The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
130
|
structure length |
100
|
Chain Sequence |
VPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPVEVLEWRFDSRLAFHHVARELHPEYF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Complex (myristylation/transferase)
|
molecule keywords |
NEGATIVE FACTOR
|
publication title |
The crystal structure of HIV-1 Nef protein bound to the Fyn kinase SH3 domain suggests a role for this complex in altered T cell receptor signaling.
pubmed doi rcsb |
source organism |
Human immunodeficiency virus 1
|
total genus |
29
|
structure length |
100
|
sequence length |
130
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 1997-09-23 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Nef Regulatory Factor | Nef Regulatory Factor |
#chains in the Genus database with same CATH superfamily 4EN2 B; 3IOZ A; 4EMZ B; 3IK5 A; 4U5W A; 3REA A; 2XI1 A; 2XI1 B; 3RBB A; 1EFN B; 1AVZ A; 1AVV A; 4D8D B; 3REB A; 4NEE C; 2NEF A; 4ORZ B; #chains in the Genus database with same CATH topology 4EN2 B; 3IOZ A; 4EMZ B; 3IK5 A; 4U5W A; 3REA A; 2XI1 A; 2XI1 B; 3RBB A; 1EFN B; 1AVZ A; 1AVV A; 4D8D B; 3REB A; 4NEE C; 2NEF A; 4ORZ B; #chains in the Genus database with same CATH homology 4EN2 B; 3IOZ A; 4EMZ B; 3IK5 A; 4U5W A; 3REA A; 2XI1 A; 2XI1 B; 3RBB A; 1EFN B; 1AVZ A; 1AVV A; 4D8D B; 3REB A; 4NEE C; 2NEF A; 4ORZ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...