The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
56
|
sequence length |
169
|
structure length |
169
|
Chain Sequence |
AMHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEETRAGARNRVDNARRLHPQADFWVAIEAGIDDDATFSWVVIDNGVQRGEARSATLPLPAVILDRVRQGEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVILALSPFHNA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom
rcsb |
molecule tags |
Structural genomics
|
source organism |
Salmonella typhimurium
|
molecule keywords |
Hypothetical UPF0244 protein yjjX
|
total genus |
56
|
structure length |
169
|
sequence length |
169
|
ec nomenclature | |
pdb deposition date | 2004-07-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01931 | NTPase_I-T | Protein of unknown function DUF84 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 3TQU A; 1EX2 A; 2I5D A; 4HEB A; 2AMH A; 3S86 A; 1B78 A; 1ZWY A; 1EXC A; 2MJP A; 2CAR A; 2ZTI A; 2DVN A; 4JHC A; 1VP2 A; 4OO0 A; 4P0U A; 2Q16 A; 2P5X A; 4LU1 A; 1K7K A; 1ZNO A; 2DVP A; 2E5X A; 2J4E A; 2PYU A; 4F95 A; 1U14 A; 4P0E A; 1U5W A; 2DVO A; 1V7R A; 4BNQ A; #chains in the Genus database with same CATH topology 4UOC A; 3TQU A; 1EX2 A; 5KVK A; 4UUX A; 2I5D A; 4CTA B; 4HEB A; 2AMH A; 3S86 A; 1B78 A; 4CT9 A; 1ZWY A; 1EXC A; 2MJP A; 2CAR A; 2ZTI A; 2DVN A; 4JHC A; 1VP2 A; 4OO0 A; 4CTA A; 4P0U A; 4UUW A; 2A9S A; 2Q16 A; 2P5X A; 4LU1 A; 5KOL A; 1K7K A; 1ZNO A; 2DVP A; 2E5X A; 2J4E A; 2PYU A; 4CT8 A; 4F95 A; 1U14 A; 4P0E A; 1U5W A; 2DVO A; 1V7R A; 4BNQ A; #chains in the Genus database with same CATH homology 3TQU A; 1EX2 A; 2I5D A; 4HEB A; 2AMH A; 3S86 A; 1B78 A; 1ZWY A; 1EXC A; 2MJP A; 2CAR A; 2ZTI A; 2DVN A; 4JHC A; 1VP2 A; 4OO0 A; 4P0U A; 2Q16 A; 2P5X A; 4LU1 A; 1K7K A; 1ZNO A; 2DVP A; 2E5X A; 2J4E A; 2PYU A; 4F95 A; 1U14 A; 4P0E A; 1U5W A; 2DVO A; 1V7R A; 4BNQ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...