1FVLA

The nuclear magnetic resonance solution structure of flavoridin, an antagonist of the platelet gp iib-iiia receptor
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GEECDCGSPSNPCCDAATCKLRPGAQCADGLCCDQCRFKKKRTICRIARGDFPDDRCTGLSNDCPRWNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation inhibitor
molecule keywords FLAVORIDIN
publication title The nuclear magnetic resonance solution structure of flavoridin, an antagonist of the platelet GP IIb-IIIa receptor.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1995-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.70.10 Few Secondary Structures Irregular Echistatin Disintegrin domain 1fvlA00
2PJIA 1Z1XA 4R5RA 1RO3A 1Q7JA 1MPZA 2W9WA 3C05B 2PJFA 1TEJB 1J2LA 3C05A 4R5UA 1Q7IA 1N4YA 1TEJA 2MP51 1FVLA 2MOP1 2W9VA 2M75A 2ECHA 3UCIA 1L3XA 1RMRA 2W9UA 2PJGA 2LJVA 4RQGA 4M4CA 2M7HA 3G5CA 2W9OA 2M7FA
chains in the Genus database with same CATH superfamily
2PJIA 1Z1XA 4R5RA 1RO3A 1Q7JA 1MPZA 2W9WA 3C05B 2PJFA 1TEJB 1J2LA 3C05A 4R5UA 1Q7IA 1N4YA 1TEJA 2MP51 1FVLA 2MOP1 2W9VA 2M75A 2ECHA 3UCIA 1L3XA 1RMRA 2W9UA 2PJGA 2LJVA 4RQGA 4M4CA 2M7HA 3G5CA 2W9OA 2M7FA
chains in the Genus database with same CATH topology
2PJIA 1Z1XA 4R5RA 1RO3A 1Q7JA 1MPZA 2W9WA 3C05B 2PJFA 1TEJB 1J2LA 3C05A 4R5UA 1Q7IA 1N4YA 1TEJA 2MP51 1FVLA 2MOP1 2W9VA 2M75A 2ECHA 3UCIA 1L3XA 1RMRA 2W9UA 2PJGA 2LJVA 4RQGA 4M4CA 2M7HA 3G5CA 2W9OA 2M7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJI A;  1Z1X A;  4R5R A;  1RO3 A;  1Q7J A;  1MPZ A;  2W9W A;  3C05 B;  2PJF A;  1TEJ B;  1J2L A;  3C05 A;  4R5U A;  1Q7I A;  1N4Y A;  1TEJ A;  2MP5 1;  1FVL A;  2MOP 1;  2W9V A;  2M75 A;  2ECH A;  3UCI A;  1L3X A;  1RMR A;  2W9U A;  2PJG A;  2LJV A;  4RQG A;  4M4C A;  2M7H A;  3G5C A;  2W9O A;  2M7F A; 
#chains in the Genus database with same CATH topology
 2PJI A;  1Z1X A;  4R5R A;  1RO3 A;  1Q7J A;  1MPZ A;  2W9W A;  3C05 B;  2PJF A;  1TEJ B;  1J2L A;  3C05 A;  4R5U A;  1Q7I A;  1N4Y A;  1TEJ A;  2MP5 1;  1FVL A;  2MOP 1;  2W9V A;  2M75 A;  2ECH A;  3UCI A;  1L3X A;  1RMR A;  2W9U A;  2PJG A;  2LJV A;  4RQG A;  4M4C A;  2M7H A;  3G5C A;  2W9O A;  2M7F A; 
#chains in the Genus database with same CATH homology
 2PJI A;  1Z1X A;  4R5R A;  1RO3 A;  1Q7J A;  1MPZ A;  2W9W A;  3C05 B;  2PJF A;  1TEJ B;  1J2L A;  3C05 A;  4R5U A;  1Q7I A;  1N4Y A;  1TEJ A;  2MP5 1;  1FVL A;  2MOP 1;  2W9V A;  2M75 A;  2ECH A;  3UCI A;  1L3X A;  1RMR A;  2W9U A;  2PJG A;  2LJV A;  4RQG A;  4M4C A;  2M7H A;  3G5C A;  2W9O A;  2M7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...