1L3XA

Solution structure of novel disintegrin salmosin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
73
structure length
73
Chain Sequence
EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKEGTICRRARGDDLDDYCNGISAGCPRNPFHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords platelet aggregation inhibitor disintegrin
publication title Solution structure of a novel disintegrin, salmosin, from Agkistrondon halys venom
pubmed doi rcsb
total genus 4
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.70.10 Few Secondary Structures Irregular Echistatin Disintegrin domain 1l3xA00
2W9VA 2M7FA 2MP51 3C05A 2W9UA 1RMRA 1TEJA 2PJFA 4R5RA 4R5UA 2MOP1 1Q7JA 1N4YA 2W9OA 2M7HA 3UCIA 1J2LA 4RQGA 1Q7IA 2PJGA 3G5CA 1L3XA 2W9WA 2ECHA 3C05B 1RO3A 4M4CA 1TEJB 2LJVA 1Z1XA 2PJIA 1FVLA 2M75A 1MPZA
chains in the Genus database with same CATH superfamily
2W9VA 2M7FA 2MP51 3C05A 2W9UA 1RMRA 1TEJA 2PJFA 4R5RA 4R5UA 2MOP1 1Q7JA 1N4YA 2W9OA 2M7HA 3UCIA 1J2LA 4RQGA 1Q7IA 2PJGA 3G5CA 1L3XA 2W9WA 2ECHA 3C05B 1RO3A 4M4CA 1TEJB 2LJVA 1Z1XA 2PJIA 1FVLA 2M75A 1MPZA
chains in the Genus database with same CATH topology
2W9VA 2M7FA 2MP51 3C05A 2W9UA 1RMRA 1TEJA 2PJFA 4R5RA 4R5UA 2MOP1 1Q7JA 1N4YA 2W9OA 2M7HA 3UCIA 1J2LA 4RQGA 1Q7IA 2PJGA 3G5CA 1L3XA 2W9WA 2ECHA 3C05B 1RO3A 4M4CA 1TEJB 2LJVA 1Z1XA 2PJIA 1FVLA 2M75A 1MPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9V A;  2M7F A;  2MP5 1;  3C05 A;  2W9U A;  1RMR A;  1TEJ A;  2PJF A;  4R5R A;  4R5U A;  2MOP 1;  1Q7J A;  1N4Y A;  2W9O A;  2M7H A;  3UCI A;  1J2L A;  4RQG A;  1Q7I A;  2PJG A;  3G5C A;  1L3X A;  2W9W A;  2ECH A;  3C05 B;  1RO3 A;  4M4C A;  1TEJ B;  2LJV A;  1Z1X A;  2PJI A;  1FVL A;  2M75 A;  1MPZ A; 
#chains in the Genus database with same CATH topology
 2W9V A;  2M7F A;  2MP5 1;  3C05 A;  2W9U A;  1RMR A;  1TEJ A;  2PJF A;  4R5R A;  4R5U A;  2MOP 1;  1Q7J A;  1N4Y A;  2W9O A;  2M7H A;  3UCI A;  1J2L A;  4RQG A;  1Q7I A;  2PJG A;  3G5C A;  1L3X A;  2W9W A;  2ECH A;  3C05 B;  1RO3 A;  4M4C A;  1TEJ B;  2LJV A;  1Z1X A;  2PJI A;  1FVL A;  2M75 A;  1MPZ A; 
#chains in the Genus database with same CATH homology
 2W9V A;  2M7F A;  2MP5 1;  3C05 A;  2W9U A;  1RMR A;  1TEJ A;  2PJF A;  4R5R A;  4R5U A;  2MOP 1;  1Q7J A;  1N4Y A;  2W9O A;  2M7H A;  3UCI A;  1J2L A;  4RQG A;  1Q7I A;  2PJG A;  3G5C A;  1L3X A;  2W9W A;  2ECH A;  3C05 B;  1RO3 A;  4M4C A;  1TEJ B;  2LJV A;  1Z1X A;  2PJI A;  1FVL A;  2M75 A;  1MPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...