The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
163
|
structure length |
163
|
Chain Sequence |
DQIAELLVESPLFSFNCAHFIAFKGFRETLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRKVCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVHRNI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution
rcsb |
| molecule keywords |
6-pyruvoyl tetrahydropterin synthase
|
| molecule tags |
Lyase, biosynthetic protein
|
| source organism |
Plasmodium vivax
|
| total genus |
45
|
| structure length |
163
|
| sequence length |
163
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
4.2.3.12: 6-pyruvoyltetrahydropterin synthase. |
| pdb deposition date | 2005-06-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01242 | PTPS | 6-pyruvoyl tetrahydropterin synthase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Tetrahydropterin Synthase; Chain A | Tetrahydropterin Synthase; Chain A |
#chains in the Genus database with same CATH superfamily 1B66 A; 4NTK A; 2DJ6 A; 3JYG A; 3M0N A; 3LX3 A; 1Y13 A; 4NTM A; 2DTT A; 4NTN A; 3QN0 A; 1GTQ A; 1B6Z A; 2G64 A; 3I2B A; 3QNA A; 2OBA A; 3LZE A; 2A0S A; 3QN9 A; 3D7J A; #chains in the Genus database with same CATH topology 1B66 A; 4NTK A; 4FVJ A; 2DJ6 A; 3JYG A; 4FVG A; 1WIN A; 4FVF A; 3M0N A; 3LX3 A; 1EFU B; 1Y13 A; 1AIP C; 4NTM A; 2DTT A; 4NTN A; 3QN0 A; 3BK6 A; 1GTQ A; 1B6Z A; 1TFE A; 2G64 A; 2RPB A; 3I2B A; 4Q7J A; 3QNA A; 2OBA A; 1XB2 B; 3LZE A; 2A0S A; 3QN9 A; 3D7J A; #chains in the Genus database with same CATH homology 1B66 A; 4NTK A; 4FVJ A; 2DJ6 A; 3JYG A; 4FVG A; 1WIN A; 4FVF A; 3M0N A; 3LX3 A; 1Y13 A; 4NTM A; 2DTT A; 4NTN A; 3QN0 A; 3BK6 A; 1GTQ A; 1B6Z A; 2G64 A; 2RPB A; 3I2B A; 3QNA A; 2OBA A; 3LZE A; 2A0S A; 3QN9 A; 3D7J A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
