1EFUB

Elongation factor complex ef-tu/ef-ts from escherichia coli
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATION FACTOR TU
publication title The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (two elongation factors)
total genus 98
structure length 282
sequence length 282
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1efuB01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 1efuB04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB03
1SG9A 1T6OA 2H5XA 1TTEA 1VEJA 2G3QA 1OTRA 2LVPC 2DAKA 1G3IA 2JZ1A 2L2DA 1XB2B 1MN3A 2DZLA 1UFZA 2KNVA 2L4FA 3IECA 4UN2B 1WJ7A 2ZTCA 2RRUA 2QNJA 2K9DA 1CUKA 1ZMUA 3GLGE 1NV8A 2ZTDA 2DAMA 3T6PA 3FRIA 3GLFE 1DO0A 2LBCA 2JY6B 1VQ1A 2MROB 1WHCA 1BVSA 1PGYA 1P3QQ 2DKLA 3K9OA 4F2LA 2WZJA 2LVOC 1HT2E 1TR8A 2LTUA 3GLHE 4HEOA 2DNAA 2HWJA 3IHPA 1HQYE 1GO5A 1HJPA 2JZ0A 1IXSA 1F4IA 4F1IA 4R71A 1QZEA 2MGWA 1VDLA 3FE3A 2DENA 2DAIA 1A5TA 1EFUB 2JY8A 3MMPA 2OOBA 3F92A 2LVQD 2DI0A 1ZV1A 1JR3E 1DV0A 3LCVB 3FRHA 1ZMVA 3H4JA 2R0IA 5JI2E 1V92A 2EKFA 3LCUA 4G3OA 2JUJA 1WR1B 1WIVA 1DO2A 4WP2A 1XXHE 1OQYA 3GLIE 1TFEA 3BMBA 2MR9A 3B89A 1KYIA 1AIPC 1YLAA 2OO9A 1C7YA 2JY7A 3K9PA 1IM2A 2JNHA 2BWBA 2O25A 5DFLA 2JY5A 2DAEA 1VG5A 2BWEA 2QSFX 2L4EA 4GEWA 2HAKA 2JP7A 1HT1E 2LVNC 1G4AE 2PN0A 2DAGA 3BBZA 1R4GA 1VEKA 3E46A 2CP8A 4DBGB 2QHOB 3E21A 1ZMWA 1VEGA 2EJSA 1WGLA 2KNAA 1G41A 1OAIA 2B3TA 1OKSA 1T43A 2KHHA 2OOAA 4Q7JA 1Q02A 2K0BX 1WGNA 1E94E 2EKKA 1IFYA 2KNZA 2LVAA 1NV9A 2MJ5B 2DHYA 2CWBA 1Y8GA
chains in the Genus database with same CATH superfamily
2C9CA 1WM9A 1T6OA 3QYEA 1IY1A 3H4MA 2QCUA 4B7GA 1OFHA 4X66M 4LZZA 3K1JA 4IBGA 3VFDA 5DNYA 2ZM6M 2E5LM 3KP0E 1FBXA 2L2DA 4Z8XA 5KO3A 1AUAA 1XB2B 1IY0A 3GP1A 2QQ8A 1NNJA 2KNVA 1UFZA 4WURA 2L4FA 2R62A 1IQPA 1L1ZA 1OJLA 3W0LB 1D2NA 2RRUA 2K9DA 4JV5M 4NE3B 3D7JA 1DGFA 3HU3A 1QDRA 3MK6A 1WPLA 2OBAA 2LNZA 3GLGE 1DGBA 1NV8A 1X37A 2ZAMA 3DZDA 3LMMA 3LVVA 3CF6E 4JI6M 2C9OA 2DAMA 2F4VM 3T6PA 3FRIA 4AKIA 3L27A 3U6MA 2LBCA 2F5QA 3VDPA 4F2LA 1IBMM 2I7PA 1T3TA 2KRKA 2M60A 2WZJA 1FNNA 1TR8A 3M0EA 2FNAA 3NBXX 4FWDA 4MGKE 4LJAA 3PXGA 4PDIA 3GLFB 3GLHE 4HEOA 2HWJA 4NRVA 2Y20A 4NL4H 3D8BA 3EIHA 3GPYA 1GO5A 1HJPA 1GTQA 4LJ9A 3WHLA 5LMNM 4G4QA 4F1IA 4II7A 3LW5G 1K82A 3L2AA 1IS8A 1NSFA 4LJ5A 1OAOC 3IG5A 3MMPA 2QENA 3HJQA 4JI0M 5FTNA 1XWIA 4KLNA 3W67A 1EE8A 1HQCA 4LFBM 4L78A 4AQYM 3L29A 3U6CA 4I81A 5KPRA 1ORYB 1SXJB 2EO2A 3PNYA 1N77A 3LZEA 4QOSA 4QPMA 2QBYA 1V92A 2MH8A 2XSZA 2WSEG 2ERCA 1WIVA 1XXHE 1TFEA 4DR6M 2J5YA 3CF0A 1XHBA 4NRWA 3HU2A 1YLAA 3CTWB 2CRUA 2JY7A 2HHHM 3AV0A 4A3VB 4E45B 1IM2A 3KSXA 3J27B 4GIPA 5DFLA 3B7ZA 2DAEA 2C99A 4JI4M 2F5OA 3L26A 4RNAA 5EP3A 4NTMA 1V33A 5BPVA 2UXBM 3Q8XA 3KP1E 1QAMA 1QUSA 4JYAM 4R3DA 5IREB 2R46A 2DAGA 3J80S 2PN0A 1QUTA 3BBZA 4P17A 1N3TA 4LJ8A 1IBLM 1WXQA 4B3MM 4DBGB 2QHOB 3J7AS 3SC3A 2LH0A 3TWLA 4JI8M 2Z7JA 2EJSA 2LWXA 4GC5A 5FSWA 2XLJA 3QNAA 3J81S 1UM8A 2HCBA 2DWMA 1GTPA 2KNAA 1G41A 4IJFA 3TPZA 3I2BA 1HR0M 4LRTA 1OKSA 1GL7A 1C1KA 2OOAA 3AL0C 4NE5B 2L09A 3FUVA 4DV3M 3LVWA 2D7HA 4BBAA 4DR2M 2CHQA 1K3WA 1E94E 1IFYA 3SBJA 4NOOB 3HHYA 3GPUA 4CISA 2NQ8C 1N32M 2L7IA 2QBYB 3I4VA 2CWBA 1B6ZA 4E44B 3B7NA 5IWAM 3GO8A 4LF7M 3L25A 2DJ6A 3FYCA 4LZJA 1OTRA 4AKHA 3W0FA 3KFUG 4NXMM 3SAUA 2F5SA 1G3IA 2JZ1A 2C5RA 1IN6A 1DGGA 5ITUA 3U6DA 2LHGA 2DZLA 4HL4A 4LFAM 2UXCM 3IECA 4UN2B 1NJFA 1NHGC 5E26A 2VIIA 5FTLA 3SASA 7CATA 1I4WA 2QNJA 1PJTA 2JA2A 1DGHA 2QZ4A 4IBCA 2ZAOA 4NC6A 4GC9A 4FCTA 3EIEA 4LF4M 4DV1M 5KPZA 4NTNA 3ILKA 1V34A 5EP4A 4IBJA 3CF2A 3GLIA 4B7FA 3WHKA 4L15A 3GLFE 4OVZA 3A46A 5LMUM 4BB9A 1DO0A 2O5RA 2JY6B 3U61A 1N34M 2W82A 3ZQJA 3MJ5A 1P3QQ 1L2BA 2CFOA 2XZFA 2LVOC 1ZAEA 4QHTA 2GNOA 5ITXA 4GHLA 3D8LA 2LTUA 2XFSA 1GJTA 1TDHA 2D7GA 4GH9A 4P16A 3UK6A 4DV4M 4GRIA 2VQEM 4DR4M 4LG2A 1F4IA 1A9CA 4R71A 1VDLA 1Q3BA 3FE3A 4MGZE 3W68A 1SXJE 3KOZE 1A5TA 4DV6M 1SXJD 5GKNA 1J09A 2H1RA 3U6OA 3U5ZB 3UMMA 5EP2A 8CATA 3T1HM 1Z5CA 2DTTA 2R65A 4X65M 2DZNB 1JR3E 2Z8YM 3HJSA 1N75A 1JR3D 4OU7A 4FCWA 1XMQM 4X62M 3QAUA 2YNMD 3LCVB 5C18A 2Z4RA 4JI7M 1Q3CA 2YR0A 2OQ4A 4GKJM 3FYDA 3KW6A 3UGJA 3RFWA 5KPTA 4FVMA 2G5GX 4B3TM 4DR5M 1WR1B 3GLGA 1DO2A 2EA0A 3U60A 3BMBA 2MR9A 1L2CA 1N3RA 3FD9A 3B89A 3KS4A 1OIPA 5FTMA 1GL6A 4G6ZA 5EXTA 2XH9A 3KSJA 4DV0M 4LRSA 3SATA 2G64A 3TQSA 4GITA 3M6AA 2O25A 2JY5A 3GLIB 3THGA 4CHTB 3A98B 4OVZB 3LW5K 3M0NA 4FVGA 2X4AA 2V1UA 1NY6A 1LTMA 2HAKA 2OPFA 3AOEC 4FCVA 4FWHA 4W5WA 1G71A 3T1YM 3GLHA 3LW5F 2CHGA 2LXEA 1ZQ9A 5F3WA 3GRVA 4GKKM 3FTDA 1R4GA 1VEKA 2JXNA 3R9XB 1GVNA 4IBBA 1YE9A 4KT0F 4XBOA 5BR8M 1W5TA 2RGOA 2R18A 4PT5A 1TH4A 3CGWA 3ZCBB 4JA3A 1IN7A 4NSRA 3AFHA 4DUYM 2CUZA 4JI1M 4IJEA 2WSEK 4BLCA 3GRRA 4L16A 4M9ZA 5FLXS 2Z4SA 2LHCA 2QPAA 5EXXA 3J7BA 2KR1A 2FFJA 2O01G 2I7NA 2CE7A 2WSEF 2VQFM 3FTEA 4I4LA 4Z6YA 1IN4A 5JI3E 3I01M 2KNZA 2APLA 1HNZM 2LVAA 4CJ6A 1HNWM 3BOSA 3NWLA 1G59A 2ZANA 2Z3XA 2D7EA 2DHYA 3PFIA 1XXHA 4G4OA 3SAVA 1W5SA 2H5XA 2O01F 3HJ8A 4PD2A 1D0KA 1TTEA 3U60B 1Z5BA 3HGIA 3HU1A 3TE6A 4YHHM 3QN9A 2A0SA 1EIJA 3HHWA 2FOIC 4M9SA 3C3DA 1NHWC 5EJCA 4L8RC 1KFVA 3FTCA 4PDGA 2FS1A 3C3EA 4LFCM 4S12A 1PM5A 4DRAE 2R45A 4IIWA 1N3SA 2RKOA 4DR3M 2BNKA 3C58A 2VDBB 1CUKA 4REZA 2VF8A 2P5TA 3FUWA 4TUWA 4B7HA 4WW0A 4M0WA 4LGMA 4LF6M 1G8PA 4AG6A 1L1TA 4I5SA 1R5LA 2C96A 2ZTDA 3M7GA 2JWSA 1JQJC 3SMPA 3JAMS 4CIZA 1IS7A 1VDDA 3A42A 3VEJA 3K2LA 2V6ZM 3TWKA 4D80A 2P11A 2V1CA 3I4YA 4RF0A 1K3XA 1VQ1A 1WHCA 3RGPA 1PGYA 2DKLA 3I04M 4DV2M 1E9RA 4GMQA 4JI5M 1TDZA 4ANRA 3T38A 1TH2A 1NJGA 1NO1A 3TL4X 2L6OA 2CV2A 2DNAA 4LGYA 1PJJA 4RKUF 4G4RA 1IXSA 1XMOM 3LQRA 2KW0A 3SHFA 2DWLA 1QZMA 3FUXA 2MGWA 2RGHA 2KZUA 3E9SA 2WSCG 2DAIA 4Y28F 3B9PA 2Q2EB 2Y21A 2LVQD 3HZJA 2CHVA 3KDSE 3AOEA 3KS8A 4AZFA 2WSCK 2R4EA 1ZV1A 4YY3M 3U6QA 2HKJA 3SYLA 3AJIB 4JI2M 1GABA 1EL6A 1MU5A 4M9XA 2WSCF 2DZOB 4I8OA 3FRHA 3HHZA 1ZMVA 3H4JA 3R8FA 3FTFA 2DHRA 4AI6A 4D82A 1OFIA 2YFQA 4XK8F 3SAWA 1TF0B 3KOXE 1WINA 1NY5A 2DVWB 3GLIE 1OQYA 1N78A 3PNVA 2G8LA 3HWSA 1KYIA 4NSOB 4IBDA 4RF1A 3LX3A 2OO9A 1QAQA 1C7YA 3K9PA 4LF9M 1TH3A 3I51A 3JR4A 2JNHA 3GLFA 3B74A 2ZBKB 4EIWA 2BWEA 4DU6A 4IBEA 2BJVA 2L4EA 1XNQM 2L7HA 1QANA 2Y0TA 1OIZA 5ITRA 4DR1M 4NTKA 4GEWA 3ZH9B 2M5ZA 1HT1E 3B7QA 3FUUA 2GQFA 1R2YA 4K0KM 4MGHA 4QOZC 2XEPA 2KXEA 1G4AE 2FE8A 3V76A 1IXZA 4D81A 3SFZA 4GHAA 3E46A 3KVWA 4MB7A 1GKIA 1YSYA 5EXSA 1GLNA 2CP8A 1I94M 4LY6A 1IXSB 1SXJA 1ZMWA 2KRUA 5A2QS 1TGUA 1DGHB 5FTKA 4OW0A 1J7KA 1QAOA 1WGLA 3HHXA 4LJ6A 1QQWA 5EP1A 1JR3A 3RGSA 1R6BX 2KHHA 1T43A 2AHMA 1QDTA 4MGIE 2XGNA 1Q02A 1B66A 4MGYE 4DV5M 4B3RM 4AKGA 4IBIA 2EKKA 2CV1A 3FUTA 3QN0A 4ZPXA 4DUZM 1L2DA 1R7RA 2MJ5B 2KEBA 3U61B 5FTJA 2RPBA 2JUJA 5DYGA 1SG9A 2J7NA 4FW9A 4QNRA 1VEJA 2G3QA 2KZSA 2LVPC 2DAKA 5DYIA 4JI3M 1XC8A 3J2PB 3U6EA 3TWMA 5EQTA 1WUQA 3DOAA 3AOGA 3HY5A 1MN3A 4JN6A 5L8RF 1Q39A 2QP9X 4G4NA 3B0BC 1KSFX 1NVMA 1WJ7A 2X8AA 2ZTCA 5ITQA 1GJSA 2UXDM 3RE8A 1N36M 1YUBA 2DWNA 1S3SA 4JXJA 4L4UA 1FJGM 4FVJA 5KQDA 3K92A 3ZC7B 2XSZD 2X49A 1ZMUA 2CEAA 1IY2A 3BK6A 3Q8GA 2UUCM 2BJWA 2EUCA 2XZUA 2C98A 2HL7A 4MM3B 1H6UA 4MH0E 4LF5M 4IBFA 3GLGB 2MROB 2UU9M 1N33M 1D0LA 3NBIA 2WSFG 1BVSA 3FKEA 3UZUA 3K9OA 2J7OA 3SYKA 2WSFK 2KDLA 3QYBA 1HT2E 4XGIA 5E6JA 4ITQA 4M0DA 1HNXM 1IN5A 1MJGM 1SXJC 2FH0A 4KO8A 1PJSA 2LNHC 1HQYE 3IHPA 4FVFA 1RU3A 2WSFF 2JZ0A 2K47A 1R2ZA 2Y0QA 1QZEA 4KODA 2DENA 3K8ZA 1EFUB 2JY8A 3GLHB 3AKZA 3F92A 1PJQA 3GRYA 1WURA 4R8QA 1IBKM 2DI0A 3GPPA 3QWLA 3JYGA 1A8RA 2DXIA 5IZ7D 2R4JA 2XFTA 1DV0A 5ITTA 3VK7A 5ITYA 1MX0A 1Z5AA 3U6LA 3OTOM 2KA6B 3VKGA 5H37D 4NXNM 4DR7M 2R0IA 3A45A 5JI2E 3LCUA 2EKFA 4G3OA 4LCBA 3VKHA 5IT9S 1D0MA 3PVSA 2F5NA 3DA1A 2YQZA 3HX3A 4LJ4A 4WP2A 5C1BA 4NE6B 3GQ4A 3C9PA 1Z59A 4HLQA 3GQ5A 3U6PA 1AIPC 3KOYE 5DMZA 1QVRA 2BWBA 2R44A 3E4RA 1XNRM 1L8QA 1XXHB 2VF7A 3DFZA 1IXRC 1VG5A 3LQQA 2QSFX 1LV7A 3GQ3A 2R6FA 3L28A 3VK8A 3MHVC 3IG8A 1NNUC 3BXWA 4B3SM 4OX9M 2LVNC 1PRBA 1JB0F 3U5ZA 2LO0A 2DWZB 3GRUA 2A5YB 1PJIA 2F5PA 3UJNA 4DV7M 4IBKA 4X64M 4AG5A 3E21A 4QHSA 1VEGA 3HKPA 1J5EM 4LF8M 4L6V6 4CGYB 4QNMA 2N35A 2XF3A 3KXEC 4LJ7A 2UUAM 3GPXA 2CV0A 1E9SA 1OAIA 2B3TA 1Y13A 4AW4A 5KQ8A 3JR5A 1QYRA 4Q7JA 1Z6TA 4FD2A 4DRBJ 1IN8A 1E32A 2UUBM 3T15A 2K0BX 1WGNA 3VLFB 3KOWE 3SMSA 4R7GA 3VDUA 5ITXE 1FB1A 3U6SA 4FWGA 5EXPA 2K6BA 4PCZA 1NV9A 4B08A 3SARA 2OOBA 4KHPM 3SHGB 2JP7A 1Y8GA
chains in the Genus database with same CATH topology
1SG9A 1WM9A 1T6OA 2H5XA 4E44B 1TTEA 1VEJA 2G3QA 1OTRA 2LVPC 2DAKA 1WUQA 1G3IA 2JZ1A 2L2DA 1FBXA 1XB2B 1MN3A 2DZLA 1UFZA 2KNVA 2L4FA 3B0BC 3IECA 4UN2B 1WJ7A 2ZTCA 4DRAE 1N3SA 2RRUA 2QNJA 2K9DA 1CUKA 4NE3B 1WPLA 2LNZA 1ZMUA 3GLGE 1NV8A 2ZTDA 2DAMA 3VEJA 3T6PA 2P11A 3FRIA 3GLFE 1DO0A 2LBCA 2JY6B 1VQ1A 2MROB 1WHCA 1BVSA 1PGYA 1P3QQ 2DKLA 3K9OA 4F2LA 2WZJA 2LVOC 1HT2E 1TR8A 2LTUA 3GLHE 4HEOA 2DNAA 2HWJA 3IHPA 1HQYE 1GO5A 1HJPA 2JZ0A 1IXSA 1F4IA 1A9CA 4F1IA 4R71A 1QZEA 2MGWA 1IS8A 1VDLA 3FE3A 2DENA 2DAIA 1A5TA 1EFUB 2JY8A 3MMPA 2OOBA 3F92A 2LVQD 1WURA 4R8QA 2DI0A 1ZV1A 1EL6A 1JR3E 1A8RA 1DV0A 3LCVB 3FRHA 1ZMVA 3H4JA 4QPMA 2R0IA 5JI2E 1V92A 2EKFA 3LCUA 4G3OA 2JUJA 1WR1B 1WIVA 1DO2A 4WP2A 1XXHE 1OQYA 3GLIE 1TFEA 3BMBA 2MR9A 4NE6B 1N3RA 3B89A 1KYIA 1AIPC 1YLAA 2OO9A 1C7YA 2JY7A 3K9PA 4E45B 5DMZA 1IM2A 2JNHA 2BWBA 2O25A 5DFLA 2JY5A 2DAEA 1VG5A 2BWEA 4DU6A 2QSFX 2L4EA 4GEWA 2HAKA 2JP7A 1HT1E 2LVNC 1G4AE 2LO0A 2PN0A 2DAGA 3BBZA 1N3TA 1R4GA 1VEKA 3E46A 1IS7A 2CP8A 4DBGB 2QHOB 3E21A 1ZMWA 1VEGA 4JA3A 2EJSA 1GTPA 1WGLA 2KNAA 1G41A 1OAIA 2B3TA 1OKSA 1T43A 2KHHA 2OOAA 4Q7JA 4NE5B 1Q02A 2KR1A 4DRBJ 2K0BX 1WGNA 1E94E 2EKKA 1IFYA 1FB1A 2KNZA 2LVAA 1NV9A 2MJ5B 2DHYA 2CWBA 1Y8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SG9 A;  1T6O A;  2H5X A;  1TTE A;  1VEJ A;  2G3Q A;  1OTR A;  2LVP C;  2DAK A;  1G3I A;  2JZ1 A;  2L2D A;  1XB2 B;  1MN3 A;  2DZL A;  1UFZ A;  2KNV A;  2L4F A;  3IEC A;  4UN2 B;  1WJ7 A;  2ZTC A;  2RRU A;  2QNJ A;  2K9D A;  1CUK A;  1ZMU A;  3GLG E;  1NV8 A;  2ZTD A;  2DAM A;  3T6P A;  3FRI A;  3GLF E;  1DO0 A;  2LBC A;  2JY6 B;  1VQ1 A;  2MRO B;  1WHC A;  1BVS A;  1PGY A;  1P3Q Q;  2DKL A;  3K9O A;  4F2L A;  2WZJ A;  2LVO C;  1HT2 E;  1TR8 A;  2LTU A;  3GLH E;  4HEO A;  2DNA A;  2HWJ A;  3IHP A;  1HQY E;  1GO5 A;  1HJP A;  2JZ0 A;  1IXS A;  1F4I A;  4F1I A;  4R71 A;  1QZE A;  2MGW A;  1VDL A;  3FE3 A;  2DEN A;  2DAI A;  1A5T A;  1EFU B;  2JY8 A;  3MMP A;  2OOB A;  3F92 A;  2LVQ D;  2DI0 A;  1ZV1 A;  1JR3 E;  1DV0 A;  3LCV B;  3FRH A;  1ZMV A;  3H4J A;  2R0I A;  5JI2 E;  1V92 A;  2EKF A;  3LCU A;  4G3O A;  2JUJ A;  1WR1 B;  1WIV A;  1DO2 A;  4WP2 A;  1XXH E;  1OQY A;  3GLI E;  1TFE A;  3BMB A;  2MR9 A;  3B89 A;  1KYI A;  1AIP C;  1YLA A;  2OO9 A;  1C7Y A;  2JY7 A;  3K9P A;  1IM2 A;  2JNH A;  2BWB A;  2O25 A;  5DFL A;  2JY5 A;  2DAE A;  1VG5 A;  2BWE A;  2QSF X;  2L4E A;  4GEW A;  2HAK A;  2JP7 A;  1HT1 E;  2LVN C;  1G4A E;  2PN0 A;  2DAG A;  3BBZ A;  1R4G A;  1VEK A;  3E46 A;  2CP8 A;  4DBG B;  2QHO B;  3E21 A;  1ZMW A;  1VEG A;  2EJS A;  1WGL A;  2KNA A;  1G41 A;  1OAI A;  2B3T A;  1OKS A;  1T43 A;  2KHH A;  2OOA A;  4Q7J A;  1Q02 A;  2K0B X;  1WGN A;  1E94 E;  2EKK A;  1IFY A;  2KNZ A;  2LVA A;  1NV9 A;  2MJ5 B;  2DHY A;  2CWB A;  1Y8G A; 
#chains in the Genus database with same CATH topology
 2C9C A;  1WM9 A;  1T6O A;  3QYE A;  1IY1 A;  3H4M A;  2QCU A;  4B7G A;  1OFH A;  4X66 M;  4LZZ A;  3K1J A;  4IBG A;  3VFD A;  5DNY A;  2ZM6 M;  2E5L M;  3KP0 E;  1FBX A;  2L2D A;  4Z8X A;  5KO3 A;  1AUA A;  1XB2 B;  1IY0 A;  3GP1 A;  2QQ8 A;  1NNJ A;  2KNV A;  1UFZ A;  4WUR A;  2L4F A;  2R62 A;  1IQP A;  1L1Z A;  1OJL A;  3W0L B;  1D2N A;  2RRU A;  2K9D A;  4JV5 M;  4NE3 B;  3D7J A;  1DGF A;  3HU3 A;  1QDR A;  3MK6 A;  1WPL A;  2OBA A;  2LNZ A;  3GLG E;  1DGB A;  1NV8 A;  1X37 A;  2ZAM A;  3DZD A;  3LMM A;  3LVV A;  3CF6 E;  4JI6 M;  2C9O A;  2DAM A;  2F4V M;  3T6P A;  3FRI A;  4AKI A;  3L27 A;  3U6M A;  2LBC A;  2F5Q A;  3VDP A;  4F2L A;  1IBM M;  2I7P A;  1T3T A;  2KRK A;  2M60 A;  2WZJ A;  1FNN A;  1TR8 A;  3M0E A;  2FNA A;  3NBX X;  4FWD A;  4MGK E;  4LJA A;  3PXG A;  4PDI A;  3GLF B;  3GLH E;  4HEO A;  2HWJ A;  4NRV A;  2Y20 A;  4NL4 H;  3D8B A;  3EIH A;  3GPY A;  1GO5 A;  1HJP A;  1GTQ A;  4LJ9 A;  3WHL A;  5LMN M;  4G4Q A;  4F1I A;  4II7 A;  3LW5 G;  1K82 A;  3L2A A;  1IS8 A;  1NSF A;  4LJ5 A;  1OAO C;  3IG5 A;  3MMP A;  2QEN A;  3HJQ A;  4JI0 M;  5FTN A;  1XWI A;  4KLN A;  3W67 A;  1EE8 A;  1HQC A;  4LFB M;  4L78 A;  4AQY M;  3L29 A;  3U6C A;  4I81 A;  5KPR A;  1ORY B;  1SXJ B;  2EO2 A;  3PNY A;  1N77 A;  3LZE A;  4QOS A;  4QPM A;  2QBY A;  1V92 A;  2MH8 A;  2XSZ A;  2WSE G;  2ERC A;  1WIV A;  1XXH E;  1TFE A;  4DR6 M;  2J5Y A;  3CF0 A;  1XHB A;  4NRW A;  3HU2 A;  1YLA A;  3CTW B;  2CRU A;  2JY7 A;  2HHH M;  3AV0 A;  4A3V B;  4E45 B;  1IM2 A;  3KSX A;  3J27 B;  4GIP A;  5DFL A;  3B7Z A;  2DAE A;  2C99 A;  4JI4 M;  2F5O A;  3L26 A;  4RNA A;  5EP3 A;  4NTM A;  1V33 A;  5BPV A;  2UXB M;  3Q8X A;  3KP1 E;  1QAM A;  1QUS A;  4JYA M;  4R3D A;  5IRE B;  2R46 A;  2DAG A;  3J80 S;  2PN0 A;  1QUT A;  3BBZ A;  4P17 A;  1N3T A;  4LJ8 A;  1IBL M;  1WXQ A;  4B3M M;  4DBG B;  2QHO B;  3J7A S;  3SC3 A;  2LH0 A;  3TWL A;  4JI8 M;  2Z7J A;  2EJS A;  2LWX A;  4GC5 A;  5FSW A;  2XLJ A;  3QNA A;  3J81 S;  1UM8 A;  2HCB A;  2DWM A;  1GTP A;  2KNA A;  1G41 A;  4IJF A;  3TPZ A;  3I2B A;  1HR0 M;  4LRT A;  1OKS A;  1GL7 A;  1C1K A;  2OOA A;  3AL0 C;  4NE5 B;  2L09 A;  3FUV A;  4DV3 M;  3LVW A;  2D7H A;  4BBA A;  4DR2 M;  2CHQ A;  1K3W A;  1E94 E;  1IFY A;  3SBJ A;  4NOO B;  3HHY A;  3GPU A;  4CIS A;  2NQ8 C;  1N32 M;  2L7I A;  2QBY B;  3I4V A;  2CWB A;  1B6Z A;  4E44 B;  3B7N A;  5IWA M;  3GO8 A;  4LF7 M;  3L25 A;  2DJ6 A;  3FYC A;  4LZJ A;  1OTR A;  4AKH A;  3W0F A;  3KFU G;  4NXM M;  3SAU A;  2F5S A;  1G3I A;  2JZ1 A;  2C5R A;  1IN6 A;  1DGG A;  5ITU A;  3U6D A;  2LHG A;  2DZL A;  4HL4 A;  4LFA M;  2UXC M;  3IEC A;  4UN2 B;  1NJF A;  1NHG C;  5E26 A;  2VII A;  5FTL A;  3SAS A;  7CAT A;  1I4W A;  2QNJ A;  1PJT A;  2JA2 A;  1DGH A;  2QZ4 A;  4IBC A;  2ZAO A;  4NC6 A;  4GC9 A;  4FCT A;  3EIE A;  4LF4 M;  4DV1 M;  5KPZ A;  4NTN A;  3ILK A;  1V34 A;  5EP4 A;  4IBJ A;  3CF2 A;  3GLI A;  4B7F A;  3WHK A;  4L15 A;  3GLF E;  4OVZ A;  3A46 A;  5LMU M;  4BB9 A;  1DO0 A;  2O5R A;  2JY6 B;  3U61 A;  1N34 M;  2W82 A;  3ZQJ A;  3MJ5 A;  1P3Q Q;  1L2B A;  2CFO A;  2XZF A;  2LVO C;  1ZAE A;  4QHT A;  2GNO A;  5ITX A;  4GHL A;  3D8L A;  2LTU A;  2XFS A;  1GJT A;  1TDH A;  2D7G A;  4GH9 A;  4P16 A;  3UK6 A;  4DV4 M;  4GRI A;  2VQE M;  4DR4 M;  4LG2 A;  1F4I A;  1A9C A;  4R71 A;  1VDL A;  1Q3B A;  3FE3 A;  4MGZ E;  3W68 A;  1SXJ E;  3KOZ E;  1A5T A;  4DV6 M;  1SXJ D;  5GKN A;  1J09 A;  2H1R A;  3U6O A;  3U5Z B;  3UMM A;  5EP2 A;  8CAT A;  3T1H M;  1Z5C A;  2DTT A;  2R65 A;  4X65 M;  2DZN B;  1JR3 E;  2Z8Y M;  3HJS A;  1N75 A;  1JR3 D;  4OU7 A;  4FCW A;  1XMQ M;  4X62 M;  3QAU A;  2YNM D;  3LCV B;  5C18 A;  2Z4R A;  4JI7 M;  1Q3C A;  2YR0 A;  2OQ4 A;  4GKJ M;  3FYD A;  3KW6 A;  3UGJ A;  3RFW A;  5KPT A;  4FVM A;  2G5G X;  4B3T M;  4DR5 M;  1WR1 B;  3GLG A;  1DO2 A;  2EA0 A;  3U60 A;  3BMB A;  2MR9 A;  1L2C A;  1N3R A;  3FD9 A;  3B89 A;  3KS4 A;  1OIP A;  5FTM A;  1GL6 A;  4G6Z A;  5EXT A;  2XH9 A;  3KSJ A;  4DV0 M;  4LRS A;  3SAT A;  2G64 A;  3TQS A;  4GIT A;  3M6A A;  2O25 A;  2JY5 A;  3GLI B;  3THG A;  4CHT B;  3A98 B;  4OVZ B;  3LW5 K;  3M0N A;  4FVG A;  2X4A A;  2V1U A;  1NY6 A;  1LTM A;  2HAK A;  2OPF A;  3AOE C;  4FCV A;  4FWH A;  4W5W A;  1G71 A;  3T1Y M;  3GLH A;  3LW5 F;  2CHG A;  2LXE A;  1ZQ9 A;  5F3W A;  3GRV A;  4GKK M;  3FTD A;  1R4G A;  1VEK A;  2JXN A;  3R9X B;  1GVN A;  4IBB A;  1YE9 A;  4KT0 F;  4XBO A;  5BR8 M;  1W5T A;  2RGO A;  2R18 A;  4PT5 A;  1TH4 A;  3CGW A;  3ZCB B;  4JA3 A;  1IN7 A;  4NSR A;  3AFH A;  4DUY M;  2CUZ A;  4JI1 M;  4IJE A;  2WSE K;  4BLC A;  3GRR A;  4L16 A;  4M9Z A;  5FLX S;  2Z4S A;  2LHC A;  2QPA A;  5EXX A;  3J7B A;  2KR1 A;  2FFJ A;  2O01 G;  2I7N A;  2CE7 A;  2WSE F;  2VQF M;  3FTE A;  4I4L A;  4Z6Y A;  1IN4 A;  5JI3 E;  3I01 M;  2KNZ A;  2APL A;  1HNZ M;  2LVA A;  4CJ6 A;  1HNW M;  3BOS A;  3NWL A;  1G59 A;  2ZAN A;  2Z3X A;  2D7E A;  2DHY A;  3PFI A;  1XXH A;  4G4O A;  3SAV A;  1W5S A;  2H5X A;  2O01 F;  3HJ8 A;  4PD2 A;  1D0K A;  1TTE A;  3U60 B;  1Z5B A;  3HGI A;  3HU1 A;  3TE6 A;  4YHH M;  3QN9 A;  2A0S A;  1EIJ A;  3HHW A;  2FOI C;  4M9S A;  3C3D A;  1NHW C;  5EJC A;  4L8R C;  1KFV A;  3FTC A;  4PDG A;  2FS1 A;  3C3E A;  4LFC M;  4S12 A;  1PM5 A;  4DRA E;  2R45 A;  4IIW A;  1N3S A;  2RKO A;  4DR3 M;  2BNK A;  3C58 A;  2VDB B;  1CUK A;  4REZ A;  2VF8 A;  2P5T A;  3FUW A;  4TUW A;  4B7H A;  4WW0 A;  4M0W A;  4LGM A;  4LF6 M;  1G8P A;  4AG6 A;  1L1T A;  4I5S A;  1R5L A;  2C96 A;  2ZTD A;  3M7G A;  2JWS A;  1JQJ C;  3SMP A;  3JAM S;  4CIZ A;  1IS7 A;  1VDD A;  3A42 A;  3VEJ A;  3K2L A;  2V6Z M;  3TWK A;  4D80 A;  2P11 A;  2V1C A;  3I4Y A;  4RF0 A;  1K3X A;  1VQ1 A;  1WHC A;  3RGP A;  1PGY A;  2DKL A;  3I04 M;  4DV2 M;  1E9R A;  4GMQ A;  4JI5 M;  1TDZ A;  4ANR A;  3T38 A;  1TH2 A;  1NJG A;  1NO1 A;  3TL4 X;  2L6O A;  2CV2 A;  2DNA A;  4LGY A;  1PJJ A;  4RKU F;  4G4R A;  1IXS A;  1XMO M;  3LQR A;  2KW0 A;  3SHF A;  2DWL A;  1QZM A;  3FUX A;  2MGW A;  2RGH A;  2KZU A;  3E9S A;  2WSC G;  2DAI A;  4Y28 F;  3B9P A;  2Q2E B;  2Y21 A;  2LVQ D;  3HZJ A;  2CHV A;  3KDS E;  3AOE A;  3KS8 A;  4AZF A;  2WSC K;  2R4E A;  1ZV1 A;  4YY3 M;  3U6Q A;  2HKJ A;  3SYL A;  3AJI B;  4JI2 M;  1GAB A;  1EL6 A;  1MU5 A;  4M9X A;  2WSC F;  2DZO B;  4I8O A;  3FRH A;  3HHZ A;  1ZMV A;  3H4J A;  3R8F A;  3FTF A;  2DHR A;  4AI6 A;  4D82 A;  1OFI A;  2YFQ A;  4XK8 F;  3SAW A;  1TF0 B;  3KOX E;  1WIN A;  1NY5 A;  2DVW B;  3GLI E;  1OQY A;  1N78 A;  3PNV A;  2G8L A;  3HWS A;  1KYI A;  4NSO B;  4IBD A;  4RF1 A;  3LX3 A;  2OO9 A;  1QAQ A;  1C7Y A;  3K9P A;  4LF9 M;  1TH3 A;  3I51 A;  3JR4 A;  2JNH A;  3GLF A;  3B74 A;  2ZBK B;  4EIW A;  2BWE A;  4DU6 A;  4IBE A;  2BJV A;  2L4E A;  1XNQ M;  2L7H A;  1QAN A;  2Y0T A;  1OIZ A;  5ITR A;  4DR1 M;  4NTK A;  4GEW A;  3ZH9 B;  2M5Z A;  1HT1 E;  3B7Q A;  3FUU A;  2GQF A;  1R2Y A;  4K0K M;  4MGH A;  4QOZ C;  2XEP A;  2KXE A;  1G4A E;  2FE8 A;  3V76 A;  1IXZ A;  4D81 A;  3SFZ A;  4GHA A;  3E46 A;  3KVW A;  4MB7 A;  1GKI A;  1YSY A;  5EXS A;  1GLN A;  2CP8 A;  1I94 M;  4LY6 A;  1IXS B;  1SXJ A;  1ZMW A;  2KRU A;  5A2Q S;  1TGU A;  1DGH B;  5FTK A;  4OW0 A;  1J7K A;  1QAO A;  1WGL A;  3HHX A;  4LJ6 A;  1QQW A;  5EP1 A;  1JR3 A;  3RGS A;  1R6B X;  2KHH A;  1T43 A;  2AHM A;  1QDT A;  4MGI E;  2XGN A;  1Q02 A;  1B66 A;  4MGY E;  4DV5 M;  4B3R M;  4AKG A;  4IBI A;  2EKK A;  2CV1 A;  3FUT A;  3QN0 A;  4ZPX A;  4DUZ M;  1L2D A;  1R7R A;  2MJ5 B;  2KEB A;  3U61 B;  5FTJ A;  2RPB A;  2JUJ A;  5DYG A;  1SG9 A;  2J7N A;  4FW9 A;  4QNR A;  1VEJ A;  2G3Q A;  2KZS A;  2LVP C;  2DAK A;  5DYI A;  4JI3 M;  1XC8 A;  3J2P B;  3U6E A;  3TWM A;  5EQT A;  1WUQ A;  3DOA A;  3AOG A;  3HY5 A;  1MN3 A;  4JN6 A;  5L8R F;  1Q39 A;  2QP9 X;  4G4N A;  3B0B C;  1KSF X;  1NVM A;  1WJ7 A;  2X8A A;  2ZTC A;  5ITQ A;  1GJS A;  2UXD M;  3RE8 A;  1N36 M;  1YUB A;  2DWN A;  1S3S A;  4JXJ A;  4L4U A;  1FJG M;  4FVJ A;  5KQD A;  3K92 A;  3ZC7 B;  2XSZ D;  2X49 A;  1ZMU A;  2CEA A;  1IY2 A;  3BK6 A;  3Q8G A;  2UUC M;  2BJW A;  2EUC A;  2XZU A;  2C98 A;  2HL7 A;  4MM3 B;  1H6U A;  4MH0 E;  4LF5 M;  4IBF A;  3GLG B;  2MRO B;  2UU9 M;  1N33 M;  1D0L A;  3NBI A;  2WSF G;  1BVS A;  3FKE A;  3UZU A;  3K9O A;  2J7O A;  3SYK A;  2WSF K;  2KDL A;  3QYB A;  1HT2 E;  4XGI A;  5E6J A;  4ITQ A;  4M0D A;  1HNX M;  1IN5 A;  1MJG M;  1SXJ C;  2FH0 A;  4KO8 A;  1PJS A;  2LNH C;  1HQY E;  3IHP A;  4FVF A;  1RU3 A;  2WSF F;  2JZ0 A;  2K47 A;  1R2Z A;  2Y0Q A;  1QZE A;  4KOD A;  2DEN A;  3K8Z A;  1EFU B;  2JY8 A;  3GLH B;  3AKZ A;  3F92 A;  1PJQ A;  3GRY A;  1WUR A;  4R8Q A;  1IBK M;  2DI0 A;  3GPP A;  3QWL A;  3JYG A;  1A8R A;  2DXI A;  5IZ7 D;  2R4J A;  2XFT A;  1DV0 A;  5ITT A;  3VK7 A;  5ITY A;  1MX0 A;  1Z5A A;  3U6L A;  3OTO M;  2KA6 B;  3VKG A;  5H37 D;  4NXN M;  4DR7 M;  2R0I A;  3A45 A;  5JI2 E;  3LCU A;  2EKF A;  4G3O A;  4LCB A;  3VKH A;  5IT9 S;  1D0M A;  3PVS A;  2F5N A;  3DA1 A;  2YQZ A;  3HX3 A;  4LJ4 A;  4WP2 A;  5C1B A;  4NE6 B;  3GQ4 A;  3C9P A;  1Z59 A;  4HLQ A;  3GQ5 A;  3U6P A;  1AIP C;  3KOY E;  5DMZ A;  1QVR A;  2BWB A;  2R44 A;  3E4R A;  1XNR M;  1L8Q A;  1XXH B;  2VF7 A;  3DFZ A;  1IXR C;  1VG5 A;  3LQQ A;  2QSF X;  1LV7 A;  3GQ3 A;  2R6F A;  3L28 A;  3VK8 A;  3MHV C;  3IG8 A;  1NNU C;  3BXW A;  4B3S M;  4OX9 M;  2LVN C;  1PRB A;  1JB0 F;  3U5Z A;  2LO0 A;  2DWZ B;  3GRU A;  2A5Y B;  1PJI A;  2F5P A;  3UJN A;  4DV7 M;  4IBK A;  4X64 M;  4AG5 A;  3E21 A;  4QHS A;  1VEG A;  3HKP A;  1J5E M;  4LF8 M;  4L6V 6;  4CGY B;  4QNM A;  2N35 A;  2XF3 A;  3KXE C;  4LJ7 A;  2UUA M;  3GPX A;  2CV0 A;  1E9S A;  1OAI A;  2B3T A;  1Y13 A;  4AW4 A;  5KQ8 A;  3JR5 A;  1QYR A;  4Q7J A;  1Z6T A;  4FD2 A;  4DRB J;  1IN8 A;  1E32 A;  2UUB M;  3T15 A;  2K0B X;  1WGN A;  3VLF B;  3KOW E;  3SMS A;  4R7G A;  3VDU A;  5ITX E;  1FB1 A;  3U6S A;  4FWG A;  5EXP A;  2K6B A;  4PCZ A;  1NV9 A;  4B08 A;  3SAR A;  2OOB A;  4KHP M;  3SHG B;  2JP7 A;  1Y8G A; 
#chains in the Genus database with same CATH homology
 1SG9 A;  1WM9 A;  1T6O A;  2H5X A;  4E44 B;  1TTE A;  1VEJ A;  2G3Q A;  1OTR A;  2LVP C;  2DAK A;  1WUQ A;  1G3I A;  2JZ1 A;  2L2D A;  1FBX A;  1XB2 B;  1MN3 A;  2DZL A;  1UFZ A;  2KNV A;  2L4F A;  3B0B C;  3IEC A;  4UN2 B;  1WJ7 A;  2ZTC A;  4DRA E;  1N3S A;  2RRU A;  2QNJ A;  2K9D A;  1CUK A;  4NE3 B;  1WPL A;  2LNZ A;  1ZMU A;  3GLG E;  1NV8 A;  2ZTD A;  2DAM A;  3VEJ A;  3T6P A;  2P11 A;  3FRI A;  3GLF E;  1DO0 A;  2LBC A;  2JY6 B;  1VQ1 A;  2MRO B;  1WHC A;  1BVS A;  1PGY A;  1P3Q Q;  2DKL A;  3K9O A;  4F2L A;  2WZJ A;  2LVO C;  1HT2 E;  1TR8 A;  2LTU A;  3GLH E;  4HEO A;  2DNA A;  2HWJ A;  3IHP A;  1HQY E;  1GO5 A;  1HJP A;  2JZ0 A;  1IXS A;  1F4I A;  1A9C A;  4F1I A;  4R71 A;  1QZE A;  2MGW A;  1IS8 A;  1VDL A;  3FE3 A;  2DEN A;  2DAI A;  1A5T A;  1EFU B;  2JY8 A;  3MMP A;  2OOB A;  3F92 A;  2LVQ D;  1WUR A;  4R8Q A;  2DI0 A;  1ZV1 A;  1EL6 A;  1JR3 E;  1A8R A;  1DV0 A;  3LCV B;  3FRH A;  1ZMV A;  3H4J A;  4QPM A;  2R0I A;  5JI2 E;  1V92 A;  2EKF A;  3LCU A;  4G3O A;  2JUJ A;  1WR1 B;  1WIV A;  1DO2 A;  4WP2 A;  1XXH E;  1OQY A;  3GLI E;  1TFE A;  3BMB A;  2MR9 A;  4NE6 B;  1N3R A;  3B89 A;  1KYI A;  1AIP C;  1YLA A;  2OO9 A;  1C7Y A;  2JY7 A;  3K9P A;  4E45 B;  5DMZ A;  1IM2 A;  2JNH A;  2BWB A;  2O25 A;  5DFL A;  2JY5 A;  2DAE A;  1VG5 A;  2BWE A;  4DU6 A;  2QSF X;  2L4E A;  4GEW A;  2HAK A;  2JP7 A;  1HT1 E;  2LVN C;  1G4A E;  2LO0 A;  2PN0 A;  2DAG A;  3BBZ A;  1N3T A;  1R4G A;  1VEK A;  3E46 A;  1IS7 A;  2CP8 A;  4DBG B;  2QHO B;  3E21 A;  1ZMW A;  1VEG A;  4JA3 A;  2EJS A;  1GTP A;  1WGL A;  2KNA A;  1G41 A;  1OAI A;  2B3T A;  1OKS A;  1T43 A;  2KHH A;  2OOA A;  4Q7J A;  4NE5 B;  1Q02 A;  2KR1 A;  4DRB J;  2K0B X;  1WGN A;  1E94 E;  2EKK A;  1IFY A;  1FB1 A;  2KNZ A;  2LVA A;  1NV9 A;  2MJ5 B;  2DHY A;  2CWB A;  1Y8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...