1EFUB

Elongation factor complex ef-tu/ef-ts from escherichia coli
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (two elongation factors)
molecule keywords ELONGATION FACTOR TU
total genus 98
structure length 282
sequence length 282
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1efuB01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 1efuB04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB03
2HAKA 2DZLA 1YLAA 1G4AE 2JZ0A 1ZMVA 2KNZA 2OO9A 2QSFX 3FRIA 3F92A 1WHCA 4Q7JA 1NV9A 2WZJA 2JNHA 4F2LA 2EKFA 1VEKA 1QZEA 1IXSA 2MGWA 3GLFE 2B3TA 1DO0A 1EFUB 2JY6B 2JZ1A 3K9PA 2DNAA 1SG9A 1AIPC 3IECA 3K9OA 3E46A 3LCUA 1WR1B 1IM2A 2K9DA 1HQYE 1OQYA 1ZMUA 1PGYA 2DAEA 2LTUA 2PN0A 2DAKA 2JUJA 1Y8GA 4UN2B 1DO2A 1HJPA 1ZV1A 2G3QA 1A5TA 2JY8A 2CWBA 1CUKA 2DAIA 1VEGA 1TTEA 2DI0A 2KHHA 2DKLA 2ZTCA 3T6PA 1WGLA 4R71A 1VQ1A 4WP2A 1G3IA 3B89A 1OAIA 1T6OA 1T43A 1OKSA 3LCVB 2L4EA 1XXHE 2LVNC 4GEWA 2R0IA 1R4GA 1G41A 1JR3E 2O25A 1C7YA 1TR8A 1VG5A 2OOBA 5JI2E 1KYIA 2L4FA 5DFLA 2ZTDA 3GLGE 2JP7A 2QHOB 2MR9A 2EJSA 2MROB 2EKKA 3GLIE 3MMPA 1DV0A 2LBCA 2DHYA 3H4JA 1XB2B 1P3QQ 2JY7A 1UFZA 4F1IA 3GLHE 2BWEA 3FE3A 3IHPA 2HWJA 2LVPC 2JY5A 2DAGA 3E21A 1OTRA 1GO5A 3BMBA 1BVSA 2L2DA 4HEOA 1Q02A 4G3OA 2CP8A 4DBGB 2K0BX 1WGNA 1V92A 2MJ5B 1VDLA 1E94E 3FRHA 2QNJA 2RRUA 1ZMWA 3BBZA 2LVAA 2H5XA 2LVQD 1WIVA 1VEJA 2KNAA 1HT1E 1NV8A 1TFEA 1IFYA 2DENA 1HT2E 1WJ7A 2BWBA 1MN3A 2DAMA 2LVOC 2KNVA 2OOAA 1F4IA
chains in the Genus database with same CATH superfamily
4KHPM 4DR1M 1OAOC 5EQTA 4MB7A 4MGIE 3K8ZA 4D81A 4AI6A 2WSFG 1QAMA 4RF1A 2F5SA 4DR7M 2DJ6A 2QSFX 1T3TA 1DGFA 3F92A 4YY3M 3GRRA 1KFVA 4JXJA 4MGZE 4B3RM 1WHCA 1WM9A 1JR3D 2DWNA 2DZNB 3BOSA 3UZUA 4REZA 4R7GA 3GPXA 3UGJA 1G59A 4GKKM 3AKZA 2JXNA 5E26A 1PJQA 4ITQA 3FTDA 4AQYM 1XNRM 1IXRC 3U6CA 4B3TM 3QN0A 1J7KA 3QNAA 2C9CA 3AOGA 3I4VA 1KSFX 4IBFA 3GPUA 3R8FA 2JWSA 2DNAA 2QBYB 5ITRA 2CUZA 3IECA 3K9OA 5ITUA 5EP2A 2FNAA 3VEJA 2LWXA 1IM2A 2QQ8A 3SHFA 1OQYA 3ZC7B 3CF6E 1RU3A 4BLCA 5BPVA 2R46A 2WSCG 4B7GA 1PGYA 2DWLA 2PN0A 2WSEF 4CHTB 3U6EA 4UN2B 4I81A 1DO2A 4BB9A 3AV0A 1A5TA 4NE3B 3SHGB 4RKUF 5KQDA 4LJ9A 4LG2A 1XMOM 3KOWE 1G71A 1IXSB 3FKEA 3RGSA 4M9ZA 2DAIA 1VEGA 3VLFB 1X37A 5KPTA 2F5PA 2XLJA 2DKLA 4M9XA 2L7IA 3HX3A 1D0KA 2QBYA 4WP2A 3VK8A 4JI0M 1R2YA 2R4EA 3B89A 2C96A 3W0FA 3LW5K 1QDTA 1T6OA 1OKSA 2RKOA 5KQ8A 4JV5M 1IY1A 4TUWA 2L4EA 1G41A 2CHQA 1GABA 3SMPA 4FVMA 3GP1A 4JI6M 3OTOM 2O25A 4FWHA 1VG5A 1XNQM 3AOEC 2C99A 1IQPA 2F5NA 3J7AS 3GLGE 2LHCA 3HU3A 5BR8M 2EKKA 2R65A 4OU7A 3SAWA 1GLNA 4LJ5A 4I5SA 4LJ7A 4X62M 3TWLA 1P3QQ 5ITXA 3VDPA 3E4RA 1L2BA 1EIJA 4LJAA 4LFCM 4LGMA 2LVPC 5ITXE 1NY5A 1S3SA 2VQFM 2DXIA 3E9SA 2L2DA 3KVWA 3NBXX 4DV3M 3LZEA 4DRAE 1Q02A 3LQQA 2KRKA 3TQSA 4WURA 4DBGB 1NHGC 2K0BX 1R5LA 2UXBM 1V34A 5EXTA 1G8PA 4BBAA 1WINA 1V92A 3QYEA 1VDLA 3GPPA 4LF7M 4S12A 2QNJA 2D7HA 2MH8A 3U6OA 5EXSA 4JI5M 2LVAA 1GJTA 2H5XA 2G64A 2WSFK 4GIPA 4NXNM 4IBIA 4NRWA 2CFOA 2D7EA 2R62A 2K6BA 4HLQA 3B0BC 2UU9M 2OBAA 2LHGA 1N36M 3T1HM 1XC8A 1GL7A 1ORYB 3KOZE 4NTMA 1MN3A 2L7HA 2XF3A 2UUBM 2KNVA 4XBOA 2F4VM 1N78A 1DGGA 5FTJA 2F5OA 1F4IA 3J7BA 1QAOA 4Z8XA 4CGYB 2UUCM 4I4LA 1E9SA 3SARA 2P11A 1J09A 3CGWA 1ZMVA 3FTCA 1L2DA 4DUZM 3KSJA 3FUVA 3GLFB 1L8QA 3SASA 2HCBA 1ZQ9A 2KRUA 3D8LA 2WZJA 2JNHA 2G5GX 2X49A 1QUTA 2EKFA 4K0KM 2ZAMA 3LW5F 3QN9A 3CTWB 1IXSA 1OJLA 2J7OA 4DV6M 2B3TA 1XXHB 2HL7A 3KP0E 4LGYA 4JI2M 2JZ1A 1GVNA 3CF2A 2EO2A 2K47A 4DR3M 1I94M 1WR1B 3H4MA 4YHHM 3GLFA 1IN7A 1Q3BA 3UJNA 2LNZA 2Z4SA 4FD2A 3FTEA 2LH0A 3U60A 2CV0A 2DAKA 2JUJA 3SFZA 1HJPA 4CJ6A 4LFAM 4PDIA 4DV7M 1ZV1A 5ITQA 2M5ZA 3UK6A 3Q8XA 1K3WA 4FVFA 3TWMA 1C1KA 3V76A 1A9CA 2QCUA 2CHGA 2QP9X 5EP3A 4Z6YA 3LVVA 4JYAM 3VKGA 1PJTA 4DV2M 1B6ZA 3U61A 1IS7A 2DI0A 5EP4A 2Y20A 3GO8A 2V1CA 3GRYA 1Z5CA 3DOAA 3CF0A 4AKGA 1Z59A 4JN6A 3GQ4A 4M0DA 3GPYA 1W5SA 3LCVB 3HHWA 2KR1A 3U60B 1NJGA 4DV5M 1TDHA 4MGKE 3PNVA 4GEWA 2VF8A 3J80S 4L15A 5KO3A 2FE8A 2WSCK 3VDUA 4B7FA 3JR5A 4LF4M 2DHRA 4LY6A 4ZPXA 3GLGB 4AZFA 3U6QA 5JI2E 3LX3A 4L16A 5LMNM 1KYIA 4KODA 3C58A 2XZUA 3B9PA 3U61B 5DFLA 1SXJE 3C9PA 4GHLA 2HHHM 4NE5B 2FH0A 2VIIA 4E45B 4IBDA 2A0SA 2LBCA 3U6MA 4DR4M 3KOYE 5ITYA 4WW0A 2CHVA 2DHYA 3H4JA 1XB2B 3HHYA 2JY7A 5FSWA 4LJ4A 3B7NA 5EJCA 1TGUA 4LJ8A 4LRTA 3PXGA 3HHZA 1IS8A 1TDZA 2HWJA 1TH3A 4OX9M 1TF0B 1GKIA 2OQ4A 3FTFA 2DAGA 2ZAOA 2LXEA 3M6AA 1QVRA 4HEOA 2WSCF 3GLGA 1PJJA 2F5QA 4P16A 4P17A 3HJ8A 4GHAA 2DTTA 3GLHA 1HQCA 3NBIA 4MH0E 1WPLA 4E44B 2ZBKB 2QENA 4OW0A 4B3MM 2ERCA 5FTNA 4FCVA 1Z5AA 4GC9A 1VDDA 1N77A 2RPBA 3L27A 2LO0A 4NTNA 4IBJA 3DA1A 3WHLA 4HL4A 1QQWA 4IBCA 5C18A 4LZJA 1GJSA 2KDLA 2LVQD 1NNUC 2DWMA 4NL4H 4FVJA 2KNAA 3HWSA 2YFQA 3ZH9B 3AL0C 2I7NA 1QAQA 1V33A 3D8BA 3LMMA 5DYGA 1IFYA 3GQ3A 3A45A 4LF6M 1WUQA 3GLHB 4R3DA 5LMUM 3HZJA 2KXEA 4D82A 3SMSA 2G8LA 4XGIA 4AG6A 5DNYA 2Z4RA 3C3EA 1D2NA 1XXHA 2JZ0A 2QPAA 4JI1M 1E9RA 2KZUA 2KNZA 4II7A 2Y0QA 1W5TA 1NY6A 3FUUA 4Q7JA 2C98A 2CE7A 2J7NA 1I4WA 2DWZB 3U6LA 1NV9A 4PT5A 4LF8M 1QZMA 2RGHA 5EXPA 3NWLA 1VEKA 4GKJM 3QWLA 2KA6B 1QZEA 3I4YA 4LFBM 3HJSA 2XH9A 4FCTA 2OPFA 3L25A 3KW6A 4GRIA 2O5RA 1EFUB 3PFIA 4DU6A 4L78A 3M0NA 4IBBA 1PJSA 3K9PA 1SG9A 1AIPC 1K3XA 3LCUA 3JYGA 2M60A 4D80A 1Z5BA 2K9DA 3SAUA 4PDGA 1DGHB 3K2LA 3J81S 1LV7A 2EUCA 2LTUA 3LQRA 4M9SA 4W5WA 5FTMA 3JR4A 4LF9M 1QANA 1Y8GA 3VFDA 1FBXA 3GQ5A 1FNNA 2G3QA 3W67A 4NE6B 2JY8A 3HKPA 4DUYM 2WSEK 4LRSA 1CUKA 3L26A 2VQEM 4QHSA 4IJEA 3HU2A 3I04M 1N3SA 2KHHA 1TH4A 2GNOA 2XEPA 3I01M 2C9OA 4R71A 1HNXM 2AHMA 1QUSA 3HHXA 1VQ1A 2O01F 1G3IA 1PRBA 3KFUG 1JQJC 1IXZA 4JI8M 2CV2A 4DRBJ 3HGIA 1LTMA 2R0IA 1R4GA 1JR3E 4GH9A 3C3DA 1N34M 3MK6A 1IN5A 2O01G 3U6PA 2GQFA 2NQ8C 2QZ4A 3W0LB 2R4JA 1AUAA 1C7YA 4LF5M 4GC5A 2XFSA 1SXJB 1OIZA 2OOBA 4KLNA 3Q8GA 5EXXA 2BJVA 3KDSE 3HY5A 2L4FA 4X66M 2V6ZM 3ZQJA 4AKIA 2MR9A 2MROB 4NTKA 5FLXS 3GLIE 2KW0A 2EA0A 2H1RA 5KPRA 3T1YM 1Z6TA 1UFZA 4QOSA 4CISA 1IN8A 2KZSA 2BWEA 3KXEC 4NC6A 3FE3A 3LVWA 3IHPA 4Y28F 1JB0F 4MGYE 2BJWA 4GITA 4B08A 3GLIA 2JY5A 3MHVC 3FUWA 1IBKM 1YSYA 3DFZA 3KP1E 1BVSA 3M7GA 1SXJA 4OVZA 2JA2A 5A2QS 2CP8A 1SXJD 3IG5A 1N75A 1GTQA 1TH2A 1Q3CA 3UMMA 2XZFA 4NRVA 3VKHA 1Y13A 1WGNA 1HNWM 2FS1A 4MM3B 2MJ5B 4B7HA 3I51A 2FFJA 1E94E 4NOOB 2WSEG 5IREB 3BK6A 1HR0M 3KOXE 4A3VB 2R6FA 2R45A 2YR0A 1MJGM 4JA3A 3A98B 4I8OA 4EIWA 1QDRA 1WIVA 1VEJA 1N32M 2VDBB 1HT1E 4QOZC 2XSZA 4G4NA 1NV8A 2UXDM 3GRUA 2KEBA 2WSFF 3U5ZB 1PM5A 1TFEA 4JI3M 1FB1A 4L6V6 5GKNA 2CEAA 2DENA 1HT2E 3IG8A 1WJ7A 2BWBA 5EP1A 5FTLA 4DR2M 3EIHA 4RNAA 4NSRA 3J2PB 4L4UA 4GMQA 2HAKA 2DZLA 1YLAA 2Z8YM 4M0WA 1L2CA 1G4AE 1A8RA 1NVMA 1E32A 3EIEA 3ZCBB 1MX0A 3QYBA 2E5LM 2OO9A 2YQZA 3FRIA 3FYDA 1IY2A 2CRUA 1XWIA 5E6JA 1DGHA 1R2ZA 5L8RF 3TWKA 2DZOB 4DV4M 3K92A 4B3SM 8CATA 4DR6M 3U5ZA 2L6OA 1K82A 4F2LA 2Z7JA 3THGA 2APLA 4FWGA 3B7QA 3VK7A 2HKJA 3K1JA 4X65M 2P5TA 3TPZA 4QPMA 4CIZA 5JI3E 2MGWA 3BXWA 3SYKA 3J27B 2R18A 3GLFE 1DO0A 1IBLM 1EL6A 2JY6B 3KS8A 3R9XB 3HU1A 5ITTA 3QAUA 3SBJA 3PVSA 3WHKA 4KO8A 3E46A 1B66A 1OFIA 2DVWB 5KPZA 1NJFA 1NSFA 3L29A 1HQYE 4FCWA 3ILKA 3FD9A 4AW4A 2L09A 1ZMUA 5IT9S 3KS4A 2DAEA 2UXCM 1SXJC 3U6SA 3AFHA 1WURA 1GTPA 4IBEA 4DV0M 1N33M 4JI4M 3GRVA 2N35A 4G4OA 2CWBA 4KT0F 3JAMS 4PD2A 1TTEA 2UUAM 2ZTCA 4MGHA 3T6PA 1WGLA 3W68A 1PJIA 1WXQA 4XK8F 4LCBA 3SAVA 1L1ZA 3L28A 4LZZA 2Y0TA 1NHWC 4IJFA 3TL4X 3RFWA 1OAIA 1T43A 2XFTA 3HJQA 4R8QA 3A42A 1D0MA 1YUBA 2FOIC 2Y21A 3B7ZA 2D7GA 4IIWA 3SYLA 4AG5A 5DMZA 1XXHE 2LVNC 2RGOA 3MJ5A 3PNYA 1JR3A 3TE6A 3GLIB 5IZ7D 4IBKA 1R7RA 1XHBA 4QHTA 1NNJA 4OVZB 1OIPA 2V1UA 1TR8A 1ZAEA 2X4AA 4NXMM 4AKHA 4FWDA 2ZTDA 2JP7A 1Q39A 4DV1M 1IN4A 3T15A 5H37D 2QHOB 3B74A 2EJSA 3SATA 3D7JA 4IBGA 1L1TA 4G4RA 3MMPA 2CV1A 3AOEA 1IBMM 1DV0A 1DGBA 5DYIA 5F3WA 5C1BA 2W82A 4G6ZA 1R6BX 3L2AA 4F1IA 7CATA 1QYRA 3GLHE 1J5EM 1IN6A 1H6UA 2YNMD 3LW5G 4FW9A 3A46A 4PCZA 3U6DA 4FVGA 3E21A 1OTRA 1GO5A 2Z3XA 4NSOB 2J5YA 3T38A 2R44A 3RE8A 4ANRA 1MU5A 1IY0A 2LNHC 4RF0A 2Q2EB 4G3OA 5FTKA 1HNZM 3BMBA 3SC3A 1NO1A 1YE9A 3I2BA 2XGNA 3FUTA 3KSXA 4L8RC 1N3TA 2XSZD 3FRHA 4X64M 2C5RA 2RRUA 2I7PA 3FUXA 4QNRA 1ZMWA 1EE8A 1UM8A 2A5YB 2ZANA 3BBZA 3FYCA 3RGPA 4DR5M 1XMQM 3DZDA 4JI7M 4LJ6A 1N3RA 2ZM6M 1OFHA 2X8AA 1GL6A 3M0EA 1D0LA 4QNMA 2VF7A 2DAMA 2LVOC 2OOAA 5IWAM 4G4QA 1FJGM 2BNKA 3AJIB
chains in the Genus database with same CATH topology
2HAKA 2DZLA 1YLAA 1A8RA 1G4AE 2JZ0A 2P11A 1ZMVA 2KNZA 2OO9A 2QSFX 3FRIA 3F92A 1WHCA 4Q7JA 1WM9A 1NV9A 2WZJA 2JNHA 4F2LA 2EKFA 1VEKA 1QZEA 4QPMA 1IXSA 2MGWA 3GLFE 1EL6A 2B3TA 1DO0A 1EFUB 4DU6A 2JY6B 2JZ1A 3K9PA 2DNAA 1SG9A 1AIPC 3IECA 3K9OA 3E46A 3LCUA 3VEJA 1WR1B 1IM2A 2K9DA 1HQYE 1OQYA 2LNZA 1ZMUA 1PGYA 2DAEA 2LTUA 2PN0A 2DAKA 2JUJA 1Y8GA 4UN2B 1DO2A 1HJPA 1WURA 1FBXA 1ZV1A 2G3QA 1GTPA 1A5TA 4NE3B 2JY8A 4NE6B 1A9CA 2CWBA 1CUKA 2DAIA 1VEGA 1TTEA 1IS7A 2DI0A 1N3SA 2KHHA 2DKLA 2ZTCA 3T6PA 1WGLA 4R71A 1VQ1A 4WP2A 1G3IA 3B89A 1OAIA 1T6OA 1T43A 4R8QA 1OKSA 3LCVB 2KR1A 4DRBJ 2L4EA 5DMZA 1XXHE 2LVNC 4GEWA 2R0IA 1R4GA 1G41A 1JR3E 2O25A 1C7YA 1TR8A 1VG5A 2OOBA 5JI2E 1KYIA 2L4FA 5DFLA 2ZTDA 3GLGE 2JP7A 2QHOB 2MR9A 2EJSA 2MROB 2EKKA 4NE5B 4E45B 3GLIE 3MMPA 1DV0A 2LBCA 2DHYA 3H4JA 1XB2B 1P3QQ 2JY7A 1UFZA 4F1IA 3GLHE 2BWEA 1IS8A 3FE3A 3IHPA 2HWJA 2LVPC 2JY5A 2DAGA 3E21A 1OTRA 1GO5A 3BMBA 1BVSA 2L2DA 4HEOA 4DRAE 1Q02A 4G3OA 2CP8A 4DBGB 2K0BX 1WPLA 4E44B 1WGNA 1V92A 1N3TA 2MJ5B 1VDLA 1E94E 3FRHA 2QNJA 2RRUA 2LO0A 1ZMWA 3BBZA 2LVAA 2H5XA 4JA3A 2LVQD 1N3RA 1WIVA 1VEJA 2KNAA 1HT1E 3B0BC 1NV8A 1TFEA 1IFYA 1FB1A 2DENA 1HT2E 1WUQA 1WJ7A 2BWBA 1MN3A 2DAMA 2LVOC 2KNVA 2OOAA 1F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAK A;  2DZL A;  1YLA A;  1G4A E;  2JZ0 A;  1ZMV A;  2KNZ A;  2OO9 A;  2QSF X;  3FRI A;  3F92 A;  1WHC A;  4Q7J A;  1NV9 A;  2WZJ A;  2JNH A;  4F2L A;  2EKF A;  1VEK A;  1QZE A;  1IXS A;  2MGW A;  3GLF E;  2B3T A;  1DO0 A;  1EFU B;  2JY6 B;  2JZ1 A;  3K9P A;  2DNA A;  1SG9 A;  1AIP C;  3IEC A;  3K9O A;  3E46 A;  3LCU A;  1WR1 B;  1IM2 A;  2K9D A;  1HQY E;  1OQY A;  1ZMU A;  1PGY A;  2DAE A;  2LTU A;  2PN0 A;  2DAK A;  2JUJ A;  1Y8G A;  4UN2 B;  1DO2 A;  1HJP A;  1ZV1 A;  2G3Q A;  1A5T A;  2JY8 A;  2CWB A;  1CUK A;  2DAI A;  1VEG A;  1TTE A;  2DI0 A;  2KHH A;  2DKL A;  2ZTC A;  3T6P A;  1WGL A;  4R71 A;  1VQ1 A;  4WP2 A;  1G3I A;  3B89 A;  1OAI A;  1T6O A;  1T43 A;  1OKS A;  3LCV B;  2L4E A;  1XXH E;  2LVN C;  4GEW A;  2R0I A;  1R4G A;  1G41 A;  1JR3 E;  2O25 A;  1C7Y A;  1TR8 A;  1VG5 A;  2OOB A;  5JI2 E;  1KYI A;  2L4F A;  5DFL A;  2ZTD A;  3GLG E;  2JP7 A;  2QHO B;  2MR9 A;  2EJS A;  2MRO B;  2EKK A;  3GLI E;  3MMP A;  1DV0 A;  2LBC A;  2DHY A;  3H4J A;  1XB2 B;  1P3Q Q;  2JY7 A;  1UFZ A;  4F1I A;  3GLH E;  2BWE A;  3FE3 A;  3IHP A;  2HWJ A;  2LVP C;  2JY5 A;  2DAG A;  3E21 A;  1OTR A;  1GO5 A;  3BMB A;  1BVS A;  2L2D A;  4HEO A;  1Q02 A;  4G3O A;  2CP8 A;  4DBG B;  2K0B X;  1WGN A;  1V92 A;  2MJ5 B;  1VDL A;  1E94 E;  3FRH A;  2QNJ A;  2RRU A;  1ZMW A;  3BBZ A;  2LVA A;  2H5X A;  2LVQ D;  1WIV A;  1VEJ A;  2KNA A;  1HT1 E;  1NV8 A;  1TFE A;  1IFY A;  2DEN A;  1HT2 E;  1WJ7 A;  2BWB A;  1MN3 A;  2DAM A;  2LVO C;  2KNV A;  2OOA A;  1F4I A; 
#chains in the Genus database with same CATH topology
 4KHP M;  4DR1 M;  1OAO C;  5EQT A;  4MB7 A;  4MGI E;  3K8Z A;  4D81 A;  4AI6 A;  2WSF G;  1QAM A;  4RF1 A;  2F5S A;  4DR7 M;  2DJ6 A;  2QSF X;  1T3T A;  1DGF A;  3F92 A;  4YY3 M;  3GRR A;  1KFV A;  4JXJ A;  4MGZ E;  4B3R M;  1WHC A;  1WM9 A;  1JR3 D;  2DWN A;  2DZN B;  3BOS A;  3UZU A;  4REZ A;  4R7G A;  3GPX A;  3UGJ A;  1G59 A;  4GKK M;  3AKZ A;  2JXN A;  5E26 A;  1PJQ A;  4ITQ A;  3FTD A;  4AQY M;  1XNR M;  1IXR C;  3U6C A;  4B3T M;  3QN0 A;  1J7K A;  3QNA A;  2C9C A;  3AOG A;  3I4V A;  1KSF X;  4IBF A;  3GPU A;  3R8F A;  2JWS A;  2DNA A;  2QBY B;  5ITR A;  2CUZ A;  3IEC A;  3K9O A;  5ITU A;  5EP2 A;  2FNA A;  3VEJ A;  2LWX A;  1IM2 A;  2QQ8 A;  3SHF A;  1OQY A;  3ZC7 B;  3CF6 E;  1RU3 A;  4BLC A;  5BPV A;  2R46 A;  2WSC G;  4B7G A;  1PGY A;  2DWL A;  2PN0 A;  2WSE F;  4CHT B;  3U6E A;  4UN2 B;  4I81 A;  1DO2 A;  4BB9 A;  3AV0 A;  1A5T A;  4NE3 B;  3SHG B;  4RKU F;  5KQD A;  4LJ9 A;  4LG2 A;  1XMO M;  3KOW E;  1G71 A;  1IXS B;  3FKE A;  3RGS A;  4M9Z A;  2DAI A;  1VEG A;  3VLF B;  1X37 A;  5KPT A;  2F5P A;  2XLJ A;  2DKL A;  4M9X A;  2L7I A;  3HX3 A;  1D0K A;  2QBY A;  4WP2 A;  3VK8 A;  4JI0 M;  1R2Y A;  2R4E A;  3B89 A;  2C96 A;  3W0F A;  3LW5 K;  1QDT A;  1T6O A;  1OKS A;  2RKO A;  5KQ8 A;  4JV5 M;  1IY1 A;  4TUW A;  2L4E A;  1G41 A;  2CHQ A;  1GAB A;  3SMP A;  4FVM A;  3GP1 A;  4JI6 M;  3OTO M;  2O25 A;  4FWH A;  1VG5 A;  1XNQ M;  3AOE C;  2C99 A;  1IQP A;  2F5N A;  3J7A S;  3GLG E;  2LHC A;  3HU3 A;  5BR8 M;  2EKK A;  2R65 A;  4OU7 A;  3SAW A;  1GLN A;  4LJ5 A;  4I5S A;  4LJ7 A;  4X62 M;  3TWL A;  1P3Q Q;  5ITX A;  3VDP A;  3E4R A;  1L2B A;  1EIJ A;  4LJA A;  4LFC M;  4LGM A;  2LVP C;  5ITX E;  1NY5 A;  1S3S A;  2VQF M;  2DXI A;  3E9S A;  2L2D A;  3KVW A;  3NBX X;  4DV3 M;  3LZE A;  4DRA E;  1Q02 A;  3LQQ A;  2KRK A;  3TQS A;  4WUR A;  4DBG B;  1NHG C;  2K0B X;  1R5L A;  2UXB M;  1V34 A;  5EXT A;  1G8P A;  4BBA A;  1WIN A;  1V92 A;  3QYE A;  1VDL A;  3GPP A;  4LF7 M;  4S12 A;  2QNJ A;  2D7H A;  2MH8 A;  3U6O A;  5EXS A;  4JI5 M;  2LVA A;  1GJT A;  2H5X A;  2G64 A;  2WSF K;  4GIP A;  4NXN M;  4IBI A;  4NRW A;  2CFO A;  2D7E A;  2R62 A;  2K6B A;  4HLQ A;  3B0B C;  2UU9 M;  2OBA A;  2LHG A;  1N36 M;  3T1H M;  1XC8 A;  1GL7 A;  1ORY B;  3KOZ E;  4NTM A;  1MN3 A;  2L7H A;  2XF3 A;  2UUB M;  2KNV A;  4XBO A;  2F4V M;  1N78 A;  1DGG A;  5FTJ A;  2F5O A;  1F4I A;  3J7B A;  1QAO A;  4Z8X A;  4CGY B;  2UUC M;  4I4L A;  1E9S A;  3SAR A;  2P11 A;  1J09 A;  3CGW A;  1ZMV A;  3FTC A;  1L2D A;  4DUZ M;  3KSJ A;  3FUV A;  3GLF B;  1L8Q A;  3SAS A;  2HCB A;  1ZQ9 A;  2KRU A;  3D8L A;  2WZJ A;  2JNH A;  2G5G X;  2X49 A;  1QUT A;  2EKF A;  4K0K M;  2ZAM A;  3LW5 F;  3QN9 A;  3CTW B;  1IXS A;  1OJL A;  2J7O A;  4DV6 M;  2B3T A;  1XXH B;  2HL7 A;  3KP0 E;  4LGY A;  4JI2 M;  2JZ1 A;  1GVN A;  3CF2 A;  2EO2 A;  2K47 A;  4DR3 M;  1I94 M;  1WR1 B;  3H4M A;  4YHH M;  3GLF A;  1IN7 A;  1Q3B A;  3UJN A;  2LNZ A;  2Z4S A;  4FD2 A;  3FTE A;  2LH0 A;  3U60 A;  2CV0 A;  2DAK A;  2JUJ A;  3SFZ A;  1HJP A;  4CJ6 A;  4LFA M;  4PDI A;  4DV7 M;  1ZV1 A;  5ITQ A;  2M5Z A;  3UK6 A;  3Q8X A;  1K3W A;  4FVF A;  3TWM A;  1C1K A;  3V76 A;  1A9C A;  2QCU A;  2CHG A;  2QP9 X;  5EP3 A;  4Z6Y A;  3LVV A;  4JYA M;  3VKG A;  1PJT A;  4DV2 M;  1B6Z A;  3U61 A;  1IS7 A;  2DI0 A;  5EP4 A;  2Y20 A;  3GO8 A;  2V1C A;  3GRY A;  1Z5C A;  3DOA A;  3CF0 A;  4AKG A;  1Z59 A;  4JN6 A;  3GQ4 A;  4M0D A;  3GPY A;  1W5S A;  3LCV B;  3HHW A;  2KR1 A;  3U60 B;  1NJG A;  4DV5 M;  1TDH A;  4MGK E;  3PNV A;  4GEW A;  2VF8 A;  3J80 S;  4L15 A;  5KO3 A;  2FE8 A;  2WSC K;  3VDU A;  4B7F A;  3JR5 A;  4LF4 M;  2DHR A;  4LY6 A;  4ZPX A;  3GLG B;  4AZF A;  3U6Q A;  5JI2 E;  3LX3 A;  4L16 A;  5LMN M;  1KYI A;  4KOD A;  3C58 A;  2XZU A;  3B9P A;  3U61 B;  5DFL A;  1SXJ E;  3C9P A;  4GHL A;  2HHH M;  4NE5 B;  2FH0 A;  2VII A;  4E45 B;  4IBD A;  2A0S A;  2LBC A;  3U6M A;  4DR4 M;  3KOY E;  5ITY A;  4WW0 A;  2CHV A;  2DHY A;  3H4J A;  1XB2 B;  3HHY A;  2JY7 A;  5FSW A;  4LJ4 A;  3B7N A;  5EJC A;  1TGU A;  4LJ8 A;  4LRT A;  3PXG A;  3HHZ A;  1IS8 A;  1TDZ A;  2HWJ A;  1TH3 A;  4OX9 M;  1TF0 B;  1GKI A;  2OQ4 A;  3FTF A;  2DAG A;  2ZAO A;  2LXE A;  3M6A A;  1QVR A;  4HEO A;  2WSC F;  3GLG A;  1PJJ A;  2F5Q A;  4P16 A;  4P17 A;  3HJ8 A;  4GHA A;  2DTT A;  3GLH A;  1HQC A;  3NBI A;  4MH0 E;  1WPL A;  4E44 B;  2ZBK B;  2QEN A;  4OW0 A;  4B3M M;  2ERC A;  5FTN A;  4FCV A;  1Z5A A;  4GC9 A;  1VDD A;  1N77 A;  2RPB A;  3L27 A;  2LO0 A;  4NTN A;  4IBJ A;  3DA1 A;  3WHL A;  4HL4 A;  1QQW A;  4IBC A;  5C18 A;  4LZJ A;  1GJS A;  2KDL A;  2LVQ D;  1NNU C;  2DWM A;  4NL4 H;  4FVJ A;  2KNA A;  3HWS A;  2YFQ A;  3ZH9 B;  3AL0 C;  2I7N A;  1QAQ A;  1V33 A;  3D8B A;  3LMM A;  5DYG A;  1IFY A;  3GQ3 A;  3A45 A;  4LF6 M;  1WUQ A;  3GLH B;  4R3D A;  5LMU M;  3HZJ A;  2KXE A;  4D82 A;  3SMS A;  2G8L A;  4XGI A;  4AG6 A;  5DNY A;  2Z4R A;  3C3E A;  1D2N A;  1XXH A;  2JZ0 A;  2QPA A;  4JI1 M;  1E9R A;  2KZU A;  2KNZ A;  4II7 A;  2Y0Q A;  1W5T A;  1NY6 A;  3FUU A;  4Q7J A;  2C98 A;  2CE7 A;  2J7N A;  1I4W A;  2DWZ B;  3U6L A;  1NV9 A;  4PT5 A;  4LF8 M;  1QZM A;  2RGH A;  5EXP A;  3NWL A;  1VEK A;  4GKJ M;  3QWL A;  2KA6 B;  1QZE A;  3I4Y A;  4LFB M;  3HJS A;  2XH9 A;  4FCT A;  2OPF A;  3L25 A;  3KW6 A;  4GRI A;  2O5R A;  1EFU B;  3PFI A;  4DU6 A;  4L78 A;  3M0N A;  4IBB A;  1PJS A;  3K9P A;  1SG9 A;  1AIP C;  1K3X A;  3LCU A;  3JYG A;  2M60 A;  4D80 A;  1Z5B A;  2K9D A;  3SAU A;  4PDG A;  1DGH B;  3K2L A;  3J81 S;  1LV7 A;  2EUC A;  2LTU A;  3LQR A;  4M9S A;  4W5W A;  5FTM A;  3JR4 A;  4LF9 M;  1QAN A;  1Y8G A;  3VFD A;  1FBX A;  3GQ5 A;  1FNN A;  2G3Q A;  3W67 A;  4NE6 B;  2JY8 A;  3HKP A;  4DUY M;  2WSE K;  4LRS A;  1CUK A;  3L26 A;  2VQE M;  4QHS A;  4IJE A;  3HU2 A;  3I04 M;  1N3S A;  2KHH A;  1TH4 A;  2GNO A;  2XEP A;  3I01 M;  2C9O A;  4R71 A;  1HNX M;  2AHM A;  1QUS A;  3HHX A;  1VQ1 A;  2O01 F;  1G3I A;  1PRB A;  3KFU G;  1JQJ C;  1IXZ A;  4JI8 M;  2CV2 A;  4DRB J;  3HGI A;  1LTM A;  2R0I A;  1R4G A;  1JR3 E;  4GH9 A;  3C3D A;  1N34 M;  3MK6 A;  1IN5 A;  2O01 G;  3U6P A;  2GQF A;  2NQ8 C;  2QZ4 A;  3W0L B;  2R4J A;  1AUA A;  1C7Y A;  4LF5 M;  4GC5 A;  2XFS A;  1SXJ B;  1OIZ A;  2OOB A;  4KLN A;  3Q8G A;  5EXX A;  2BJV A;  3KDS E;  3HY5 A;  2L4F A;  4X66 M;  2V6Z M;  3ZQJ A;  4AKI A;  2MR9 A;  2MRO B;  4NTK A;  5FLX S;  3GLI E;  2KW0 A;  2EA0 A;  2H1R A;  5KPR A;  3T1Y M;  1Z6T A;  1UFZ A;  4QOS A;  4CIS A;  1IN8 A;  2KZS A;  2BWE A;  3KXE C;  4NC6 A;  3FE3 A;  3LVW A;  3IHP A;  4Y28 F;  1JB0 F;  4MGY E;  2BJW A;  4GIT A;  4B08 A;  3GLI A;  2JY5 A;  3MHV C;  3FUW A;  1IBK M;  1YSY A;  3DFZ A;  3KP1 E;  1BVS A;  3M7G A;  1SXJ A;  4OVZ A;  2JA2 A;  5A2Q S;  2CP8 A;  1SXJ D;  3IG5 A;  1N75 A;  1GTQ A;  1TH2 A;  1Q3C A;  3UMM A;  2XZF A;  4NRV A;  3VKH A;  1Y13 A;  1WGN A;  1HNW M;  2FS1 A;  4MM3 B;  2MJ5 B;  4B7H A;  3I51 A;  2FFJ A;  1E94 E;  4NOO B;  2WSE G;  5IRE B;  3BK6 A;  1HR0 M;  3KOX E;  4A3V B;  2R6F A;  2R45 A;  2YR0 A;  1MJG M;  4JA3 A;  3A98 B;  4I8O A;  4EIW A;  1QDR A;  1WIV A;  1VEJ A;  1N32 M;  2VDB B;  1HT1 E;  4QOZ C;  2XSZ A;  4G4N A;  1NV8 A;  2UXD M;  3GRU A;  2KEB A;  2WSF F;  3U5Z B;  1PM5 A;  1TFE A;  4JI3 M;  1FB1 A;  4L6V 6;  5GKN A;  2CEA A;  2DEN A;  1HT2 E;  3IG8 A;  1WJ7 A;  2BWB A;  5EP1 A;  5FTL A;  4DR2 M;  3EIH A;  4RNA A;  4NSR A;  3J2P B;  4L4U A;  4GMQ A;  2HAK A;  2DZL A;  1YLA A;  2Z8Y M;  4M0W A;  1L2C A;  1G4A E;  1A8R A;  1NVM A;  1E32 A;  3EIE A;  3ZCB B;  1MX0 A;  3QYB A;  2E5L M;  2OO9 A;  2YQZ A;  3FRI A;  3FYD A;  1IY2 A;  2CRU A;  1XWI A;  5E6J A;  1DGH A;  1R2Z A;  5L8R F;  3TWK A;  2DZO B;  4DV4 M;  3K92 A;  4B3S M;  8CAT A;  4DR6 M;  3U5Z A;  2L6O A;  1K82 A;  4F2L A;  2Z7J A;  3THG A;  2APL A;  4FWG A;  3B7Q A;  3VK7 A;  2HKJ A;  3K1J A;  4X65 M;  2P5T A;  3TPZ A;  4QPM A;  4CIZ A;  5JI3 E;  2MGW A;  3BXW A;  3SYK A;  3J27 B;  2R18 A;  3GLF E;  1DO0 A;  1IBL M;  1EL6 A;  2JY6 B;  3KS8 A;  3R9X B;  3HU1 A;  5ITT A;  3QAU A;  3SBJ A;  3PVS A;  3WHK A;  4KO8 A;  3E46 A;  1B66 A;  1OFI A;  2DVW B;  5KPZ A;  1NJF A;  1NSF A;  3L29 A;  1HQY E;  4FCW A;  3ILK A;  3FD9 A;  4AW4 A;  2L09 A;  1ZMU A;  5IT9 S;  3KS4 A;  2DAE A;  2UXC M;  1SXJ C;  3U6S A;  3AFH A;  1WUR A;  1GTP A;  4IBE A;  4DV0 M;  1N33 M;  4JI4 M;  3GRV A;  2N35 A;  4G4O A;  2CWB A;  4KT0 F;  3JAM S;  4PD2 A;  1TTE A;  2UUA M;  2ZTC A;  4MGH A;  3T6P A;  1WGL A;  3W68 A;  1PJI A;  1WXQ A;  4XK8 F;  4LCB A;  3SAV A;  1L1Z A;  3L28 A;  4LZZ A;  2Y0T A;  1NHW C;  4IJF A;  3TL4 X;  3RFW A;  1OAI A;  1T43 A;  2XFT A;  3HJQ A;  4R8Q A;  3A42 A;  1D0M A;  1YUB A;  2FOI C;  2Y21 A;  3B7Z A;  2D7G A;  4IIW A;  3SYL A;  4AG5 A;  5DMZ A;  1XXH E;  2LVN C;  2RGO A;  3MJ5 A;  3PNY A;  1JR3 A;  3TE6 A;  3GLI B;  5IZ7 D;  4IBK A;  1R7R A;  1XHB A;  4QHT A;  1NNJ A;  4OVZ B;  1OIP A;  2V1U A;  1TR8 A;  1ZAE A;  2X4A A;  4NXM M;  4AKH A;  4FWD A;  2ZTD A;  2JP7 A;  1Q39 A;  4DV1 M;  1IN4 A;  3T15 A;  5H37 D;  2QHO B;  3B74 A;  2EJS A;  3SAT A;  3D7J A;  4IBG A;  1L1T A;  4G4R A;  3MMP A;  2CV1 A;  3AOE A;  1IBM M;  1DV0 A;  1DGB A;  5DYI A;  5F3W A;  5C1B A;  2W82 A;  4G6Z A;  1R6B X;  3L2A A;  4F1I A;  7CAT A;  1QYR A;  3GLH E;  1J5E M;  1IN6 A;  1H6U A;  2YNM D;  3LW5 G;  4FW9 A;  3A46 A;  4PCZ A;  3U6D A;  4FVG A;  3E21 A;  1OTR A;  1GO5 A;  2Z3X A;  4NSO B;  2J5Y A;  3T38 A;  2R44 A;  3RE8 A;  4ANR A;  1MU5 A;  1IY0 A;  2LNH C;  4RF0 A;  2Q2E B;  4G3O A;  5FTK A;  1HNZ M;  3BMB A;  3SC3 A;  1NO1 A;  1YE9 A;  3I2B A;  2XGN A;  3FUT A;  3KSX A;  4L8R C;  1N3T A;  2XSZ D;  3FRH A;  4X64 M;  2C5R A;  2RRU A;  2I7P A;  3FUX A;  4QNR A;  1ZMW A;  1EE8 A;  1UM8 A;  2A5Y B;  2ZAN A;  3BBZ A;  3FYC A;  3RGP A;  4DR5 M;  1XMQ M;  3DZD A;  4JI7 M;  4LJ6 A;  1N3R A;  2ZM6 M;  1OFH A;  2X8A A;  1GL6 A;  3M0E A;  1D0L A;  4QNM A;  2VF7 A;  2DAM A;  2LVO C;  2OOA A;  5IWA M;  4G4Q A;  1FJG M;  2BNK A;  3AJI B; 
#chains in the Genus database with same CATH homology
 2HAK A;  2DZL A;  1YLA A;  1A8R A;  1G4A E;  2JZ0 A;  2P11 A;  1ZMV A;  2KNZ A;  2OO9 A;  2QSF X;  3FRI A;  3F92 A;  1WHC A;  4Q7J A;  1WM9 A;  1NV9 A;  2WZJ A;  2JNH A;  4F2L A;  2EKF A;  1VEK A;  1QZE A;  4QPM A;  1IXS A;  2MGW A;  3GLF E;  1EL6 A;  2B3T A;  1DO0 A;  1EFU B;  4DU6 A;  2JY6 B;  2JZ1 A;  3K9P A;  2DNA A;  1SG9 A;  1AIP C;  3IEC A;  3K9O A;  3E46 A;  3LCU A;  3VEJ A;  1WR1 B;  1IM2 A;  2K9D A;  1HQY E;  1OQY A;  2LNZ A;  1ZMU A;  1PGY A;  2DAE A;  2LTU A;  2PN0 A;  2DAK A;  2JUJ A;  1Y8G A;  4UN2 B;  1DO2 A;  1HJP A;  1WUR A;  1FBX A;  1ZV1 A;  2G3Q A;  1GTP A;  1A5T A;  4NE3 B;  2JY8 A;  4NE6 B;  1A9C A;  2CWB A;  1CUK A;  2DAI A;  1VEG A;  1TTE A;  1IS7 A;  2DI0 A;  1N3S A;  2KHH A;  2DKL A;  2ZTC A;  3T6P A;  1WGL A;  4R71 A;  1VQ1 A;  4WP2 A;  1G3I A;  3B89 A;  1OAI A;  1T6O A;  1T43 A;  4R8Q A;  1OKS A;  3LCV B;  2KR1 A;  4DRB J;  2L4E A;  5DMZ A;  1XXH E;  2LVN C;  4GEW A;  2R0I A;  1R4G A;  1G41 A;  1JR3 E;  2O25 A;  1C7Y A;  1TR8 A;  1VG5 A;  2OOB A;  5JI2 E;  1KYI A;  2L4F A;  5DFL A;  2ZTD A;  3GLG E;  2JP7 A;  2QHO B;  2MR9 A;  2EJS A;  2MRO B;  2EKK A;  4NE5 B;  4E45 B;  3GLI E;  3MMP A;  1DV0 A;  2LBC A;  2DHY A;  3H4J A;  1XB2 B;  1P3Q Q;  2JY7 A;  1UFZ A;  4F1I A;  3GLH E;  2BWE A;  1IS8 A;  3FE3 A;  3IHP A;  2HWJ A;  2LVP C;  2JY5 A;  2DAG A;  3E21 A;  1OTR A;  1GO5 A;  3BMB A;  1BVS A;  2L2D A;  4HEO A;  4DRA E;  1Q02 A;  4G3O A;  2CP8 A;  4DBG B;  2K0B X;  1WPL A;  4E44 B;  1WGN A;  1V92 A;  1N3T A;  2MJ5 B;  1VDL A;  1E94 E;  3FRH A;  2QNJ A;  2RRU A;  2LO0 A;  1ZMW A;  3BBZ A;  2LVA A;  2H5X A;  4JA3 A;  2LVQ D;  1N3R A;  1WIV A;  1VEJ A;  2KNA A;  1HT1 E;  3B0B C;  1NV8 A;  1TFE A;  1IFY A;  1FB1 A;  2DEN A;  1HT2 E;  1WUQ A;  1WJ7 A;  2BWB A;  1MN3 A;  2DAM A;  2LVO C;  2KNV A;  2OOA A;  1F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...