1EFUB

Elongation factor complex ef-tu/ef-ts from escherichia coli
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
282
structure length
282
Chain Sequence
b'AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATION FACTOR TU
publication title The structure of the Escherichia coli EF-Tu.EF-Ts complex at 2.5 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (two elongation factors)
total genus 98
structure length 282
sequence length 282
chains with identical sequence D
ec nomenclature
pdb deposition date 1996-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1efuB01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 1efuB04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 1efuB03
2KNVA 4HEOA 1WR1B 1PGYA 1VEJA 1ZMWA 1HT1E 2K0BX 3K9PA 3GLHE 3K9OA 1XB2B 2OOAA 4F1IA 1KYIA 2WZJA 1OTRA 1VDLA 2JY7A 1G4AE 2OOBA 3H4JA 2CWBA 2HWJA 1C7YA 2JY5A 1VG5A 4WP2A 3IECA 1XXHE 2ZTCA 5DFLA 4G3OA 1ZMUA 2H5XA 1T43A 2KNAA 1IFYA 4F2LA 2MR9A 2JP7A 2DENA 1G41A 2CP8A 2JY6B 1WHCA 2L4FA 1CUKA 1OAIA 2QHOB 2MJ5B 1F4IA 3FRHA 1TTEA 1WJ7A 3MMPA 1G3IA 2MROB 2DKLA 3E21A 1JR3E 2KNZA 3E46A 1T6OA 1E94E 1SG9A 2MGWA 3LCVB 1NV9A 4R71A 1ZV1A 2DHYA 2EKFA 3LCUA 1HT2E 2QNJA 1V92A 2LBCA 1OQYA 1GO5A 1R4GA 3IHPA 5JI2E 1ZMVA 4GEWA 1WGLA 2G3QA 2JZ1A 2LVAA 2DAIA 2EJSA 2L2DA 1BVSA 1DV0A 2HAKA 2PN0A 1IXSA 2JUJA 2JY8A 1MN3A 2JZ0A 1AIPC 4Q7JA 1UFZA 1VEKA 2O25A 1HQYE 2KHHA 2RRUA 1Q02A 2LVPC 1NV8A 2LVOC 1HJPA 2L4EA 3FRIA 2R0IA 2BWBA 1TR8A 2JNHA 2BWEA 3F92A 1A5TA 2LTUA 1YLAA 2ZTDA 1TFEA 3T6PA 2DNAA 1OKSA 1IM2A 1DO2A 3B89A 2DI0A 3GLGE 2K9DA 4DBGB 1DO0A 2B3TA 1VQ1A 2QSFX 1P3QQ 2LVQD 2DAKA 3GLIE 1EFUB 2DAMA 1QZEA 3BBZA 1Y8GA 2DZLA 2DAEA 1WGNA 1WIVA 2OO9A 3FE3A 4UN2B 3GLFE 2LVNC 2EKKA 2DAGA 3BMBA 1VEGA
chains in the Genus database with same CATH superfamily
4LJ5A 3HX3A 4GC5A 1TH4A 4II7A 4P17A 3GPPA 1PGYA 4RF0A 3GO8A 3FUVA 3M0NA 1L2DA 2ZBKB 4Z6YA 3GLHE 1EE8A 3VK8A 4JI2M 2HKJA 5EXTA 5IZ7D 4M0WA 2DHRA 4LCBA 4KO8A 1OTRA 1GL7A 3H4JA 3THGA 3GLIB 4LJAA 3VLFB 2CWBA 1QANA 3HY5A 4JI7M 2F5OA 2WSCK 2ZAMA 3D7JA 4WP2A 1H6UA 3IECA 2KDLA 4AKGA 3FUXA 1N34M 2R6FA 1SXJC 3FD9A 4YHHM 2KNAA 4ANRA 4IBDA 3KVWA 3L25A 2DWNA 3SMSA 2DTTA 3A45A 2JY6B 1G41A 4G4QA 4NE5B 1WURA 1T3TA 3Q8GA 2CRUA 2YQZA 3U60A 2EO2A 4LY6A 3IG5A 3HHXA 5LMUM 3U6SA 1N32M 3TWMA 2V1CA 1L2BA 5E6JA 3EIEA 3HKPA 4QHTA 1NO1A 4B08A 1L1TA 3E46A 3U61A 1IBLM 2QBYA 3FUWA 1WINA 4NSOB 3PNYA 1XMQM 3VDUA 1WM9A 7CATA 5H37D 3T38A 3LCVB 2X8AA 5LMNM 3AOGA 2OQ4A 1OAOC 2UUCM 2YNMD 4GMQA 1HT2E 4ZPXA 5EXSA 3FTEA 1DGBA 4MGZE 2M60A 3FTFA 1IS8A 1PJIA 4X64M 3QAUA 4MGYE 3VKHA 4LG2A 1N36M 4LF6M 4GEWA 4NRWA 5EP1A 4IBKA 2JWSA 4L15A 2JZ1A 2F5NA 2FH0A 2W82A 4GHLA 3MHVC 2AHMA 1IXZA 3GLIA 3RFWA 3M7GA 4MH0E 2JUJA 3VDPA 1YE9A 2KRKA 3QYEA 3L26A 2LNHC 3KDSE 4JI4M 3HU1A 3R8FA 4NTNA 3LZEA 4GIPA 3H4MA 4MGKE 3OTOM 4GKKM 2UXBM 3B74A 1A8RA 2C98A 3WHLA 3SAVA 1N78A 5EXXA 5EJCA 3J2PB 4L78A 4PT5A 1R6BX 1TF0B 2DZOB 3JYGA 1HQYE 4LJ7A 3I4YA 2LVPC 2VQFM 3T15A 1NV8A 3AV0A 2G8LA 2J7NA 1HJPA 5DMZA 2CEAA 3GRRA 1HNXM 2FS1A 2R0IA 2WSCF 3R9XB 4QNMA 2JNHA 3SFZA 4DV4M 1A5TA 4DR7M 5DNYA 3T6PA 1OKSA 4B7GA 2LHGA 3B89A 2CV0A 5ITYA 4IJEA 1PJSA 4B7HA 3L27A 1IN5A 3GLGE 3GRYA 2XEPA 2Y20A 3CF6E 4LFCM 3SYLA 1N77A 1JQJC 4NE3B 2QSFX 3B0BC 1UM8A 2Z4RA 3Q8XA 1JB0F 2LVQD 2F5QA 1AUAA 1XHBA 3TPZA 4MB7A 4R3DA 3UMMA 2UU9M 4DV7M 2BJVA 1GTPA 4B3MM 4G6ZA 4GKJM 1QAMA 4P16A 1SXJB 1D0KA 1XNQM 2DZLA 4GC9A 3PXGA 1HNWM 3TL4X 4D81A 1J09A 1WGNA 2OO9A 3HJQA 3KOZE 5EXPA 4CHTB 1PJQA 4NRVA 4BLCA 2QP9X 2LVNC 2MH8A 2EKKA 2Z4SA 3UJNA 3J81S 4DR4M 1JR3D 1YSYA 2DWMA 1Y13A 1ZMWA 3GLHB 1HT1E 2K0BX 3CF2A 2OBAA 3L29A 4A3VB 3DOAA 3K9OA 3I01M 4PDGA 2UXDM 5KPRA 4G4RA 4E44B 4L16A 3SMPA 3U6DA 1KYIA 2WZJA 3U6OA 1IY2A 2OOBA 3VKGA 4JI6M 2C99A 2CE7A 2HWJA 3NBXX 1IXSB 2GQFA 3SHGB 3T1YM 3QNAA 4FVJA 4X62M 2JY5A 1XXHE 1QUTA 1J7KA 1QQWA 2ZTCA 3ZH9B 2J7OA 4OVZB 3CGWA 4TUWA 4F2LA 4YY3M 2M5ZA 3K1JA 4KHPM 3K8ZA 3MK6A 4E45B 1NY5A 2CP8A 2DZNB 4D82A 1B66A 3DA1A 1NJFA 3HJSA 4DV3M 3C58A 4REZA 4JI1M 4NC6A 2YFQA 4DV0M 1F4IA 3E9SA 1NVMA 4IBJA 3RE8A 2Y0TA 5IT9S 2KW0A 1SXJD 1SXJA 3BXWA 1K3WA 2DKLA 3PNVA 1LTMA 2EA0A 4R7GA 4JN6A 1EL6A 2D7GA 3VK7A 2KA6B 3D8LA 1W5TA 2MGWA 1IN8A 3KS4A 3FTDA 3I04M 4R71A 1ZV1A 1K82A 3LCUA 3W0FA 3ILKA 3UGJA 2R44A 1FJGM 5DYGA 4BB9A 2UUAM 3HHYA 4X65M 4GHAA 1OJLA 3LQQA 4NTMA 3GLHA 2R65A 1ORYB 4FCTA 3V76A 1GABA 4KODA 1OQYA 5FLXS 3MJ5A 2FOIC 2F5PA 3ZCBB 4NE6B 3D8BA 3U6CA 2LVAA 2G3QA 2DVWB 2DAIA 1GLNA 2QCUA 5DYIA 2EJSA 3GRUA 1ZQ9A 3NBIA 1XC8A 3KFUG 1NSFA 1GL6A 1IXSA 1R7RA 4IBIA 4CIZA 5EP3A 1QUSA 4DR1M 2JY8A 3JAMS 2CFOA 2DWZB 4Y28F 2EUCA 2C9CA 4OVZA 8CATA 2XH9A 4GH9A 1AIPC 1NHWC 2C96A 1N3RA 5F3WA 3FUUA 5KQ8A 5JI3E 5IREB 4CJ6A 3AJIB 1VEKA 1C1KA 2ZAOA 4LGMA 1Q02A 1WUQA 3JR5A 3U6QA 2H1RA 2O01G 1L1ZA 3LQRA 2WSEG 3M6AA 1GVNA 1MX0A 3LX3A 1G8PA 2LTUA 1YLAA 2A5YB 1TFEA 2DNAA 4R8QA 2QENA 1OFHA 1DO2A 4IBBA 3QN0A 1L8QA 4QOZC 2XFSA 2KZUA 3K92A 5EQTA 2K9DA 4XGIA 4DBGB 3HWSA 4OU7A 3SBJA 1XMOM 2B3TA 3FYDA 1G59A 1KSFX 1VQ1A 1FB1A 1WPLA 4IBEA 1HNZM 1P3QQ 3VFDA 3CTWB 3GLIE 3TWLA 3KSJA 3QYBA 3FYCA 3KOYE 3RGSA 2Q2EB 2R45A 2I7PA 3B7QA 4LZZA 3E4RA 3KSXA 3I2BA 2P5TA 1OIPA 1WIVA 3SATA 3FE3A 4MM3B 2VIIA 4GRIA 4EIWA 1DGGA 4IIWA 3GLFE 1IBMM 4AG5A 3HJ8A 3BMBA 2CHGA 2LXEA 4NTKA 2KNVA 4QHSA 2L09A 4KLNA 3LW5G 3AOEC 2XF3A 3SHFA 3KS8A 4LFBM 2HCBA 1XB2B 3AKZA 1YUBA 4B3SM 2VF8A 2LNZA 4F1IA 1QYRA 1TH2A 4L4UA 1VDLA 2JY7A 1G4AE 4NXNM 3I51A 3SYKA 4AKIA 1D0MA 4LF8M 3QN9A 2R46A 3GQ3A 4AZFA 4DV5M 4Z8XA 1XXHB 1VG5A 3KW6A 2BJWA 2J5YA 3LMMA 1IN6A 2R4EA 4XK8F 5C1BA 1PJJA 1I94M 2RPBA 1NNJA 3LVVA 4JV5M 2O5RA 4G3OA 2H5XA 3ZC7B 3GLGA 4HLQA 3KP0E 2JP7A 1K3XA 4IJFA 4M9SA 2RKOA 2ZANA 1PM5A 1D0LA 1CUKA 1NNUC 1OAIA 1XWIA 2QHOB 2RGOA 3DFZA 2MJ5B 2WSFG 3SASA 4FCVA 1TTEA 1WJ7A 2APLA 5L8RF 2V1UA 3FUTA 3MMPA 1G3IA 4WURA 4I8OA 3E21A 1JR3E 2HHHM 2UUBM 4NXMM 4LZJA 2L7HA 4RKUF 1V33A 1N33M 5IWAM 2QNJA 5E26A 1TDZA 4LF4M 1XNRM 2LBCA 4IBGA 2CV1A 1E32A 3SARA 4DUZM 1ZMVA 3SAUA 2CV2A 4AI6A 2LH0A 4JI3M 1WGLA 4AKHA 1A9CA 5ITXE 1IY0A 4DUYM 3U6LA 1NY6A 4PCZA 1BVSA 3GRVA 1IBKM 3TWKA 2HAKA 1N3TA 3VEJA 4NSRA 4HL4A 3GQ5A 4DV6M 4PD2A 1XXHA 4IBCA 2R4JA 5KPTA 3EIHA 2Z3XA 4JI5M 1TGUA 4QOSA 1MN3A 4FW9A 5FTJA 3TE6A 1GTQA 2XGNA 4LJ9A 2VF7A 4Q7JA 3U6PA 5GKNA 1TDHA 1R2ZA 2KHHA 1D2NA 4B3RM 3B9PA 2LVOC 2QZ4A 2KXEA 2JXNA 3FRIA 1N75A 3U6MA 2BWBA 1TR8A 2OPFA 2LO0A 1X37A 2Y21A 3A98B 1ZAEA 4DRAE 4OW0A 1IM2A 1QDTA 2FFJA 2QPAA 1Z59A 5ITUA 4NL4H 5FTLA 4WW0A 2DI0A 4L8RC 2R62A 2WSEK 4FCWA 4QNRA 3LVWA 3ZQJA 3JR4A 1J5EM 4QPMA 3J27B 5C18A 2LWXA 2FNAA 2C9OA 2XLJA 1OIZA 4D80A 1QZMA 4BBAA 4ITQA 4JYAM 2I7NA 2FE8A 1EIJA 4G4NA 3PVSA 2DAMA 4FWHA 2KEBA 1QZEA 4M9ZA 1TH3A 4DR3M 1NJGA 1W5SA 3BBZA 5KO3A 1IN4A 1Z5BA 2DAEA 3IG8A 3UK6A 4UN2B 3GLFB 4X66M 4LF5M 2CHVA 3K2LA 4LJ4A 1HQCA 1VEGA 4HEOA 1WR1B 4MGIE 4S12A 1VEJA 4W5WA 4FVGA 2N35A 3K9PA 2K6BA 3AL0C 3DZDA 3GLGB 3J7AS 4IBFA 5EP4A 3B7ZA 2WSCG 4AG6A 1GJTA 2OOAA 3C3EA 1DGFA 3GPUA 3LW5K 3I4VA 3M0EA 2KRUA 2Y0QA 1IY1A 1C7YA 3AFHA 4LFAM 2KR1A 3FKEA 5FTNA 3AOEA 1QVRA 1R2YA 2LHCA 5DFLA 1I4WA 3UZUA 4I81A 1ZMUA 1T43A 1IFYA 2ERCA 3B7NA 2MR9A 4LF9M 3W0LB 4LJ6A 2DENA 4G4OA 4B3TM 2VQEM 4FVMA 1E9RA 1WHCA 2A0SA 4RNAA 2L4FA 3SC3A 2D7EA 5ITRA 2L6OA 2ZM6M 1KFVA 5ITQA 4JI0M 4OX9M 5BPVA 2CUZA 1IN7A 1OFIA 3FRHA 3PFIA 4FVFA 2D7HA 3HHZA 3W68A 1PRBA 2GNOA 2G5GX 4M0DA 2MROB 2O01F 2WSEF 2KNZA 3HU3A 3KOWE 1T6OA 3BOSA 3W67A 2QQ8A 1E94E 1R5LA 1SG9A 3GPYA 3T1HM 2WSFK 1RU3A 3GLFA 1N3SA 1Q3CA 1FBXA 1NV9A 4LGYA 3GP1A 2DJ6A 1LV7A 2DHYA 1E9SA 2EKFA 2R18A 4NOOB 4CISA 4B7FA 3L28A 3HHWA 1V92A 1MJGM 4K0KM 2L7IA 5EP2A 1IQPA 2K47A 1GO5A 1R4GA 1V34A 1Q3BA 3IHPA 5JI2E 3A46A 3CF0A 4DR6M 4M9XA 3NWLA 3U5ZB 4L6V6 1Q39A 3KOXE 2X4AA 2X49A 1IXRC 4KT0F 3A42A 3KP1E 4LJ8A 2L2DA 5A2QS 2Z8YM 5KPZA 1HR0M 1DGHB 1Z5AA 2KZSA 1DV0A 4DU6A 1B6ZA 1Z6TA 1WXQA 2PN0A 4MGHA 2XZFA 2F4VM 2XZUA 3QWLA 1MU5A 4LRSA 1GJSA 4I5SA 3C9PA 2JZ0A 4DRBJ 2DXIA 1FNNA 1GKIA 2XFTA 4CGYB 4FWDA 4LF7M 4I4LA 4GITA 3U6EA 2UXCM 1UFZA 1QDRA 2O25A 5FSWA 2NQ8C 4DR5M 3J7BA 3HGIA 2RRUA 2Z7JA 2RGHA 3LW5F 3C3DA 4XBOA 2VDBB 2DWLA 3FTCA 2L4EA 2YR0A 4FD2A 4DR2M 3F92A 2BWEA 2CHQA 2ZTDA 2JA2A 5BR8M 1JR3A 5FTMA 2F5SA 3J80S 2C5RA 1Z5CA 3RGPA 4JI8M 1NHGC 4LRTA 3GPXA 2V6ZM 1DO0A 3SAWA 1PJTA 1QAOA 3HU2A 3L2AA 2HL7A 3GQ4A 3TQSA 4RF1A 2DAKA 3U60B 2XSZD 1EFUB 2XSZA 1VDDA 1S3SA 4FWGA 4PDIA 5ITXA 3KXEC 5ITTA 3U5ZA 2BNKA 1Y8GA 1G71A 1SXJE 2WSFF 4AQYM 3U61B 2QBYB 4JA3A 4AW4A 3BK6A 1DGHA 5FTKA 5KQDA 1IS7A 2P11A 4DV1M 2E5LM 2G64A 4DV2M 1L2CA 3HZJA 4JXJA 1QAQA 2DAGA 3WHKA
chains in the Genus database with same CATH topology
2KNVA 4HEOA 1WR1B 1PGYA 1VEJA 1ZMWA 1HT1E 2K0BX 3K9PA 3GLHE 3K9OA 1XB2B 2OOAA 4E44B 2LNZA 4F1IA 1KYIA 2WZJA 1OTRA 1VDLA 2JY7A 1G4AE 2OOBA 3H4JA 2CWBA 2HWJA 1C7YA 2JY5A 2KR1A 1VG5A 4WP2A 3IECA 1XXHE 2ZTCA 5DFLA 4G3OA 1ZMUA 2H5XA 1T43A 2KNAA 1IFYA 4F2LA 2MR9A 2JP7A 2DENA 1G41A 2CP8A 2JY6B 4E45B 4NE5B 1WHCA 1WURA 2L4FA 1CUKA 1OAIA 2QHOB 2MJ5B 1F4IA 3FRHA 1TTEA 1WJ7A 3MMPA 1G3IA 2MROB 2DKLA 3E21A 1JR3E 2KNZA 3E46A 1T6OA 1E94E 1EL6A 1SG9A 1WM9A 1N3SA 2MGWA 3LCVB 1FBXA 1NV9A 4R71A 1ZV1A 2DHYA 2EKFA 3LCUA 1HT2E 2QNJA 1V92A 2LBCA 1IS8A 4NE6B 1OQYA 1GO5A 1R4GA 3IHPA 5JI2E 1ZMVA 4GEWA 1A9CA 1WGLA 2G3QA 2JZ1A 2LVAA 2DAIA 2EJSA 2L2DA 1BVSA 4DU6A 1DV0A 3VEJA 2HAKA 1N3TA 2PN0A 1IXSA 2JUJA 2JY8A 1MN3A 2JZ0A 1A8RA 1AIPC 4DRBJ 1N3RA 4Q7JA 1UFZA 1VEKA 2O25A 1HQYE 2KHHA 2RRUA 1WUQA 1Q02A 2LVPC 1NV8A 2LVOC 1HJPA 5DMZA 2L4EA 3FRIA 2R0IA 2BWBA 1TR8A 2JNHA 2BWEA 3F92A 1A5TA 2LTUA 1YLAA 2ZTDA 1TFEA 3T6PA 2DNAA 2LO0A 4DRAE 4R8QA 1OKSA 1IM2A 1DO2A 3B89A 2DI0A 3GLGE 4QPMA 2K9DA 4DBGB 1DO0A 2B3TA 4NE3B 1WPLA 1VQ1A 2QSFX 1FB1A 3B0BC 1P3QQ 2LVQD 2DAKA 3GLIE 1EFUB 2DAMA 1QZEA 1GTPA 3BBZA 1Y8GA 2DZLA 2DAEA 4JA3A 1WGNA 1WIVA 2OO9A 3FE3A 4UN2B 1IS7A 2P11A 3GLFE 2LVNC 2EKKA 2DAGA 3BMBA 1VEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNV A;  4HEO A;  1WR1 B;  1PGY A;  1VEJ A;  1ZMW A;  1HT1 E;  2K0B X;  3K9P A;  3GLH E;  3K9O A;  1XB2 B;  2OOA A;  4F1I A;  1KYI A;  2WZJ A;  1OTR A;  1VDL A;  2JY7 A;  1G4A E;  2OOB A;  3H4J A;  2CWB A;  2HWJ A;  1C7Y A;  2JY5 A;  1VG5 A;  4WP2 A;  3IEC A;  1XXH E;  2ZTC A;  5DFL A;  4G3O A;  1ZMU A;  2H5X A;  1T43 A;  2KNA A;  1IFY A;  4F2L A;  2MR9 A;  2JP7 A;  2DEN A;  1G41 A;  2CP8 A;  2JY6 B;  1WHC A;  2L4F A;  1CUK A;  1OAI A;  2QHO B;  2MJ5 B;  1F4I A;  3FRH A;  1TTE A;  1WJ7 A;  3MMP A;  1G3I A;  2MRO B;  2DKL A;  3E21 A;  1JR3 E;  2KNZ A;  3E46 A;  1T6O A;  1E94 E;  1SG9 A;  2MGW A;  3LCV B;  1NV9 A;  4R71 A;  1ZV1 A;  2DHY A;  2EKF A;  3LCU A;  1HT2 E;  2QNJ A;  1V92 A;  2LBC A;  1OQY A;  1GO5 A;  1R4G A;  3IHP A;  5JI2 E;  1ZMV A;  4GEW A;  1WGL A;  2G3Q A;  2JZ1 A;  2LVA A;  2DAI A;  2EJS A;  2L2D A;  1BVS A;  1DV0 A;  2HAK A;  2PN0 A;  1IXS A;  2JUJ A;  2JY8 A;  1MN3 A;  2JZ0 A;  1AIP C;  4Q7J A;  1UFZ A;  1VEK A;  2O25 A;  1HQY E;  2KHH A;  2RRU A;  1Q02 A;  2LVP C;  1NV8 A;  2LVO C;  1HJP A;  2L4E A;  3FRI A;  2R0I A;  2BWB A;  1TR8 A;  2JNH A;  2BWE A;  3F92 A;  1A5T A;  2LTU A;  1YLA A;  2ZTD A;  1TFE A;  3T6P A;  2DNA A;  1OKS A;  1IM2 A;  1DO2 A;  3B89 A;  2DI0 A;  3GLG E;  2K9D A;  4DBG B;  1DO0 A;  2B3T A;  1VQ1 A;  2QSF X;  1P3Q Q;  2LVQ D;  2DAK A;  3GLI E;  1EFU B;  2DAM A;  1QZE A;  3BBZ A;  1Y8G A;  2DZL A;  2DAE A;  1WGN A;  1WIV A;  2OO9 A;  3FE3 A;  4UN2 B;  3GLF E;  2LVN C;  2EKK A;  2DAG A;  3BMB A;  1VEG A; 
#chains in the Genus database with same CATH topology
 4LJ5 A;  3HX3 A;  4GC5 A;  1TH4 A;  4II7 A;  4P17 A;  3GPP A;  1PGY A;  4RF0 A;  3GO8 A;  3FUV A;  3M0N A;  1L2D A;  2ZBK B;  4Z6Y A;  3GLH E;  1EE8 A;  3VK8 A;  4JI2 M;  2HKJ A;  5EXT A;  5IZ7 D;  4M0W A;  2DHR A;  4LCB A;  4KO8 A;  1OTR A;  1GL7 A;  3H4J A;  3THG A;  3GLI B;  4LJA A;  3VLF B;  2CWB A;  1QAN A;  3HY5 A;  4JI7 M;  2F5O A;  2WSC K;  2ZAM A;  3D7J A;  4WP2 A;  1H6U A;  3IEC A;  2KDL A;  4AKG A;  3FUX A;  1N34 M;  2R6F A;  1SXJ C;  3FD9 A;  4YHH M;  2KNA A;  4ANR A;  4IBD A;  3KVW A;  3L25 A;  2DWN A;  3SMS A;  2DTT A;  3A45 A;  2JY6 B;  1G41 A;  4G4Q A;  4NE5 B;  1WUR A;  1T3T A;  3Q8G A;  2CRU A;  2YQZ A;  3U60 A;  2EO2 A;  4LY6 A;  3IG5 A;  3HHX A;  5LMU M;  3U6S A;  1N32 M;  3TWM A;  2V1C A;  1L2B A;  5E6J A;  3EIE A;  3HKP A;  4QHT A;  1NO1 A;  4B08 A;  1L1T A;  3E46 A;  3U61 A;  1IBL M;  2QBY A;  3FUW A;  1WIN A;  4NSO B;  3PNY A;  1XMQ M;  3VDU A;  1WM9 A;  7CAT A;  5H37 D;  3T38 A;  3LCV B;  2X8A A;  5LMN M;  3AOG A;  2OQ4 A;  1OAO C;  2UUC M;  2YNM D;  4GMQ A;  1HT2 E;  4ZPX A;  5EXS A;  3FTE A;  1DGB A;  4MGZ E;  2M60 A;  3FTF A;  1IS8 A;  1PJI A;  4X64 M;  3QAU A;  4MGY E;  3VKH A;  4LG2 A;  1N36 M;  4LF6 M;  4GEW A;  4NRW A;  5EP1 A;  4IBK A;  2JWS A;  4L15 A;  2JZ1 A;  2F5N A;  2FH0 A;  2W82 A;  4GHL A;  3MHV C;  2AHM A;  1IXZ A;  3GLI A;  3RFW A;  3M7G A;  4MH0 E;  2JUJ A;  3VDP A;  1YE9 A;  2KRK A;  3QYE A;  3L26 A;  2LNH C;  3KDS E;  4JI4 M;  3HU1 A;  3R8F A;  4NTN A;  3LZE A;  4GIP A;  3H4M A;  4MGK E;  3OTO M;  4GKK M;  2UXB M;  3B74 A;  1A8R A;  2C98 A;  3WHL A;  3SAV A;  1N78 A;  5EXX A;  5EJC A;  3J2P B;  4L78 A;  4PT5 A;  1R6B X;  1TF0 B;  2DZO B;  3JYG A;  1HQY E;  4LJ7 A;  3I4Y A;  2LVP C;  2VQF M;  3T15 A;  1NV8 A;  3AV0 A;  2G8L A;  2J7N A;  1HJP A;  5DMZ A;  2CEA A;  3GRR A;  1HNX M;  2FS1 A;  2R0I A;  2WSC F;  3R9X B;  4QNM A;  2JNH A;  3SFZ A;  4DV4 M;  1A5T A;  4DR7 M;  5DNY A;  3T6P A;  1OKS A;  4B7G A;  2LHG A;  3B89 A;  2CV0 A;  5ITY A;  4IJE A;  1PJS A;  4B7H A;  3L27 A;  1IN5 A;  3GLG E;  3GRY A;  2XEP A;  2Y20 A;  3CF6 E;  4LFC M;  3SYL A;  1N77 A;  1JQJ C;  4NE3 B;  2QSF X;  3B0B C;  1UM8 A;  2Z4R A;  3Q8X A;  1JB0 F;  2LVQ D;  2F5Q A;  1AUA A;  1XHB A;  3TPZ A;  4MB7 A;  4R3D A;  3UMM A;  2UU9 M;  4DV7 M;  2BJV A;  1GTP A;  4B3M M;  4G6Z A;  4GKJ M;  1QAM A;  4P16 A;  1SXJ B;  1D0K A;  1XNQ M;  2DZL A;  4GC9 A;  3PXG A;  1HNW M;  3TL4 X;  4D81 A;  1J09 A;  1WGN A;  2OO9 A;  3HJQ A;  3KOZ E;  5EXP A;  4CHT B;  1PJQ A;  4NRV A;  4BLC A;  2QP9 X;  2LVN C;  2MH8 A;  2EKK A;  2Z4S A;  3UJN A;  3J81 S;  4DR4 M;  1JR3 D;  1YSY A;  2DWM A;  1Y13 A;  1ZMW A;  3GLH B;  1HT1 E;  2K0B X;  3CF2 A;  2OBA A;  3L29 A;  4A3V B;  3DOA A;  3K9O A;  3I01 M;  4PDG A;  2UXD M;  5KPR A;  4G4R A;  4E44 B;  4L16 A;  3SMP A;  3U6D A;  1KYI A;  2WZJ A;  3U6O A;  1IY2 A;  2OOB A;  3VKG A;  4JI6 M;  2C99 A;  2CE7 A;  2HWJ A;  3NBX X;  1IXS B;  2GQF A;  3SHG B;  3T1Y M;  3QNA A;  4FVJ A;  4X62 M;  2JY5 A;  1XXH E;  1QUT A;  1J7K A;  1QQW A;  2ZTC A;  3ZH9 B;  2J7O A;  4OVZ B;  3CGW A;  4TUW A;  4F2L A;  4YY3 M;  2M5Z A;  3K1J A;  4KHP M;  3K8Z A;  3MK6 A;  4E45 B;  1NY5 A;  2CP8 A;  2DZN B;  4D82 A;  1B66 A;  3DA1 A;  1NJF A;  3HJS A;  4DV3 M;  3C58 A;  4REZ A;  4JI1 M;  4NC6 A;  2YFQ A;  4DV0 M;  1F4I A;  3E9S A;  1NVM A;  4IBJ A;  3RE8 A;  2Y0T A;  5IT9 S;  2KW0 A;  1SXJ D;  1SXJ A;  3BXW A;  1K3W A;  2DKL A;  3PNV A;  1LTM A;  2EA0 A;  4R7G A;  4JN6 A;  1EL6 A;  2D7G A;  3VK7 A;  2KA6 B;  3D8L A;  1W5T A;  2MGW A;  1IN8 A;  3KS4 A;  3FTD A;  3I04 M;  4R71 A;  1ZV1 A;  1K82 A;  3LCU A;  3W0F A;  3ILK A;  3UGJ A;  2R44 A;  1FJG M;  5DYG A;  4BB9 A;  2UUA M;  3HHY A;  4X65 M;  4GHA A;  1OJL A;  3LQQ A;  4NTM A;  3GLH A;  2R65 A;  1ORY B;  4FCT A;  3V76 A;  1GAB A;  4KOD A;  1OQY A;  5FLX S;  3MJ5 A;  2FOI C;  2F5P A;  3ZCB B;  4NE6 B;  3D8B A;  3U6C A;  2LVA A;  2G3Q A;  2DVW B;  2DAI A;  1GLN A;  2QCU A;  5DYI A;  2EJS A;  3GRU A;  1ZQ9 A;  3NBI A;  1XC8 A;  3KFU G;  1NSF A;  1GL6 A;  1IXS A;  1R7R A;  4IBI A;  4CIZ A;  5EP3 A;  1QUS A;  4DR1 M;  2JY8 A;  3JAM S;  2CFO A;  2DWZ B;  4Y28 F;  2EUC A;  2C9C A;  4OVZ A;  8CAT A;  2XH9 A;  4GH9 A;  1AIP C;  1NHW C;  2C96 A;  1N3R A;  5F3W A;  3FUU A;  5KQ8 A;  5JI3 E;  5IRE B;  4CJ6 A;  3AJI B;  1VEK A;  1C1K A;  2ZAO A;  4LGM A;  1Q02 A;  1WUQ A;  3JR5 A;  3U6Q A;  2H1R A;  2O01 G;  1L1Z A;  3LQR A;  2WSE G;  3M6A A;  1GVN A;  1MX0 A;  3LX3 A;  1G8P A;  2LTU A;  1YLA A;  2A5Y B;  1TFE A;  2DNA A;  4R8Q A;  2QEN A;  1OFH A;  1DO2 A;  4IBB A;  3QN0 A;  1L8Q A;  4QOZ C;  2XFS A;  2KZU A;  3K92 A;  5EQT A;  2K9D A;  4XGI A;  4DBG B;  3HWS A;  4OU7 A;  3SBJ A;  1XMO M;  2B3T A;  3FYD A;  1G59 A;  1KSF X;  1VQ1 A;  1FB1 A;  1WPL A;  4IBE A;  1HNZ M;  1P3Q Q;  3VFD A;  3CTW B;  3GLI E;  3TWL A;  3KSJ A;  3QYB A;  3FYC A;  3KOY E;  3RGS A;  2Q2E B;  2R45 A;  2I7P A;  3B7Q A;  4LZZ A;  3E4R A;  3KSX A;  3I2B A;  2P5T A;  1OIP A;  1WIV A;  3SAT A;  3FE3 A;  4MM3 B;  2VII A;  4GRI A;  4EIW A;  1DGG A;  4IIW A;  3GLF E;  1IBM M;  4AG5 A;  3HJ8 A;  3BMB A;  2CHG A;  2LXE A;  4NTK A;  2KNV A;  4QHS A;  2L09 A;  4KLN A;  3LW5 G;  3AOE C;  2XF3 A;  3SHF A;  3KS8 A;  4LFB M;  2HCB A;  1XB2 B;  3AKZ A;  1YUB A;  4B3S M;  2VF8 A;  2LNZ A;  4F1I A;  1QYR A;  1TH2 A;  4L4U A;  1VDL A;  2JY7 A;  1G4A E;  4NXN M;  3I51 A;  3SYK A;  4AKI A;  1D0M A;  4LF8 M;  3QN9 A;  2R46 A;  3GQ3 A;  4AZF A;  4DV5 M;  4Z8X A;  1XXH B;  1VG5 A;  3KW6 A;  2BJW A;  2J5Y A;  3LMM A;  1IN6 A;  2R4E A;  4XK8 F;  5C1B A;  1PJJ A;  1I94 M;  2RPB A;  1NNJ A;  3LVV A;  4JV5 M;  2O5R A;  4G3O A;  2H5X A;  3ZC7 B;  3GLG A;  4HLQ A;  3KP0 E;  2JP7 A;  1K3X A;  4IJF A;  4M9S A;  2RKO A;  2ZAN A;  1PM5 A;  1D0L A;  1CUK A;  1NNU C;  1OAI A;  1XWI A;  2QHO B;  2RGO A;  3DFZ A;  2MJ5 B;  2WSF G;  3SAS A;  4FCV A;  1TTE A;  1WJ7 A;  2APL A;  5L8R F;  2V1U A;  3FUT A;  3MMP A;  1G3I A;  4WUR A;  4I8O A;  3E21 A;  1JR3 E;  2HHH M;  2UUB M;  4NXM M;  4LZJ A;  2L7H A;  4RKU F;  1V33 A;  1N33 M;  5IWA M;  2QNJ A;  5E26 A;  1TDZ A;  4LF4 M;  1XNR M;  2LBC A;  4IBG A;  2CV1 A;  1E32 A;  3SAR A;  4DUZ M;  1ZMV A;  3SAU A;  2CV2 A;  4AI6 A;  2LH0 A;  4JI3 M;  1WGL A;  4AKH A;  1A9C A;  5ITX E;  1IY0 A;  4DUY M;  3U6L A;  1NY6 A;  4PCZ A;  1BVS A;  3GRV A;  1IBK M;  3TWK A;  2HAK A;  1N3T A;  3VEJ A;  4NSR A;  4HL4 A;  3GQ5 A;  4DV6 M;  4PD2 A;  1XXH A;  4IBC A;  2R4J A;  5KPT A;  3EIH A;  2Z3X A;  4JI5 M;  1TGU A;  4QOS A;  1MN3 A;  4FW9 A;  5FTJ A;  3TE6 A;  1GTQ A;  2XGN A;  4LJ9 A;  2VF7 A;  4Q7J A;  3U6P A;  5GKN A;  1TDH A;  1R2Z A;  2KHH A;  1D2N A;  4B3R M;  3B9P A;  2LVO C;  2QZ4 A;  2KXE A;  2JXN A;  3FRI A;  1N75 A;  3U6M A;  2BWB A;  1TR8 A;  2OPF A;  2LO0 A;  1X37 A;  2Y21 A;  3A98 B;  1ZAE A;  4DRA E;  4OW0 A;  1IM2 A;  1QDT A;  2FFJ A;  2QPA A;  1Z59 A;  5ITU A;  4NL4 H;  5FTL A;  4WW0 A;  2DI0 A;  4L8R C;  2R62 A;  2WSE K;  4FCW A;  4QNR A;  3LVW A;  3ZQJ A;  3JR4 A;  1J5E M;  4QPM A;  3J27 B;  5C18 A;  2LWX A;  2FNA A;  2C9O A;  2XLJ A;  1OIZ A;  4D80 A;  1QZM A;  4BBA A;  4ITQ A;  4JYA M;  2I7N A;  2FE8 A;  1EIJ A;  4G4N A;  3PVS A;  2DAM A;  4FWH A;  2KEB A;  1QZE A;  4M9Z A;  1TH3 A;  4DR3 M;  1NJG A;  1W5S A;  3BBZ A;  5KO3 A;  1IN4 A;  1Z5B A;  2DAE A;  3IG8 A;  3UK6 A;  4UN2 B;  3GLF B;  4X66 M;  4LF5 M;  2CHV A;  3K2L A;  4LJ4 A;  1HQC A;  1VEG A;  4HEO A;  1WR1 B;  4MGI E;  4S12 A;  1VEJ A;  4W5W A;  4FVG A;  2N35 A;  3K9P A;  2K6B A;  3AL0 C;  3DZD A;  3GLG B;  3J7A S;  4IBF A;  5EP4 A;  3B7Z A;  2WSC G;  4AG6 A;  1GJT A;  2OOA A;  3C3E A;  1DGF A;  3GPU A;  3LW5 K;  3I4V A;  3M0E A;  2KRU A;  2Y0Q A;  1IY1 A;  1C7Y A;  3AFH A;  4LFA M;  2KR1 A;  3FKE A;  5FTN A;  3AOE A;  1QVR A;  1R2Y A;  2LHC A;  5DFL A;  1I4W A;  3UZU A;  4I81 A;  1ZMU A;  1T43 A;  1IFY A;  2ERC A;  3B7N A;  2MR9 A;  4LF9 M;  3W0L B;  4LJ6 A;  2DEN A;  4G4O A;  4B3T M;  2VQE M;  4FVM A;  1E9R A;  1WHC A;  2A0S A;  4RNA A;  2L4F A;  3SC3 A;  2D7E A;  5ITR A;  2L6O A;  2ZM6 M;  1KFV A;  5ITQ A;  4JI0 M;  4OX9 M;  5BPV A;  2CUZ A;  1IN7 A;  1OFI A;  3FRH A;  3PFI A;  4FVF A;  2D7H A;  3HHZ A;  3W68 A;  1PRB A;  2GNO A;  2G5G X;  4M0D A;  2MRO B;  2O01 F;  2WSE F;  2KNZ A;  3HU3 A;  3KOW E;  1T6O A;  3BOS A;  3W67 A;  2QQ8 A;  1E94 E;  1R5L A;  1SG9 A;  3GPY A;  3T1H M;  2WSF K;  1RU3 A;  3GLF A;  1N3S A;  1Q3C A;  1FBX A;  1NV9 A;  4LGY A;  3GP1 A;  2DJ6 A;  1LV7 A;  2DHY A;  1E9S A;  2EKF A;  2R18 A;  4NOO B;  4CIS A;  4B7F A;  3L28 A;  3HHW A;  1V92 A;  1MJG M;  4K0K M;  2L7I A;  5EP2 A;  1IQP A;  2K47 A;  1GO5 A;  1R4G A;  1V34 A;  1Q3B A;  3IHP A;  5JI2 E;  3A46 A;  3CF0 A;  4DR6 M;  4M9X A;  3NWL A;  3U5Z B;  4L6V 6;  1Q39 A;  3KOX E;  2X4A A;  2X49 A;  1IXR C;  4KT0 F;  3A42 A;  3KP1 E;  4LJ8 A;  2L2D A;  5A2Q S;  2Z8Y M;  5KPZ A;  1HR0 M;  1DGH B;  1Z5A A;  2KZS A;  1DV0 A;  4DU6 A;  1B6Z A;  1Z6T A;  1WXQ A;  2PN0 A;  4MGH A;  2XZF A;  2F4V M;  2XZU A;  3QWL A;  1MU5 A;  4LRS A;  1GJS A;  4I5S A;  3C9P A;  2JZ0 A;  4DRB J;  2DXI A;  1FNN A;  1GKI A;  2XFT A;  4CGY B;  4FWD A;  4LF7 M;  4I4L A;  4GIT A;  3U6E A;  2UXC M;  1UFZ A;  1QDR A;  2O25 A;  5FSW A;  2NQ8 C;  4DR5 M;  3J7B A;  3HGI A;  2RRU A;  2Z7J A;  2RGH A;  3LW5 F;  3C3D A;  4XBO A;  2VDB B;  2DWL A;  3FTC A;  2L4E A;  2YR0 A;  4FD2 A;  4DR2 M;  3F92 A;  2BWE A;  2CHQ A;  2ZTD A;  2JA2 A;  5BR8 M;  1JR3 A;  5FTM A;  2F5S A;  3J80 S;  2C5R A;  1Z5C A;  3RGP A;  4JI8 M;  1NHG C;  4LRT A;  3GPX A;  2V6Z M;  1DO0 A;  3SAW A;  1PJT A;  1QAO A;  3HU2 A;  3L2A A;  2HL7 A;  3GQ4 A;  3TQS A;  4RF1 A;  2DAK A;  3U60 B;  2XSZ D;  1EFU B;  2XSZ A;  1VDD A;  1S3S A;  4FWG A;  4PDI A;  5ITX A;  3KXE C;  5ITT A;  3U5Z A;  2BNK A;  1Y8G A;  1G71 A;  1SXJ E;  2WSF F;  4AQY M;  3U61 B;  2QBY B;  4JA3 A;  4AW4 A;  3BK6 A;  1DGH A;  5FTK A;  5KQD A;  1IS7 A;  2P11 A;  4DV1 M;  2E5L M;  2G64 A;  4DV2 M;  1L2C A;  3HZJ A;  4JXJ A;  1QAQ A;  2DAG A;  3WHK A; 
#chains in the Genus database with same CATH homology
 2KNV A;  4HEO A;  1WR1 B;  1PGY A;  1VEJ A;  1ZMW A;  1HT1 E;  2K0B X;  3K9P A;  3GLH E;  3K9O A;  1XB2 B;  2OOA A;  4E44 B;  2LNZ A;  4F1I A;  1KYI A;  2WZJ A;  1OTR A;  1VDL A;  2JY7 A;  1G4A E;  2OOB A;  3H4J A;  2CWB A;  2HWJ A;  1C7Y A;  2JY5 A;  2KR1 A;  1VG5 A;  4WP2 A;  3IEC A;  1XXH E;  2ZTC A;  5DFL A;  4G3O A;  1ZMU A;  2H5X A;  1T43 A;  2KNA A;  1IFY A;  4F2L A;  2MR9 A;  2JP7 A;  2DEN A;  1G41 A;  2CP8 A;  2JY6 B;  4E45 B;  4NE5 B;  1WHC A;  1WUR A;  2L4F A;  1CUK A;  1OAI A;  2QHO B;  2MJ5 B;  1F4I A;  3FRH A;  1TTE A;  1WJ7 A;  3MMP A;  1G3I A;  2MRO B;  2DKL A;  3E21 A;  1JR3 E;  2KNZ A;  3E46 A;  1T6O A;  1E94 E;  1EL6 A;  1SG9 A;  1WM9 A;  1N3S A;  2MGW A;  3LCV B;  1FBX A;  1NV9 A;  4R71 A;  1ZV1 A;  2DHY A;  2EKF A;  3LCU A;  1HT2 E;  2QNJ A;  1V92 A;  2LBC A;  1IS8 A;  4NE6 B;  1OQY A;  1GO5 A;  1R4G A;  3IHP A;  5JI2 E;  1ZMV A;  4GEW A;  1A9C A;  1WGL A;  2G3Q A;  2JZ1 A;  2LVA A;  2DAI A;  2EJS A;  2L2D A;  1BVS A;  4DU6 A;  1DV0 A;  3VEJ A;  2HAK A;  1N3T A;  2PN0 A;  1IXS A;  2JUJ A;  2JY8 A;  1MN3 A;  2JZ0 A;  1A8R A;  1AIP C;  4DRB J;  1N3R A;  4Q7J A;  1UFZ A;  1VEK A;  2O25 A;  1HQY E;  2KHH A;  2RRU A;  1WUQ A;  1Q02 A;  2LVP C;  1NV8 A;  2LVO C;  1HJP A;  5DMZ A;  2L4E A;  3FRI A;  2R0I A;  2BWB A;  1TR8 A;  2JNH A;  2BWE A;  3F92 A;  1A5T A;  2LTU A;  1YLA A;  2ZTD A;  1TFE A;  3T6P A;  2DNA A;  2LO0 A;  4DRA E;  4R8Q A;  1OKS A;  1IM2 A;  1DO2 A;  3B89 A;  2DI0 A;  3GLG E;  4QPM A;  2K9D A;  4DBG B;  1DO0 A;  2B3T A;  4NE3 B;  1WPL A;  1VQ1 A;  2QSF X;  1FB1 A;  3B0B C;  1P3Q Q;  2LVQ D;  2DAK A;  3GLI E;  1EFU B;  2DAM A;  1QZE A;  1GTP A;  3BBZ A;  1Y8G A;  2DZL A;  2DAE A;  4JA3 A;  1WGN A;  1WIV A;  2OO9 A;  3FE3 A;  4UN2 B;  1IS7 A;  2P11 A;  3GLF E;  2LVN C;  2EKK A;  2DAG A;  3BMB A;  1VEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...