4Q7JA

Complex structure of viral rna polymerase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
TASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Ts
publication title Molecular insights into replication initiation by Q beta replicase using ribosomal protein S1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation/transferase
total genus 78
structure length 278
sequence length 278
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4q7jA01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4q7jA04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA03
1E94E 2JY7A 1TTEA 2LVQD 1HJPA 2DENA 2EKKA 5DFLA 3FRIA 1MN3A 2KNAA 3BBZA 1KYIA 1JR3E 2KNVA 2MJ5B 1OTRA 1ZMVA 2OO9A 1ZMUA 3FRHA 2BWEA 1UFZA 2JUJA 2HWJA 2OOBA 3MMPA 2JP7A 2JY8A 4UN2B 1DV0A 4G3OA 3H4JA 5JI2E 1IFYA 3FE3A 2OOAA 1TR8A 2PN0A 2JY6B 2LTUA 2LVAA 1DO0A 2DNAA 1G41A 1WHCA 1EFUB 3GLHE 2B3TA 2L4FA 1V92A 3B89A 2HAKA 4GEWA 1HT2E 4Q7JA 1VEKA 2QSFX 3BMBA 2EKFA 1VDLA 2KHHA 3K9OA 2LBCA 4R71A 2LVNC 2JZ1A 3K9PA 1T43A 3IHPA 4F1IA 1T6OA 4WP2A 1WR1B 1IM2A 1WJ7A 1R4GA 2MR9A 1ZMWA 3F92A 3GLFE 2DAIA 1YLAA 3GLIE 2RRUA 1P3QQ 1VEGA 1Y8GA 2LVPC 1OKSA 2DKLA 4DBGB 2DAEA 2O25A 1VEJA 1VG5A 1QZEA 1NV9A 2MROB 2DAKA 2ZTDA 3E46A 1HT1E 2JNHA 1G4AE 2JY5A 2LVOC 2WZJA 2ZTCA 2DAMA 1GO5A 1CUKA 2QHOB 2L2DA 3IECA 1WGLA 1VQ1A 1AIPC 3LCUA 1A5TA 2EJSA 1NV8A 2DAGA 2CWBA 2R0IA 1HQYE 2DZLA 1ZV1A 1DO2A 2CP8A 1TFEA 2L4EA 3T6PA 1XB2B 1OAIA 2QNJA 4HEOA 1BVSA 1XXHE 4F2LA 1WGNA 2DHYA 1OQYA 3E21A 2BWBA 3LCVB 2KNZA 1IXSA 2K9DA 2DI0A 1SG9A 1G3IA 3GLGE 1PGYA 1C7YA 1WIVA 2G3QA 2MGWA 2H5XA 1Q02A 2JZ0A 1F4IA 2K0BX
chains in the Genus database with same CATH superfamily
5FLXS 5H37D 4R8QA 2C99A 3T15A 3U6CA 1E94E 3J7AS 2L7HA 1D2NA 2CV1A 3FUTA 3FRIA 4M0DA 4D80A 3U61A 3I01M 1IN5A 3GP1A 3Q8GA 5FTMA 4FWHA 2WSEK 2C96A 3I4VA 1JR3E 4LRTA 3HHYA 3UGJA 1V33A 2OO9A 4TUWA 2G64A 4EIWA 1E9SA 2JUJA 2XFSA 1IY0A 3KOZE 1XNRM 2R4JA 2QZ4A 3MMPA 1D0MA 2OPFA 4NE5B 3AOEA 3LMMA 2JY8A 1DV0A 2WSCK 1R7RA 3SYKA 3AOEC 2XF3A 3FE3A 2ZBKB 3I04M 4OVZB 2OOAA 3TWKA 4DR5M 3T1HM 3C58A 3GQ4A 1N3RA 1FNNA 1PJQA 2XEPA 2DWZB 4OVZA 3RE8A 3UMMA 3VLFB 3UJNA 1E9RA 1G71A 2ERCA 4JN6A 3C9PA 2DNAA 5EP2A 1QYRA 4JI0M 1N33M 5DMZA 1TDZA 4LRSA 1K82A 3TL4X 2DZNB 3DZDA 1Z5AA 4KODA 4Q7JA 4FW9A 4QNMA 1KSFX 1VEKA 2CFOA 4JI3M 4KLNA 1VDLA 3K9OA 4RNAA 4R71A 2LVNC 1XC8A 3KSJA 1IBKM 1NNJA 3K9PA 4AKGA 3BOSA 3L28A 4IBJA 1B6ZA 3T38A 4L16A 3AOGA 3FKEA 3ILKA 4PD2A 4G4QA 2XSZD 5DYGA 1R4GA 1GJTA 4DRBJ 2DZOB 3GLFE 2DAIA 3M7GA 4CJ6A 2ZAOA 3MK6A 4NOOB 4X66M 2DXIA 3QN0A 2EUCA 3KSXA 1NVMA 3CF6E 1WINA 2ZM6M 1W5TA 1DGBA 4OU7A 2VF8A 4LF7M 3J27B 2F4VM 2MROB 3DFZA 4LJAA 2KR1A 1QDTA 3HWSA 3E46A 1XMQM 3B74A 3THGA 1QAQA 2XH9A 5ITUA 2L2DA 2DTTA 1WGLA 4S12A 5FSWA 2XLJA 1NO1A 2XFTA 3LW5K 2UUAM 5GKNA 3R8FA 4NE3B 1JR3A 4FCVA 2F5PA 1NSFA 4MB7A 3TQSA 3GPXA 1N78A 2WSEG 4B3MM 2I7NA 2QP9X 3J2PB 1XHBA 1AUAA 1NV8A 3PFIA 4DR4M 3RGPA 1QAOA 3GPUA 2R0IA 4LFCM 4QOSA 2DZLA 4ITQA 4B08A 4QPMA 5IWAM 1IQPA 2X49A 1QUSA 3Q8XA 4AG5A 3SARA 4GIPA 1TFEA 2RPBA 2AHMA 2WSCG 2DVWB 2LHCA 1IXZA 3QN9A 2LO0A 3LVWA 3TPZA 1X37A 3QNAA 5BR8M 4GITA 5KPTA 1XXHE 2RKOA 3E21A 2VQEM 1GVNA 2FNAA 2DHRA 1HQCA 3BXWA 2KNZA 3J81S 1IY1A 3FYDA 2DI0A 3U6DA 1G3IA 3AFHA 4BBAA 3GLGE 4JI5M 1C7YA 2D7HA 3A98B 3QYBA 4P16A 8CATA 3KOWE 4IJFA 3H4JA 3U6LA 2DJ6A 2APLA 2XZFA 3BK6A 1I94M 1YE9A 2FH0A 5EXXA 3PXGA 3GLFB 3L25A 2GNOA 1HJPA 2LNHC 2EKKA 4LGMA 3GLFA 2VQFM 4YY3M 4NTMA 3HHWA 1MN3A 4GC9A 2KRKA 4DV2M 3J80S 4JI2M 2JA2A 2RGHA 3QWLA 4DV0M 2MJ5B 2R62A 1ZMUA 1GTQA 1OAOC 2BWEA 2J7NA 4XBOA 2QPAA 4QHTA 4WW0A 3W67A 5A2QS 3GO8A 2HWJA 4FWGA 1K3XA 1QDRA 2OOBA 5EP1A 2M60A 2JP7A 3TWMA 3M0EA 4LF9M 1NY5A 3FD9A 1IFYA 1GLNA 3DOAA 3U6OA 1K3WA 3SATA 2K47A 3NBXX 3K92A 2XSZA 4I8OA 2D7EA 3FTFA 1IN6A 4NTKA 3VDPA 1EIJA 5F3WA 1N3SA 3SHGB 3KVWA 4LY6A 4JI6M 3LW5G 1OJLA 3W0LB 2R46A 4DV5M 3K2LA 4Z8XA 4PCZA 5FTLA 1EFUB 1NHGC 2KW0A 3TWLA 3HHXA 2O5RA 4LJ9A 2L4FA 5KPRA 3B89A 2HCBA 1WM9A 3FUWA 2R6FA 4GC5A 4AI6A 5KQDA 2DWMA 3BMBA 2HL7A 3SYLA 3W0FA 2KHHA 2LBCA 1Q3BA 4E45B 1PJIA 4KT0F 3NWLA 4F1IA 2GQFA 3VKGA 3I4YA 1XXHB 4NRWA 4M9SA 2X4AA 1Z5CA 1PM5A 1XXHA 3AV0A 2BNKA 3GLIE 4G4RA 1J7KA 1YLAA 3GLGB 1L8QA 4FD2A 4GKJM 4X65M 3GLGA 4R3DA 3GRRA 5IREB 1NNUC 5KQ8A 4G4NA 2LVPC 1OKSA 2DKLA 2R45A 3L26A 2O25A 5ITQA 3A46A 4DV4M 1HNXM 3V76A 3SAWA 3RFWA 1VEJA 1PRBA 1VG5A 3C3EA 3FTDA 3PVSA 5KPZA 1NV9A 4X64M 1UM8A 2P11A 2DAKA 1QVRA 2L09A 3K1JA 5JI3E 4JV5M 2ZAMA 1HT1E 1OFIA 2JNHA 2WSFF 4FVMA 2LVOC 3JYGA 3ZCBB 2Z3XA 1GO5A 1MJGM 1QANA 3IECA 4B3TM 1N75A 1I4WA 2VF7A 1N32M 1EE8A 5IZ7D 4LF5M 2XZUA 4I5SA 4DUYM 3SC3A 3U5ZB 1VQ1A 2J5YA 1C1KA 1AIPC 4OW0A 4D81A 3K8ZA 4AZFA 3ZQJA 4B7GA 3U5ZA 2QCUA 2KXEA 4MM3B 5C1BA 2LNZA 3HGIA 1JQJC 5EP3A 4Z6YA 2QBYB 1JB0F 4DRAE 3UZUA 3QAUA 1D0KA 3PNVA 2QBYA 4NSOB 2P5TA 4CGYB 1L2BA 4JI4M 1G59A 3SMPA 4X62M 2CE7A 2JXNA 5IT9S 3M0NA 1HR0M 3IG8A 4HL4A 2QNJA 1TH3A 3GRUA 1N34M 1BVSA 4PDGA 1R6BX 2EO2A 3FYCA 4F2LA 5EP4A 4DR7M 1Y13A 3KS4A 3SAVA 3EIHA 2KZUA 2K9DA 2XGNA 4W5WA 4B7FA 4DR3M 3HU2A 1H6UA 1PGYA 1WXQA 2NQ8C 4IBKA 3I2BA 2W82A 5E26A 2H5XA 5FTKA 3U6MA 4DR2M 4L8RC 1QZMA 1J5EM 3FTEA 2K0BX 2LXEA 3B7NA 4AKIA 4IBIA 4M0WA 3E4RA 4MGKE 4GRIA 2LWXA 4LJ7A 4FCWA 3GPPA 3GLIB 1PJJA 1TTEA 3VFDA 3GLIA 2WSEF 3PNYA 4CISA 2DENA 5DFLA 3MJ5A 2KRUA 3B9PA 4LJ6A 4QOZC 3VKHA 3VK8A 3BBZA 2V6ZM 1KFVA 2FE8A 4LF8M 4AG6A 2FOIC 5EJCA 1OTRA 1ZAEA 4GMQA 3FRHA 5KO3A 4K0KM 3ZC7B 4LCBA 4JI1M 4LJ8A 2UUCM 2OQ4A 2O01F 1T3TA 2E5LM 4UN2B 2F5NA 4FWDA 5E6JA 1WPLA 1E32A 4HLQA 1S3SA 3D8LA 5ITXE 1TR8A 3D8BA 2K6BA 4AW4A 1XNQM 2JY6B 1PJTA 2C9OA 4NL4H 3JR5A 3ZH9B 2CV0A 2DWLA 5EQTA 1G41A 1FB1A 3IG5A 3HY5A 4PT5A 3GQ3A 1TDHA 1L2DA 1V92A 1TH2A 1V34A 2CRUA 3HJSA 4GEWA 1HT2E 4LF6M 1OFHA 1GTPA 1PJSA 3LVVA 4GH9A 2EKFA 5DNYA 4GHLA 1MX0A 2A5YB 3FUVA 2WSFK 3VEJA 2BJVA 1NY6A 2DWNA 2CUZA 1NJFA 3L2AA 3KW6A 1T43A 3UK6A 1NJGA 1Q3CA 1R2YA 4REZA 4WP2A 2Y20A 3U6QA 4A3VB 4YHHM 1G8PA 3EIEA 3F92A 2R44A 5EXSA 4KHPM 2RRUA 4IBDA 4FVGA 2RGOA 1P3QQ 1VEGA 1Z59A 4ANRA 2UU9M 2Y21A 4MGZE 1Y8GA 4FVJA 4OX9M 4AKHA 3LQRA 4DBGB 1N36M 3JR4A 2G8LA 2R4EA 4D82A 2ZTDA 2Y0TA 4DR1M 1IBLM 2BJWA 2MH8A 2JY5A 3AJIB 2ZTCA 2UXCM 1VDDA 4NE6B 1D0LA 4IBGA 3I51A 1DGGA 2D7GA 2YR0A 3SASA 1L1ZA 3SBJA 4BLCA 4P17A 4B7HA 4NXMM 4MGYE 2YQZA 3WHKA 3HZJA 2M5ZA 3LCUA 1A5TA 2Q2EB 2EJSA 1N3TA 2R65A 4I4LA 1OIZA 4M9XA 2CWBA 1IY2A 2CHVA 2YNMD 4L6V6 4LFBM 1IN8A 1DO2A 3U61B 2QENA 5ITXA 2L4EA 3NBIA 4ZPXA 3T6PA 4NRVA 1EL6A 2Z4SA 4QNRA 3SHFA 3A45A 3CF0A 1OAIA 1OIPA 2FS1A 2R18A 4IJEA 3GRYA 3CF2A 4L15A 2KA6B 4HEOA 1L2CA 3KOXE 4JI8M 4RF0A 3RGSA 1SXJD 4IBCA 1IXSB 1OQYA 3GRVA 1GJSA 3LCVB 4IBBA 4I81A 1IXSA 1SG9A 4NC6A 3DA1A 5C18A 5ITRA 2MGWA 4II7A 3C3DA 1DGFA 2L7IA 5BPVA 3KFUG 2JZ0A 4FCTA 1N77A 1HNWM 4E44B 3D7JA 4IBFA 4DU6A 4LJ4A 2WSFG 4NXNM 2JY7A 3HKPA 2LVQD 1RU3A 2HKJA 1L1TA 5LMUM 1LTMA 2OBAA 4MGHA 2KNAA 4JYAM 1WUQA 4IBEA 4WURA 3VK7A 1KYIA 7CATA 3HU3A 2KNVA 1R2ZA 2ZANA 1A8RA 1SXJE 1ZMVA 2KDLA 1FJGM 1UFZA 3KXEC 4MH0E 2EA0A 2Y0QA 5LMNM 1XWIA 2YFQA 4GHAA 3KOYE 4G3OA 4LGYA 4GKKM 1TF0B 5ITYA 5JI2E 3SMSA 3GPYA 1LV7A 4NTNA 1B66A 3QYEA 2KZSA 1IN7A 2PN0A 2LTUA 3AKZA 4JI7M 2LVAA 1R5LA 2Z8YM 1DO0A 1QAMA 1Z6TA 3VDUA 4DV3M 1WHCA 3FUUA 3GLHE 4AQYM 2B3TA 5L8RF 4KO8A 3KP0E 3JAMS 2HAKA 4DUZM 2A0SA 1YSYA 2QSFX 2JWSA 1W5SA 1HNZM 3M6AA 1QQWA 2CHQA 2JZ1A 3U6PA 5EXPA 2WSCF 3KP1E 3TE6A 3IHPA 1DGHB 1T6OA 4XK8F 4LZJA 1WR1B 2LH0A 4LF4M 3HX3A 4LJ5A 1IS7A 1DGHA 4B3SM 2F5SA 1IM2A 3B0BC 3U60B 1WJ7A 2MR9A 2V1CA 1ZMWA 2UXDM 4JXJA 4L78A 5EXTA 3A42A 3FUXA 3U60A 2CHGA 3W68A 4CIZA 4B3RM 2G5GX 2VIIA 3LQQA 1IN4A 2HHHM 2F5OA 2L6OA 2X8AA 3CTWB 2I7PA 3HU1A 2UUBM 3U6SA 2DAEA 4LG2A 4JA3A 4IIWA 4R7GA 3GQ5A 2KEBA 1QZEA 4CHTB 3HHZA 1GABA 2VDBB 2N35A 3T1YM 1TGUA 4QHSA 2O01G 1GL7A 4Y28F 1G4AE 2WZJA 1IBMM 1J09A 2C9CA 4L4UA 2DAMA 4DV7M 1CUKA 2QHOB 3U6EA 2UXBM 4DV6M 1SXJB 3SFZA 4XGIA 3SAUA 1SXJA 2LHGA 5FTJA 4M9ZA 1SXJC 3J7BA 1A9CA 4LZZA 1QUTA 1GKIA 4PDIA 3L27A 1YUBA 1NHWC 2C5RA 1WURA 2DAGA 3OTOM 2CV2A 1HQYE 4RF1A 1ZV1A 3R9XB 2J7OA 2F5QA 4FVFA 3H4MA 4NSRA 2FFJA 1GL6A 2CP8A 3E9SA 3LX3A 3KS8A 3KDSE 4BB9A 3LZEA 2QQ8A 4DR6M 1XB2B 4DV1M 3AL0C 3GLHB 2Z4RA 4G6ZA 1FBXA 1Q39A 2C98A 3LW5F 1ORYB 3GLHA 2CEAA 1JR3D 3HJ8A 1WGNA 2DHYA 2Z7JA 1TH4A 3FTCA 4RKUF 1XMOM 1ZQ9A 2BWBA 5FTNA 2V1UA 1IS8A 3B7QA 3CGWA 5DYIA 5ITTA 1Z5BA 3MHVC 4G4OA 3B7ZA 1WIVA 3L29A 2G3QA 1MU5A 4LFAM 3WHLA 1Q02A 3HJQA 4MGIE 1F4IA 2H1RA 1IXRC
chains in the Genus database with same CATH topology
4R8QA 4E44B 4DU6A 1E94E 2JY7A 1TTEA 2LVQD 1HJPA 2DENA 2EKKA 5DFLA 3FRIA 1MN3A 2KNAA 1WUQA 3BBZA 1KYIA 1A8RA 1JR3E 2KNVA 2MJ5B 1OTRA 1ZMVA 2OO9A 1ZMUA 3FRHA 2BWEA 1UFZA 2JUJA 2HWJA 2OOBA 3MMPA 4NE5B 2JP7A 2JY8A 4UN2B 1DV0A 4G3OA 3H4JA 1WPLA 5JI2E 1IFYA 3FE3A 2OOAA 1N3RA 1TR8A 1N3SA 2PN0A 2JY6B 2LTUA 2LVAA 1DO0A 2DNAA 1G41A 1FB1A 1WHCA 1EFUB 3GLHE 5DMZA 2B3TA 2L4FA 1V92A 3B89A 2HAKA 4GEWA 1WM9A 1HT2E 4Q7JA 1GTPA 1VEKA 2QSFX 3BMBA 2EKFA 1VDLA 2KHHA 3K9OA 2LBCA 4R71A 2LVNC 2JZ1A 3VEJA 4E45B 3K9PA 1T43A 3IHPA 4F1IA 1T6OA 4WP2A 1WR1B 1IS7A 3B0BC 1IM2A 1WJ7A 1R4GA 2MR9A 1ZMWA 3F92A 3GLFE 2DAIA 1YLAA 3GLIE 4DRBJ 2RRUA 1P3QQ 1VEGA 1Y8GA 2LVPC 1OKSA 2DKLA 4DBGB 2DAEA 2O25A 4JA3A 1VEJA 1VG5A 1QZEA 2P11A 1NV9A 2MROB 2DAKA 2KR1A 2ZTDA 3E46A 1HT1E 2JNHA 1G4AE 2JY5A 2LVOC 2WZJA 2ZTCA 4NE6B 2DAMA 1GO5A 1CUKA 2QHOB 2L2DA 3IECA 1WGLA 4NE3B 1VQ1A 1A9CA 1AIPC 3LCUA 1A5TA 1N3TA 2EJSA 1NV8A 2LNZA 1WURA 2DAGA 2CWBA 2R0IA 1HQYE 2DZLA 1ZV1A 1DO2A 4DRAE 4QPMA 2CP8A 1TFEA 2L4EA 3T6PA 1EL6A 1XB2B 2LO0A 1FBXA 1OAIA 2QNJA 4HEOA 1BVSA 1XXHE 4F2LA 1WGNA 2DHYA 1OQYA 3E21A 1IS8A 2BWBA 3LCVB 2KNZA 1IXSA 2K9DA 2DI0A 1SG9A 1G3IA 3GLGE 1PGYA 1C7YA 1WIVA 2G3QA 2MGWA 2H5XA 1Q02A 2JZ0A 1F4IA 2K0BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E94 E;  2JY7 A;  1TTE A;  2LVQ D;  1HJP A;  2DEN A;  2EKK A;  5DFL A;  3FRI A;  1MN3 A;  2KNA A;  3BBZ A;  1KYI A;  1JR3 E;  2KNV A;  2MJ5 B;  1OTR A;  1ZMV A;  2OO9 A;  1ZMU A;  3FRH A;  2BWE A;  1UFZ A;  2JUJ A;  2HWJ A;  2OOB A;  3MMP A;  2JP7 A;  2JY8 A;  4UN2 B;  1DV0 A;  4G3O A;  3H4J A;  5JI2 E;  1IFY A;  3FE3 A;  2OOA A;  1TR8 A;  2PN0 A;  2JY6 B;  2LTU A;  2LVA A;  1DO0 A;  2DNA A;  1G41 A;  1WHC A;  1EFU B;  3GLH E;  2B3T A;  2L4F A;  1V92 A;  3B89 A;  2HAK A;  4GEW A;  1HT2 E;  4Q7J A;  1VEK A;  2QSF X;  3BMB A;  2EKF A;  1VDL A;  2KHH A;  3K9O A;  2LBC A;  4R71 A;  2LVN C;  2JZ1 A;  3K9P A;  1T43 A;  3IHP A;  4F1I A;  1T6O A;  4WP2 A;  1WR1 B;  1IM2 A;  1WJ7 A;  1R4G A;  2MR9 A;  1ZMW A;  3F92 A;  3GLF E;  2DAI A;  1YLA A;  3GLI E;  2RRU A;  1P3Q Q;  1VEG A;  1Y8G A;  2LVP C;  1OKS A;  2DKL A;  4DBG B;  2DAE A;  2O25 A;  1VEJ A;  1VG5 A;  1QZE A;  1NV9 A;  2MRO B;  2DAK A;  2ZTD A;  3E46 A;  1HT1 E;  2JNH A;  1G4A E;  2JY5 A;  2LVO C;  2WZJ A;  2ZTC A;  2DAM A;  1GO5 A;  1CUK A;  2QHO B;  2L2D A;  3IEC A;  1WGL A;  1VQ1 A;  1AIP C;  3LCU A;  1A5T A;  2EJS A;  1NV8 A;  2DAG A;  2CWB A;  2R0I A;  1HQY E;  2DZL A;  1ZV1 A;  1DO2 A;  2CP8 A;  1TFE A;  2L4E A;  3T6P A;  1XB2 B;  1OAI A;  2QNJ A;  4HEO A;  1BVS A;  1XXH E;  4F2L A;  1WGN A;  2DHY A;  1OQY A;  3E21 A;  2BWB A;  3LCV B;  2KNZ A;  1IXS A;  2K9D A;  2DI0 A;  1SG9 A;  1G3I A;  3GLG E;  1PGY A;  1C7Y A;  1WIV A;  2G3Q A;  2MGW A;  2H5X A;  1Q02 A;  2JZ0 A;  1F4I A;  2K0B X; 
#chains in the Genus database with same CATH topology
 5FLX S;  5H37 D;  4R8Q A;  2C99 A;  3T15 A;  3U6C A;  1E94 E;  3J7A S;  2L7H A;  1D2N A;  2CV1 A;  3FUT A;  3FRI A;  4M0D A;  4D80 A;  3U61 A;  3I01 M;  1IN5 A;  3GP1 A;  3Q8G A;  5FTM A;  4FWH A;  2WSE K;  2C96 A;  3I4V A;  1JR3 E;  4LRT A;  3HHY A;  3UGJ A;  1V33 A;  2OO9 A;  4TUW A;  2G64 A;  4EIW A;  1E9S A;  2JUJ A;  2XFS A;  1IY0 A;  3KOZ E;  1XNR M;  2R4J A;  2QZ4 A;  3MMP A;  1D0M A;  2OPF A;  4NE5 B;  3AOE A;  3LMM A;  2JY8 A;  1DV0 A;  2WSC K;  1R7R A;  3SYK A;  3AOE C;  2XF3 A;  3FE3 A;  2ZBK B;  3I04 M;  4OVZ B;  2OOA A;  3TWK A;  4DR5 M;  3T1H M;  3C58 A;  3GQ4 A;  1N3R A;  1FNN A;  1PJQ A;  2XEP A;  2DWZ B;  4OVZ A;  3RE8 A;  3UMM A;  3VLF B;  3UJN A;  1E9R A;  1G71 A;  2ERC A;  4JN6 A;  3C9P A;  2DNA A;  5EP2 A;  1QYR A;  4JI0 M;  1N33 M;  5DMZ A;  1TDZ A;  4LRS A;  1K82 A;  3TL4 X;  2DZN B;  3DZD A;  1Z5A A;  4KOD A;  4Q7J A;  4FW9 A;  4QNM A;  1KSF X;  1VEK A;  2CFO A;  4JI3 M;  4KLN A;  1VDL A;  3K9O A;  4RNA A;  4R71 A;  2LVN C;  1XC8 A;  3KSJ A;  1IBK M;  1NNJ A;  3K9P A;  4AKG A;  3BOS A;  3L28 A;  4IBJ A;  1B6Z A;  3T38 A;  4L16 A;  3AOG A;  3FKE A;  3ILK A;  4PD2 A;  4G4Q A;  2XSZ D;  5DYG A;  1R4G A;  1GJT A;  4DRB J;  2DZO B;  3GLF E;  2DAI A;  3M7G A;  4CJ6 A;  2ZAO A;  3MK6 A;  4NOO B;  4X66 M;  2DXI A;  3QN0 A;  2EUC A;  3KSX A;  1NVM A;  3CF6 E;  1WIN A;  2ZM6 M;  1W5T A;  1DGB A;  4OU7 A;  2VF8 A;  4LF7 M;  3J27 B;  2F4V M;  2MRO B;  3DFZ A;  4LJA A;  2KR1 A;  1QDT A;  3HWS A;  3E46 A;  1XMQ M;  3B74 A;  3THG A;  1QAQ A;  2XH9 A;  5ITU A;  2L2D A;  2DTT A;  1WGL A;  4S12 A;  5FSW A;  2XLJ A;  1NO1 A;  2XFT A;  3LW5 K;  2UUA M;  5GKN A;  3R8F A;  4NE3 B;  1JR3 A;  4FCV A;  2F5P A;  1NSF A;  4MB7 A;  3TQS A;  3GPX A;  1N78 A;  2WSE G;  4B3M M;  2I7N A;  2QP9 X;  3J2P B;  1XHB A;  1AUA A;  1NV8 A;  3PFI A;  4DR4 M;  3RGP A;  1QAO A;  3GPU A;  2R0I A;  4LFC M;  4QOS A;  2DZL A;  4ITQ A;  4B08 A;  4QPM A;  5IWA M;  1IQP A;  2X49 A;  1QUS A;  3Q8X A;  4AG5 A;  3SAR A;  4GIP A;  1TFE A;  2RPB A;  2AHM A;  2WSC G;  2DVW B;  2LHC A;  1IXZ A;  3QN9 A;  2LO0 A;  3LVW A;  3TPZ A;  1X37 A;  3QNA A;  5BR8 M;  4GIT A;  5KPT A;  1XXH E;  2RKO A;  3E21 A;  2VQE M;  1GVN A;  2FNA A;  2DHR A;  1HQC A;  3BXW A;  2KNZ A;  3J81 S;  1IY1 A;  3FYD A;  2DI0 A;  3U6D A;  1G3I A;  3AFH A;  4BBA A;  3GLG E;  4JI5 M;  1C7Y A;  2D7H A;  3A98 B;  3QYB A;  4P16 A;  8CAT A;  3KOW E;  4IJF A;  3H4J A;  3U6L A;  2DJ6 A;  2APL A;  2XZF A;  3BK6 A;  1I94 M;  1YE9 A;  2FH0 A;  5EXX A;  3PXG A;  3GLF B;  3L25 A;  2GNO A;  1HJP A;  2LNH C;  2EKK A;  4LGM A;  3GLF A;  2VQF M;  4YY3 M;  4NTM A;  3HHW A;  1MN3 A;  4GC9 A;  2KRK A;  4DV2 M;  3J80 S;  4JI2 M;  2JA2 A;  2RGH A;  3QWL A;  4DV0 M;  2MJ5 B;  2R62 A;  1ZMU A;  1GTQ A;  1OAO C;  2BWE A;  2J7N A;  4XBO A;  2QPA A;  4QHT A;  4WW0 A;  3W67 A;  5A2Q S;  3GO8 A;  2HWJ A;  4FWG A;  1K3X A;  1QDR A;  2OOB A;  5EP1 A;  2M60 A;  2JP7 A;  3TWM A;  3M0E A;  4LF9 M;  1NY5 A;  3FD9 A;  1IFY A;  1GLN A;  3DOA A;  3U6O A;  1K3W A;  3SAT A;  2K47 A;  3NBX X;  3K92 A;  2XSZ A;  4I8O A;  2D7E A;  3FTF A;  1IN6 A;  4NTK A;  3VDP A;  1EIJ A;  5F3W A;  1N3S A;  3SHG B;  3KVW A;  4LY6 A;  4JI6 M;  3LW5 G;  1OJL A;  3W0L B;  2R46 A;  4DV5 M;  3K2L A;  4Z8X A;  4PCZ A;  5FTL A;  1EFU B;  1NHG C;  2KW0 A;  3TWL A;  3HHX A;  2O5R A;  4LJ9 A;  2L4F A;  5KPR A;  3B89 A;  2HCB A;  1WM9 A;  3FUW A;  2R6F A;  4GC5 A;  4AI6 A;  5KQD A;  2DWM A;  3BMB A;  2HL7 A;  3SYL A;  3W0F A;  2KHH A;  2LBC A;  1Q3B A;  4E45 B;  1PJI A;  4KT0 F;  3NWL A;  4F1I A;  2GQF A;  3VKG A;  3I4Y A;  1XXH B;  4NRW A;  4M9S A;  2X4A A;  1Z5C A;  1PM5 A;  1XXH A;  3AV0 A;  2BNK A;  3GLI E;  4G4R A;  1J7K A;  1YLA A;  3GLG B;  1L8Q A;  4FD2 A;  4GKJ M;  4X65 M;  3GLG A;  4R3D A;  3GRR A;  5IRE B;  1NNU C;  5KQ8 A;  4G4N A;  2LVP C;  1OKS A;  2DKL A;  2R45 A;  3L26 A;  2O25 A;  5ITQ A;  3A46 A;  4DV4 M;  1HNX M;  3V76 A;  3SAW A;  3RFW A;  1VEJ A;  1PRB A;  1VG5 A;  3C3E A;  3FTD A;  3PVS A;  5KPZ A;  1NV9 A;  4X64 M;  1UM8 A;  2P11 A;  2DAK A;  1QVR A;  2L09 A;  3K1J A;  5JI3 E;  4JV5 M;  2ZAM A;  1HT1 E;  1OFI A;  2JNH A;  2WSF F;  4FVM A;  2LVO C;  3JYG A;  3ZCB B;  2Z3X A;  1GO5 A;  1MJG M;  1QAN A;  3IEC A;  4B3T M;  1N75 A;  1I4W A;  2VF7 A;  1N32 M;  1EE8 A;  5IZ7 D;  4LF5 M;  2XZU A;  4I5S A;  4DUY M;  3SC3 A;  3U5Z B;  1VQ1 A;  2J5Y A;  1C1K A;  1AIP C;  4OW0 A;  4D81 A;  3K8Z A;  4AZF A;  3ZQJ A;  4B7G A;  3U5Z A;  2QCU A;  2KXE A;  4MM3 B;  5C1B A;  2LNZ A;  3HGI A;  1JQJ C;  5EP3 A;  4Z6Y A;  2QBY B;  1JB0 F;  4DRA E;  3UZU A;  3QAU A;  1D0K A;  3PNV A;  2QBY A;  4NSO B;  2P5T A;  4CGY B;  1L2B A;  4JI4 M;  1G59 A;  3SMP A;  4X62 M;  2CE7 A;  2JXN A;  5IT9 S;  3M0N A;  1HR0 M;  3IG8 A;  4HL4 A;  2QNJ A;  1TH3 A;  3GRU A;  1N34 M;  1BVS A;  4PDG A;  1R6B X;  2EO2 A;  3FYC A;  4F2L A;  5EP4 A;  4DR7 M;  1Y13 A;  3KS4 A;  3SAV A;  3EIH A;  2KZU A;  2K9D A;  2XGN A;  4W5W A;  4B7F A;  4DR3 M;  3HU2 A;  1H6U A;  1PGY A;  1WXQ A;  2NQ8 C;  4IBK A;  3I2B A;  2W82 A;  5E26 A;  2H5X A;  5FTK A;  3U6M A;  4DR2 M;  4L8R C;  1QZM A;  1J5E M;  3FTE A;  2K0B X;  2LXE A;  3B7N A;  4AKI A;  4IBI A;  4M0W A;  3E4R A;  4MGK E;  4GRI A;  2LWX A;  4LJ7 A;  4FCW A;  3GPP A;  3GLI B;  1PJJ A;  1TTE A;  3VFD A;  3GLI A;  2WSE F;  3PNY A;  4CIS A;  2DEN A;  5DFL A;  3MJ5 A;  2KRU A;  3B9P A;  4LJ6 A;  4QOZ C;  3VKH A;  3VK8 A;  3BBZ A;  2V6Z M;  1KFV A;  2FE8 A;  4LF8 M;  4AG6 A;  2FOI C;  5EJC A;  1OTR A;  1ZAE A;  4GMQ A;  3FRH A;  5KO3 A;  4K0K M;  3ZC7 B;  4LCB A;  4JI1 M;  4LJ8 A;  2UUC M;  2OQ4 A;  2O01 F;  1T3T A;  2E5L M;  4UN2 B;  2F5N A;  4FWD A;  5E6J A;  1WPL A;  1E32 A;  4HLQ A;  1S3S A;  3D8L A;  5ITX E;  1TR8 A;  3D8B A;  2K6B A;  4AW4 A;  1XNQ M;  2JY6 B;  1PJT A;  2C9O A;  4NL4 H;  3JR5 A;  3ZH9 B;  2CV0 A;  2DWL A;  5EQT A;  1G41 A;  1FB1 A;  3IG5 A;  3HY5 A;  4PT5 A;  3GQ3 A;  1TDH A;  1L2D A;  1V92 A;  1TH2 A;  1V34 A;  2CRU A;  3HJS A;  4GEW A;  1HT2 E;  4LF6 M;  1OFH A;  1GTP A;  1PJS A;  3LVV A;  4GH9 A;  2EKF A;  5DNY A;  4GHL A;  1MX0 A;  2A5Y B;  3FUV A;  2WSF K;  3VEJ A;  2BJV A;  1NY6 A;  2DWN A;  2CUZ A;  1NJF A;  3L2A A;  3KW6 A;  1T43 A;  3UK6 A;  1NJG A;  1Q3C A;  1R2Y A;  4REZ A;  4WP2 A;  2Y20 A;  3U6Q A;  4A3V B;  4YHH M;  1G8P A;  3EIE A;  3F92 A;  2R44 A;  5EXS A;  4KHP M;  2RRU A;  4IBD A;  4FVG A;  2RGO A;  1P3Q Q;  1VEG A;  1Z59 A;  4ANR A;  2UU9 M;  2Y21 A;  4MGZ E;  1Y8G A;  4FVJ A;  4OX9 M;  4AKH A;  3LQR A;  4DBG B;  1N36 M;  3JR4 A;  2G8L A;  2R4E A;  4D82 A;  2ZTD A;  2Y0T A;  4DR1 M;  1IBL M;  2BJW A;  2MH8 A;  2JY5 A;  3AJI B;  2ZTC A;  2UXC M;  1VDD A;  4NE6 B;  1D0L A;  4IBG A;  3I51 A;  1DGG A;  2D7G A;  2YR0 A;  3SAS A;  1L1Z A;  3SBJ A;  4BLC A;  4P17 A;  4B7H A;  4NXM M;  4MGY E;  2YQZ A;  3WHK A;  3HZJ A;  2M5Z A;  3LCU A;  1A5T A;  2Q2E B;  2EJS A;  1N3T A;  2R65 A;  4I4L A;  1OIZ A;  4M9X A;  2CWB A;  1IY2 A;  2CHV A;  2YNM D;  4L6V 6;  4LFB M;  1IN8 A;  1DO2 A;  3U61 B;  2QEN A;  5ITX A;  2L4E A;  3NBI A;  4ZPX A;  3T6P A;  4NRV A;  1EL6 A;  2Z4S A;  4QNR A;  3SHF A;  3A45 A;  3CF0 A;  1OAI A;  1OIP A;  2FS1 A;  2R18 A;  4IJE A;  3GRY A;  3CF2 A;  4L15 A;  2KA6 B;  4HEO A;  1L2C A;  3KOX E;  4JI8 M;  4RF0 A;  3RGS A;  1SXJ D;  4IBC A;  1IXS B;  1OQY A;  3GRV A;  1GJS A;  3LCV B;  4IBB A;  4I81 A;  1IXS A;  1SG9 A;  4NC6 A;  3DA1 A;  5C18 A;  5ITR A;  2MGW A;  4II7 A;  3C3D A;  1DGF A;  2L7I A;  5BPV A;  3KFU G;  2JZ0 A;  4FCT A;  1N77 A;  1HNW M;  4E44 B;  3D7J A;  4IBF A;  4DU6 A;  4LJ4 A;  2WSF G;  4NXN M;  2JY7 A;  3HKP A;  2LVQ D;  1RU3 A;  2HKJ A;  1L1T A;  5LMU M;  1LTM A;  2OBA A;  4MGH A;  2KNA A;  4JYA M;  1WUQ A;  4IBE A;  4WUR A;  3VK7 A;  1KYI A;  7CAT A;  3HU3 A;  2KNV A;  1R2Z A;  2ZAN A;  1A8R A;  1SXJ E;  1ZMV A;  2KDL A;  1FJG M;  1UFZ A;  3KXE C;  4MH0 E;  2EA0 A;  2Y0Q A;  5LMN M;  1XWI A;  2YFQ A;  4GHA A;  3KOY E;  4G3O A;  4LGY A;  4GKK M;  1TF0 B;  5ITY A;  5JI2 E;  3SMS A;  3GPY A;  1LV7 A;  4NTN A;  1B66 A;  3QYE A;  2KZS A;  1IN7 A;  2PN0 A;  2LTU A;  3AKZ A;  4JI7 M;  2LVA A;  1R5L A;  2Z8Y M;  1DO0 A;  1QAM A;  1Z6T A;  3VDU A;  4DV3 M;  1WHC A;  3FUU A;  3GLH E;  4AQY M;  2B3T A;  5L8R F;  4KO8 A;  3KP0 E;  3JAM S;  2HAK A;  4DUZ M;  2A0S A;  1YSY A;  2QSF X;  2JWS A;  1W5S A;  1HNZ M;  3M6A A;  1QQW A;  2CHQ A;  2JZ1 A;  3U6P A;  5EXP A;  2WSC F;  3KP1 E;  3TE6 A;  3IHP A;  1DGH B;  1T6O A;  4XK8 F;  4LZJ A;  1WR1 B;  2LH0 A;  4LF4 M;  3HX3 A;  4LJ5 A;  1IS7 A;  1DGH A;  4B3S M;  2F5S A;  1IM2 A;  3B0B C;  3U60 B;  1WJ7 A;  2MR9 A;  2V1C A;  1ZMW A;  2UXD M;  4JXJ A;  4L78 A;  5EXT A;  3A42 A;  3FUX A;  3U60 A;  2CHG A;  3W68 A;  4CIZ A;  4B3R M;  2G5G X;  2VII A;  3LQQ A;  1IN4 A;  2HHH M;  2F5O A;  2L6O A;  2X8A A;  3CTW B;  2I7P A;  3HU1 A;  2UUB M;  3U6S A;  2DAE A;  4LG2 A;  4JA3 A;  4IIW A;  4R7G A;  3GQ5 A;  2KEB A;  1QZE A;  4CHT B;  3HHZ A;  1GAB A;  2VDB B;  2N35 A;  3T1Y M;  1TGU A;  4QHS A;  2O01 G;  1GL7 A;  4Y28 F;  1G4A E;  2WZJ A;  1IBM M;  1J09 A;  2C9C A;  4L4U A;  2DAM A;  4DV7 M;  1CUK A;  2QHO B;  3U6E A;  2UXB M;  4DV6 M;  1SXJ B;  3SFZ A;  4XGI A;  3SAU A;  1SXJ A;  2LHG A;  5FTJ A;  4M9Z A;  1SXJ C;  3J7B A;  1A9C A;  4LZZ A;  1QUT A;  1GKI A;  4PDI A;  3L27 A;  1YUB A;  1NHW C;  2C5R A;  1WUR A;  2DAG A;  3OTO M;  2CV2 A;  1HQY E;  4RF1 A;  1ZV1 A;  3R9X B;  2J7O A;  2F5Q A;  4FVF A;  3H4M A;  4NSR A;  2FFJ A;  1GL6 A;  2CP8 A;  3E9S A;  3LX3 A;  3KS8 A;  3KDS E;  4BB9 A;  3LZE A;  2QQ8 A;  4DR6 M;  1XB2 B;  4DV1 M;  3AL0 C;  3GLH B;  2Z4R A;  4G6Z A;  1FBX A;  1Q39 A;  2C98 A;  3LW5 F;  1ORY B;  3GLH A;  2CEA A;  1JR3 D;  3HJ8 A;  1WGN A;  2DHY A;  2Z7J A;  1TH4 A;  3FTC A;  4RKU F;  1XMO M;  1ZQ9 A;  2BWB A;  5FTN A;  2V1U A;  1IS8 A;  3B7Q A;  3CGW A;  5DYI A;  5ITT A;  1Z5B A;  3MHV C;  4G4O A;  3B7Z A;  1WIV A;  3L29 A;  2G3Q A;  1MU5 A;  4LFA M;  3WHL A;  1Q02 A;  3HJQ A;  4MGI E;  1F4I A;  2H1R A;  1IXR C; 
#chains in the Genus database with same CATH homology
 4R8Q A;  4E44 B;  4DU6 A;  1E94 E;  2JY7 A;  1TTE A;  2LVQ D;  1HJP A;  2DEN A;  2EKK A;  5DFL A;  3FRI A;  1MN3 A;  2KNA A;  1WUQ A;  3BBZ A;  1KYI A;  1A8R A;  1JR3 E;  2KNV A;  2MJ5 B;  1OTR A;  1ZMV A;  2OO9 A;  1ZMU A;  3FRH A;  2BWE A;  1UFZ A;  2JUJ A;  2HWJ A;  2OOB A;  3MMP A;  4NE5 B;  2JP7 A;  2JY8 A;  4UN2 B;  1DV0 A;  4G3O A;  3H4J A;  1WPL A;  5JI2 E;  1IFY A;  3FE3 A;  2OOA A;  1N3R A;  1TR8 A;  1N3S A;  2PN0 A;  2JY6 B;  2LTU A;  2LVA A;  1DO0 A;  2DNA A;  1G41 A;  1FB1 A;  1WHC A;  1EFU B;  3GLH E;  5DMZ A;  2B3T A;  2L4F A;  1V92 A;  3B89 A;  2HAK A;  4GEW A;  1WM9 A;  1HT2 E;  4Q7J A;  1GTP A;  1VEK A;  2QSF X;  3BMB A;  2EKF A;  1VDL A;  2KHH A;  3K9O A;  2LBC A;  4R71 A;  2LVN C;  2JZ1 A;  3VEJ A;  4E45 B;  3K9P A;  1T43 A;  3IHP A;  4F1I A;  1T6O A;  4WP2 A;  1WR1 B;  1IS7 A;  3B0B C;  1IM2 A;  1WJ7 A;  1R4G A;  2MR9 A;  1ZMW A;  3F92 A;  3GLF E;  2DAI A;  1YLA A;  3GLI E;  4DRB J;  2RRU A;  1P3Q Q;  1VEG A;  1Y8G A;  2LVP C;  1OKS A;  2DKL A;  4DBG B;  2DAE A;  2O25 A;  4JA3 A;  1VEJ A;  1VG5 A;  1QZE A;  2P11 A;  1NV9 A;  2MRO B;  2DAK A;  2KR1 A;  2ZTD A;  3E46 A;  1HT1 E;  2JNH A;  1G4A E;  2JY5 A;  2LVO C;  2WZJ A;  2ZTC A;  4NE6 B;  2DAM A;  1GO5 A;  1CUK A;  2QHO B;  2L2D A;  3IEC A;  1WGL A;  4NE3 B;  1VQ1 A;  1A9C A;  1AIP C;  3LCU A;  1A5T A;  1N3T A;  2EJS A;  1NV8 A;  2LNZ A;  1WUR A;  2DAG A;  2CWB A;  2R0I A;  1HQY E;  2DZL A;  1ZV1 A;  1DO2 A;  4DRA E;  4QPM A;  2CP8 A;  1TFE A;  2L4E A;  3T6P A;  1EL6 A;  1XB2 B;  2LO0 A;  1FBX A;  1OAI A;  2QNJ A;  4HEO A;  1BVS A;  1XXH E;  4F2L A;  1WGN A;  2DHY A;  1OQY A;  3E21 A;  1IS8 A;  2BWB A;  3LCV B;  2KNZ A;  1IXS A;  2K9D A;  2DI0 A;  1SG9 A;  1G3I A;  3GLG E;  1PGY A;  1C7Y A;  1WIV A;  2G3Q A;  2MGW A;  2H5X A;  1Q02 A;  2JZ0 A;  1F4I A;  2K0B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...