4Q7JA

Complex structure of viral rna polymerase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
b'TASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Ts
publication title Molecular insights into replication initiation by Q beta replicase using ribosomal protein S1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation/transferase
total genus 78
structure length 278
sequence length 278
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4q7jA01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4q7jA04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA03
2LVPC 3IECA 2K9DA 4G3OA 2L4EA 2DZLA 1DV0A 1P3QQ 3T6PA 3K9OA 1KYIA 4F1IA 1IM2A 2WZJA 1EFUB 1T6OA 2BWBA 2DENA 1OQYA 2JZ0A 3F92A 5DFLA 1SG9A 2L2DA 3B89A 2CWBA 3FE3A 3FRIA 3GLHE 1XB2B 2PN0A 2LBCA 2DAIA 1DO0A 2JY7A 1VEJA 3IHPA 2EJSA 1HT1E 1ZMUA 3E21A 1VEKA 1TR8A 2RRUA 3BBZA 2LTUA 3K9PA 1TFEA 2MR9A 3MMPA 2EKKA 3GLFE 4Q7JA 2OO9A 1TTEA 2LVOC 2DNAA 2JZ1A 1AIPC 2OOBA 2LVQD 2LVNC 2R0IA 2KNAA 4R71A 3H4JA 2DAEA 1XXHE 4F2LA 1DO2A 2HWJA 4GEWA 2K0BX 4UN2B 1NV8A 5JI2E 1OKSA 2G3QA 1OTRA 3LCUA 1HQYE 2MGWA 2LVAA 1HT2E 2CP8A 1CUKA 2H5XA 1UFZA 1WR1B 1WGNA 4WP2A 1F4IA 1V92A 3FRHA 1QZEA 1IFYA 2JY8A 1WHCA 1G4AE 2DKLA 1G3IA 1E94E 2KHHA 3E46A 2MJ5B 3LCVB 2JUJA 2MROB 1OAIA 1VDLA 1ZMVA 1VQ1A 2EKFA 1WIVA 2QNJA 2DI0A 1C7YA 1ZV1A 1MN3A 1WJ7A 1WGLA 2JY6B 3GLGE 2QSFX 1Y8GA 2ZTCA 2BWEA 1PGYA 1VG5A 1GO5A 2HAKA 1IXSA 2DAKA 2JNHA 4HEOA 2JP7A 2QHOB 1YLAA 2KNZA 4DBGB 1BVSA 1Q02A 3BMBA 2B3TA 1NV9A 1A5TA 1R4GA 2DHYA 2DAGA 1JR3E 1T43A 3GLIE 2OOAA 2JY5A 2O25A 1ZMWA 2KNVA 2L4FA 2ZTDA 1HJPA 2DAMA 1G41A 1VEGA
chains in the Genus database with same CATH superfamily
2BJWA 2LVPC 2QQ8A 2CRUA 2L4EA 3VK7A 2WSEG 2L09A 4G4RA 1EL6A 5EP4A 2FH0A 3HU2A 2DZLA 3E4RA 1HNWM 3U6DA 2WSFG 1P3QQ 5EP1A 1PJSA 1R2ZA 1IM2A 3AOGA 4JXJA 3VFDA 4AG5A 4JYAM 4LZZA 5A2QS 1T6OA 2QPAA 4B3MM 2LHGA 2OBAA 1OQYA 2WSCK 3FTFA 3F92A 3LW5F 3HJQA 2L2DA 4OU7A 4DV6M 3PVSA 3SAVA 3J7BA 3HU1A 4KHPM 3L29A 1HQCA 2XLJA 5EJCA 3ZQJA 1L1TA 3GLHE 2R4JA 2P11A 3M6AA 2CV1A 3K8ZA 3Q8XA 4AW4A 2JY7A 3IHPA 3VLFB 4YHHM 3QNAA 5FTNA 3FD9A 2XZUA 2RKOA 1WINA 5FTJA 1IY1A 1TR8A 1JQJC 2RRUA 4MGZE 2ZM6M 3KFUG 1IN5A 1TFEA 3B0BC 3J7AS 3MMPA 4BLCA 2UU9M 2M5ZA 4NXNM 4D80A 4DR4M 1X37A 4B7HA 4B3SM 1NY6A 3PNYA 1JR3D 2EUCA 2OOBA 3D8LA 4L16A 3TWMA 2CHQA 5DNYA 4RF1A 2R0IA 3B7NA 3FUTA 5FSWA 1IXSB 4NRVA 2V6ZM 3T38A 3H4JA 1GTQA 2DWMA 4II7A 3HWSA 3SHFA 3KS8A 4CJ6A 1FB1A 1XXHE 2VIIA 4F2LA 4MGKE 2DZOB 1XMQM 2OPFA 2F5SA 3CF0A 1NV8A 4ITQA 2VQFM 3U60A 2F5OA 2G3QA 3IG5A 2O5RA 3SHGB 3W67A 1OTRA 2HHHM 1XNRM 1WM9A 3GQ4A 2LVAA 2LWXA 4PD2A 4DR3M 3GPXA 4DUYM 3W68A 3FYDA 2H5XA 4AKHA 1YSYA 1DGGA 1WGNA 3FUXA 4LF6M 3HGIA 4DV3M 4M0WA 1ZAEA 3FRHA 2O01F 3FYCA 1NNUC 2Y21A 4NRWA 3RGPA 4GC9A 3EIEA 3KXEC 1WHCA 3LW5K 2CFOA 2VF7A 3A98B 4LCBA 2WSCG 2KRUA 4LJ9A 1RU3A 2QBYA 4LJAA 2XF3A 5DYIA 3E46A 1NHGC 1UM8A 2YQZA 2CV0A 2L6OA 4DV2M 1TH3A 4GRIA 3QYBA 4CIZA 4PCZA 2EKFA 4IBCA 3LQQA 2HL7A 1C7YA 1XNQM 3KSXA 1D0MA 2R18A 1A8RA 1WJ7A 1WGLA 3GLGE 2K47A 4DU6A 1Y8GA 2ZTCA 1L2DA 3SMPA 1OJLA 8CATA 4E45B 3HZJA 3JR4A 3C9PA 4JI1M 4JI5M 1MX0A 2L7HA 3HHXA 1HNZM 1GO5A 3U6EA 4HEOA 1Z5BA 5C1BA 4XGIA 4DUZM 4IJEA 3AL0C 1V33A 2DWZB 2KNZA 2JWSA 2XZFA 1BVSA 4LZJA 1Q02A 4LJ8A 3E9SA 3VKHA 3U6MA 2I7PA 5BR8M 2DHYA 2CV2A 1H6UA 4B3TM 1LV7A 1S3SA 2HKJA 3SFZA 4I5SA 3KVWA 2DAGA 1T43A 5KPTA 5FLXS 3U6LA 4AG6A 3M0EA 3MJ5A 1N77A 4GH9A 1OIZA 1ZQ9A 4DV4M 3KSJA 3T1HM 4LF5M 2H1RA 1R5LA 2D7HA 2FNAA 1V34A 1HJPA 2ZTDA 3I01M 4Y28F 5EXTA 4YY3M 1DGFA 2P5TA 4BB9A 4X65M 3I4VA 3DFZA 3W0LB 4B7GA 4IBEA 4TUWA 1G8PA 2K9DA 4EIWA 2VQEM 1N32M 2VDBB 2VF8A 3ZH9B 3VEJA 1IS8A 1XC8A 2R46A 3U60B 4XK8F 4LRTA 4P17A 4M0DA 5ITRA 1KYIA 1QZMA 2C99A 1EFUB 2J7OA 4DV5M 4GITA 4LRSA 3U6SA 3U5ZA 4L8RC 3LW5G 2JZ0A 4AKIA 2Q2EB 1R6BX 3KS4A 3D7JA 2X49A 3J81S 1SG9A 1TH4A 1HNXM 3WHKA 1N3RA 3A45A 3FE3A 3L2AA 4E44B 4DR2M 2JA2A 3D8BA 4FCWA 4QOSA 3U6OA 2QBYB 3C58A 2LBCA 4DRBJ 2W82A 4IBFA 4PDIA 1VEJA 3CF6E 2EJSA 1WPLA 1OFHA 4A3VB 1HT1E 1L8QA 2C98A 3BBZA 1FBXA 1NY5A 2YR0A 3KOXE 3GLFE 1IN8A 2A0SA 2J7NA 2QCUA 4NE5B 3HY5A 3U61A 2JZ1A 1YUBA 2KA6B 1Q3CA 3FTCA 5IZ7D 4I8OA 2KRKA 4FVFA 4X66M 2Y0QA 4MGIE 5ITUA 2X8AA 2F4VM 4NE6B 4AKGA 2K0BX 4IIWA 4DRAE 3PXGA 4MH0E 1B6ZA 4UN2B 3JAMS 4CHTB 5JI2E 2CUZA 1OKSA 3I04M 2F5PA 5GKNA 3T15A 3MK6A 4LF9M 1TGUA 4HLQA 5DYGA 4DV1M 1CUKA 2A5YB 2RGOA 4IBIA 5ITQA 2JXNA 2DVWB 2O01G 3GPPA 1K3XA 2Z3XA 4GHAA 2UXDM 3R9XB 3GLHA 2RPBA 1IFYA 1W5SA 2DXIA 2OQ4A 1TDZA 4KO8A 2JUJA 4X62M 4IBBA 3U5ZB 1OAIA 1VDLA 4G6ZA 3ZCBB 3AOEC 1VQ1A 5KPRA 1WIVA 2FOIC 4G4NA 2QNJA 4REZA 2DI0A 1B66A 5BPVA 3K2LA 3HU3A 4I4LA 2JY6B 2BNKA 4NSOB 4QNRA 3ILKA 2QSFX 4NE3B 3AV0A 3H4MA 1A9CA 2KR1A 1D0KA 1XXHA 2DAKA 2JNHA 2D7EA 4LY6A 5KQDA 3AKZA 2QHOB 3IG8A 1YLAA 3FTEA 4JI7M 2FFJA 2XFSA 3BMBA 4DR6M 3WHLA 5ITTA 2X4AA 1NV9A 1A5TA 1R4GA 2G64A 1GL7A 3PFIA 3GLIE 1JR3E 3UZUA 3HJSA 2GNOA 3SAWA 1ZMWA 2LH0A 3GRVA 2I7NA 4XBOA 2APLA 4FVJA 4ZPXA 3SBJA 2CHGA 1VEGA 4AQYM 1GL6A 3IECA 4QHSA 2QENA 2LO0A 4QNMA 5IT9S 4LF4M 4LG2A 2ZBKB 5EXXA 3VDPA 3GLIA 1JR3A 1DV0A 3KOZE 1OFIA 3K9OA 4F1IA 1Z6TA 4P16A 4OVZA 4JI3M 2R45A 5KO3A 3AOEA 2Z8YM 3VKGA 4M9XA 1R7RA 5JI3E 1W5TA 3TE6A 3QWLA 4BBAA 3KDSE 4LFBM 5DFLA 3GLGA 2R6FA 1Y13A 2DZNB 4DV7M 3GLHB 4MM3B 1WUQA 1TH2A 3GPYA 4IBGA 2GQFA 3FRIA 2C9CA 4L15A 4NSRA 2HCBA 3HKPA 4GMQA 4RF0A 3TWKA 3SARA 1DGBA 2DAIA 4KT0F 4X64M 1DO0A 3TPZA 2G8LA 1N3SA 5EQTA 4QPMA 2WSEK 3E21A 1QUTA 4FCVA 3CTWB 3I4YA 3UJNA 1EIJA 2LTUA 2WSFK 1PRBA 3K9PA 3RE8A 1Z5AA 7CATA 2EKKA 3KOYE 1TF0B 3LZEA 1GJTA 3QN0A 4JI2M 2OO9A 1TTEA 2LVOC 3GRYA 3L28A 5IREB 4IBKA 2LVQD 1I94M 2LVNC 5EXPA 2KNAA 1XXHB 4L78A 4GKJM 4QOZC 2J5YA 1K82A 2YFQA 3RGSA 4M9ZA 1N34M 1IXRC 2N35A 4M9SA 3KW6A 1OIPA 1XMOM 2DJ6A 1TDHA 1QDTA 2UUCM 1ORYB 3LVWA 1Q3BA 3K1JA 1HQYE 2KXEA 1GVNA 1SXJC 2MGWA 3M0NA 1HT2E 4NL4H 2C9OA 1UFZA 2LNZA 3K92A 1IQPA 1IN6A 1J7KA 2FS1A 5H37D 1AUAA 1NNJA 3HHZA 4B7FA 2ZAOA 2R65A 1QQWA 1QUSA 1QZEA 2XH9A 1J09A 2KW0A 2JY8A 1IS7A 1G4AE 2DKLA 4GIPA 2CHVA 3RFWA 3QYEA 2R4EA 3GLIB 3T1YM 1GJSA 3SC3A 1E94E 4OVZB 4JA3A 2KHHA 2BJVA 4JI8M 1L2CA 3C3DA 3LCVB 5FTKA 3DZDA 1T3TA 4JI4M 1JB0F 1QANA 5LMUM 1ZMVA 1IY0A 3C3EA 5ITYA 1YE9A 3VK8A 4RNAA 3LX3A 3GLFA 3GLGB 1NJGA 1IN4A 1ZV1A 3L26A 4B08A 2UXCM 3DOAA 2C96A 2D7GA 1SXJE 1PJQA 2Z7JA 4RKUF 2LHCA 4I81A 5ITXE 4LF8M 4ANRA 5DMZA 5EP3A 5IWAM 1L1ZA 1QVRA 2UXBM 2HAKA 4NXMM 2JP7A 4Z6YA 5KPZA 4G4QA 2XGNA 2MH8A 5C18A 2Y0TA 4FD2A 1GTPA 2CEAA 4FWDA 4MB7A 4FVGA 2DTTA 4CISA 3L27A 3GPUA 1SXJA 3Q8GA 2KZSA 1IXZA 5ITXA 4DV0M 1MU5A 2JY5A 2K6BA 2OOAA 2XSZA 3KP0E 3SYKA 2KNVA 3GRRA 2UUBM 1KSFX 2L4FA 3J80S 3TQSA 3U6PA 3DA1A 1Z59A 3LMMA 4LJ5A 1N33M 5FTLA 5L8RF 3J2PB 4G3OA 3R8FA 1N78A 2FE8A 2DWNA 1QAOA 4GHLA 1PJJA 4IBJA 2WSEF 1L2BA 3T6PA 3PNVA 3AFHA 1IBMM 2WSFF 1OAOC 3GQ5A 2WZJA 1D0LA 3ZC7B 5F3WA 4FCTA 2BWBA 4NTMA 2DENA 4Z8XA 3THGA 3SYLA 2NQ8C 1R2YA 4FVMA 3B89A 1PJIA 4AZFA 2QP9X 3GO8A 2CWBA 4QHTA 3QAUA 3MHVC 4IJFA 1WURA 3U61B 3B9PA 1XB2B 4G4OA 1FNNA 3LVVA 4GC5A 4HL4A 4LJ6A 3W0FA 2EA0A 3NWLA 2R44A 4WW0A 3JR5A 4R8QA 4DR5M 3BK6A 1LTMA 1ZMUA 2DHRA 3EIHA 4L4UA 2ZANA 4WURA 3OTOM 2C5RA 1VEKA 1DGHA 2E5LM 4GKKM 4IBDA 1IBLM 4K0KM 3GLFB 4JN6A 1Q39A 2MR9A 3SMSA 3U6CA 4AI6A 3BXWA 1IN7A 5FTMA 3SASA 4FWHA 4Q7JA 1D2NA 1FJGM 4OW0A 3B74A 1HR0M 2F5QA 3FTDA 1N3TA 4PDGA 2DNAA 1AIPC 4D82A 4DR7M 4DR1M 1XWIA 3HHYA 1MJGM 4R71A 3KP1E 4LJ4A 1WXQA 4JV5M 2DAEA 1DO2A 4B3RM 3I2BA 2HWJA 2Z4RA 4GEWA 4NTKA 1K3WA 2KDLA 3GRUA 1E9SA 3FUVA 4KLNA 3V76A 2DWLA 1QDRA 1SXJB 4NOOB 3CF2A 1IY2A 1KFVA 1QAQA 3LCUA 4LFAM 1E32A 2CP8A 4FWGA 2G5GX 5EXSA 1GABA 1GLNA 3M7GA 1WR1B 2QZ4A 2ZAMA 3GQ3A 2LXEA 4WP2A 3JYGA 1F4IA 5EP2A 4LF7M 1J5EM 3QN9A 1V92A 2XEPA 1NVMA 2KZUA 2ERCA 3AJIB 3B7ZA 4MGHA 2EO2A 2YNMD 3FUWA 2AHMA 1NHWC 1G3IA 2Z4SA 3CGWA 2F5NA 4JI6M 1PJTA 2WSCF 4LFCM 4LJ7A 1NJFA 2MJ5B 4R7GA 2PN0A 1G71A 3SAUA 2MROB 4LGYA 1EE8A 3U6QA 3HJ8A 1IBKM 2CE7A 1G59A 2UUAM 3J27B 4CGYB 4W5WA 1E9RA 1C1KA 3FUUA 1PM5A 3NBIA 1MN3A 3GP1A 2LNHC 5E6JA 1QAMA 3KOWE 2M60A 4R3DA 2BWEA 3UGJA 3A46A 1PGYA 2RGHA 4PT5A 1VG5A 5E26A 3NBXX 4NC6A 3I51A 4D81A 4NTNA 1QYRA 1I4WA 1IXSA 1VDDA 3BOSA 2V1CA 2Y20A 4KODA 2KEBA 4L6V6 3TWLA 3SATA 1DGHB 4FW9A 2R62A 1XHBA 4DBGB 3B7QA 4LGMA 3TL4X 1NSFA 4JI0M 2L7IA 1N36M 3UMMA 4S12A 2B3TA 1N75A 3HHWA 1Z5CA 2V1UA 1GKIA 3UK6A 5LMNM 3HX3A 2O25A 1SXJD 1NO1A 3A42A 3VDUA 3FKEA 2XSZD 4MGYE 3LQRA 5KQ8A 3L25A 2DAMA 1G41A 4OX9M 2XFTA
chains in the Genus database with same CATH topology
2LVPC 3IECA 2K9DA 4G3OA 2L4EA 2LO0A 1EL6A 3VEJA 1IS8A 2DZLA 1DV0A 1P3QQ 3T6PA 3K9OA 1KYIA 4F1IA 1IM2A 2WZJA 1EFUB 1T6OA 2BWBA 2DENA 1OQYA 2JZ0A 3F92A 5DFLA 1SG9A 2L2DA 3B89A 2CWBA 1N3RA 3FE3A 1WUQA 4E44B 1WURA 3FRIA 2P11A 3GLHE 1XB2B 2PN0A 2LBCA 2DAIA 4DRBJ 1DO0A 2JY7A 4R8QA 1VEJA 3IHPA 2EJSA 1N3SA 1WPLA 1HT1E 4QPMA 1ZMUA 3E21A 1VEKA 1TR8A 2RRUA 3BBZA 2LTUA 1FBXA 3K9PA 1TFEA 2MR9A 3B0BC 3MMPA 2EKKA 3GLFE 4Q7JA 2OO9A 1TTEA 2LVOC 1N3TA 4NE5B 2DNAA 2JZ1A 1AIPC 2OOBA 2LVQD 2LVNC 2R0IA 2KNAA 4R71A 3H4JA 2DAEA 1FB1A 1XXHE 4F2LA 1DO2A 2HWJA 4NE6B 4GEWA 2K0BX 4DRAE 4UN2B 1NV8A 5JI2E 1OKSA 2G3QA 1OTRA 3LCUA 1HQYE 1WM9A 2MGWA 2LVAA 1HT2E 2CP8A 1CUKA 2H5XA 1UFZA 2LNZA 1WR1B 1WGNA 4WP2A 1F4IA 1V92A 3FRHA 1QZEA 1IFYA 1IS7A 2JY8A 1WHCA 1G4AE 2DKLA 1G3IA 1E94E 4JA3A 2KHHA 3E46A 2MJ5B 3LCVB 2JUJA 2MROB 1OAIA 1VDLA 1ZMVA 1VQ1A 2EKFA 1WIVA 2QNJA 2DI0A 1C7YA 1A8RA 1ZV1A 1MN3A 1WJ7A 1WGLA 2JY6B 3GLGE 4DU6A 2QSFX 4NE3B 1Y8GA 2ZTCA 5DMZA 2BWEA 1PGYA 4E45B 1VG5A 1GO5A 1A9CA 2HAKA 1IXSA 2DAKA 2JNHA 4HEOA 2KR1A 2JP7A 2QHOB 1YLAA 2KNZA 4DBGB 1BVSA 1Q02A 1GTPA 3BMBA 2B3TA 1NV9A 1A5TA 1R4GA 2DHYA 2DAGA 1JR3E 1T43A 3GLIE 2OOAA 2JY5A 2O25A 1ZMWA 2KNVA 2L4FA 2ZTDA 1HJPA 2DAMA 1G41A 1VEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVP C;  3IEC A;  2K9D A;  4G3O A;  2L4E A;  2DZL A;  1DV0 A;  1P3Q Q;  3T6P A;  3K9O A;  1KYI A;  4F1I A;  1IM2 A;  2WZJ A;  1EFU B;  1T6O A;  2BWB A;  2DEN A;  1OQY A;  2JZ0 A;  3F92 A;  5DFL A;  1SG9 A;  2L2D A;  3B89 A;  2CWB A;  3FE3 A;  3FRI A;  3GLH E;  1XB2 B;  2PN0 A;  2LBC A;  2DAI A;  1DO0 A;  2JY7 A;  1VEJ A;  3IHP A;  2EJS A;  1HT1 E;  1ZMU A;  3E21 A;  1VEK A;  1TR8 A;  2RRU A;  3BBZ A;  2LTU A;  3K9P A;  1TFE A;  2MR9 A;  3MMP A;  2EKK A;  3GLF E;  4Q7J A;  2OO9 A;  1TTE A;  2LVO C;  2DNA A;  2JZ1 A;  1AIP C;  2OOB A;  2LVQ D;  2LVN C;  2R0I A;  2KNA A;  4R71 A;  3H4J A;  2DAE A;  1XXH E;  4F2L A;  1DO2 A;  2HWJ A;  4GEW A;  2K0B X;  4UN2 B;  1NV8 A;  5JI2 E;  1OKS A;  2G3Q A;  1OTR A;  3LCU A;  1HQY E;  2MGW A;  2LVA A;  1HT2 E;  2CP8 A;  1CUK A;  2H5X A;  1UFZ A;  1WR1 B;  1WGN A;  4WP2 A;  1F4I A;  1V92 A;  3FRH A;  1QZE A;  1IFY A;  2JY8 A;  1WHC A;  1G4A E;  2DKL A;  1G3I A;  1E94 E;  2KHH A;  3E46 A;  2MJ5 B;  3LCV B;  2JUJ A;  2MRO B;  1OAI A;  1VDL A;  1ZMV A;  1VQ1 A;  2EKF A;  1WIV A;  2QNJ A;  2DI0 A;  1C7Y A;  1ZV1 A;  1MN3 A;  1WJ7 A;  1WGL A;  2JY6 B;  3GLG E;  2QSF X;  1Y8G A;  2ZTC A;  2BWE A;  1PGY A;  1VG5 A;  1GO5 A;  2HAK A;  1IXS A;  2DAK A;  2JNH A;  4HEO A;  2JP7 A;  2QHO B;  1YLA A;  2KNZ A;  4DBG B;  1BVS A;  1Q02 A;  3BMB A;  2B3T A;  1NV9 A;  1A5T A;  1R4G A;  2DHY A;  2DAG A;  1JR3 E;  1T43 A;  3GLI E;  2OOA A;  2JY5 A;  2O25 A;  1ZMW A;  2KNV A;  2L4F A;  2ZTD A;  1HJP A;  2DAM A;  1G41 A;  1VEG A; 
#chains in the Genus database with same CATH topology
 2BJW A;  2LVP C;  2QQ8 A;  2CRU A;  2L4E A;  3VK7 A;  2WSE G;  2L09 A;  4G4R A;  1EL6 A;  5EP4 A;  2FH0 A;  3HU2 A;  2DZL A;  3E4R A;  1HNW M;  3U6D A;  2WSF G;  1P3Q Q;  5EP1 A;  1PJS A;  1R2Z A;  1IM2 A;  3AOG A;  4JXJ A;  3VFD A;  4AG5 A;  4JYA M;  4LZZ A;  5A2Q S;  1T6O A;  2QPA A;  4B3M M;  2LHG A;  2OBA A;  1OQY A;  2WSC K;  3FTF A;  3F92 A;  3LW5 F;  3HJQ A;  2L2D A;  4OU7 A;  4DV6 M;  3PVS A;  3SAV A;  3J7B A;  3HU1 A;  4KHP M;  3L29 A;  1HQC A;  2XLJ A;  5EJC A;  3ZQJ A;  1L1T A;  3GLH E;  2R4J A;  2P11 A;  3M6A A;  2CV1 A;  3K8Z A;  3Q8X A;  4AW4 A;  2JY7 A;  3IHP A;  3VLF B;  4YHH M;  3QNA A;  5FTN A;  3FD9 A;  2XZU A;  2RKO A;  1WIN A;  5FTJ A;  1IY1 A;  1TR8 A;  1JQJ C;  2RRU A;  4MGZ E;  2ZM6 M;  3KFU G;  1IN5 A;  1TFE A;  3B0B C;  3J7A S;  3MMP A;  4BLC A;  2UU9 M;  2M5Z A;  4NXN M;  4D80 A;  4DR4 M;  1X37 A;  4B7H A;  4B3S M;  1NY6 A;  3PNY A;  1JR3 D;  2EUC A;  2OOB A;  3D8L A;  4L16 A;  3TWM A;  2CHQ A;  5DNY A;  4RF1 A;  2R0I A;  3B7N A;  3FUT A;  5FSW A;  1IXS B;  4NRV A;  2V6Z M;  3T38 A;  3H4J A;  1GTQ A;  2DWM A;  4II7 A;  3HWS A;  3SHF A;  3KS8 A;  4CJ6 A;  1FB1 A;  1XXH E;  2VII A;  4F2L A;  4MGK E;  2DZO B;  1XMQ M;  2OPF A;  2F5S A;  3CF0 A;  1NV8 A;  4ITQ A;  2VQF M;  3U60 A;  2F5O A;  2G3Q A;  3IG5 A;  2O5R A;  3SHG B;  3W67 A;  1OTR A;  2HHH M;  1XNR M;  1WM9 A;  3GQ4 A;  2LVA A;  2LWX A;  4PD2 A;  4DR3 M;  3GPX A;  4DUY M;  3W68 A;  3FYD A;  2H5X A;  4AKH A;  1YSY A;  1DGG A;  1WGN A;  3FUX A;  4LF6 M;  3HGI A;  4DV3 M;  4M0W A;  1ZAE A;  3FRH A;  2O01 F;  3FYC A;  1NNU C;  2Y21 A;  4NRW A;  3RGP A;  4GC9 A;  3EIE A;  3KXE C;  1WHC A;  3LW5 K;  2CFO A;  2VF7 A;  3A98 B;  4LCB A;  2WSC G;  2KRU A;  4LJ9 A;  1RU3 A;  2QBY A;  4LJA A;  2XF3 A;  5DYI A;  3E46 A;  1NHG C;  1UM8 A;  2YQZ A;  2CV0 A;  2L6O A;  4DV2 M;  1TH3 A;  4GRI A;  3QYB A;  4CIZ A;  4PCZ A;  2EKF A;  4IBC A;  3LQQ A;  2HL7 A;  1C7Y A;  1XNQ M;  3KSX A;  1D0M A;  2R18 A;  1A8R A;  1WJ7 A;  1WGL A;  3GLG E;  2K47 A;  4DU6 A;  1Y8G A;  2ZTC A;  1L2D A;  3SMP A;  1OJL A;  8CAT A;  4E45 B;  3HZJ A;  3JR4 A;  3C9P A;  4JI1 M;  4JI5 M;  1MX0 A;  2L7H A;  3HHX A;  1HNZ M;  1GO5 A;  3U6E A;  4HEO A;  1Z5B A;  5C1B A;  4XGI A;  4DUZ M;  4IJE A;  3AL0 C;  1V33 A;  2DWZ B;  2KNZ A;  2JWS A;  2XZF A;  1BVS A;  4LZJ A;  1Q02 A;  4LJ8 A;  3E9S A;  3VKH A;  3U6M A;  2I7P A;  5BR8 M;  2DHY A;  2CV2 A;  1H6U A;  4B3T M;  1LV7 A;  1S3S A;  2HKJ A;  3SFZ A;  4I5S A;  3KVW A;  2DAG A;  1T43 A;  5KPT A;  5FLX S;  3U6L A;  4AG6 A;  3M0E A;  3MJ5 A;  1N77 A;  4GH9 A;  1OIZ A;  1ZQ9 A;  4DV4 M;  3KSJ A;  3T1H M;  4LF5 M;  2H1R A;  1R5L A;  2D7H A;  2FNA A;  1V34 A;  1HJP A;  2ZTD A;  3I01 M;  4Y28 F;  5EXT A;  4YY3 M;  1DGF A;  2P5T A;  4BB9 A;  4X65 M;  3I4V A;  3DFZ A;  3W0L B;  4B7G A;  4IBE A;  4TUW A;  1G8P A;  2K9D A;  4EIW A;  2VQE M;  1N32 M;  2VDB B;  2VF8 A;  3ZH9 B;  3VEJ A;  1IS8 A;  1XC8 A;  2R46 A;  3U60 B;  4XK8 F;  4LRT A;  4P17 A;  4M0D A;  5ITR A;  1KYI A;  1QZM A;  2C99 A;  1EFU B;  2J7O A;  4DV5 M;  4GIT A;  4LRS A;  3U6S A;  3U5Z A;  4L8R C;  3LW5 G;  2JZ0 A;  4AKI A;  2Q2E B;  1R6B X;  3KS4 A;  3D7J A;  2X49 A;  3J81 S;  1SG9 A;  1TH4 A;  1HNX M;  3WHK A;  1N3R A;  3A45 A;  3FE3 A;  3L2A A;  4E44 B;  4DR2 M;  2JA2 A;  3D8B A;  4FCW A;  4QOS A;  3U6O A;  2QBY B;  3C58 A;  2LBC A;  4DRB J;  2W82 A;  4IBF A;  4PDI A;  1VEJ A;  3CF6 E;  2EJS A;  1WPL A;  1OFH A;  4A3V B;  1HT1 E;  1L8Q A;  2C98 A;  3BBZ A;  1FBX A;  1NY5 A;  2YR0 A;  3KOX E;  3GLF E;  1IN8 A;  2A0S A;  2J7N A;  2QCU A;  4NE5 B;  3HY5 A;  3U61 A;  2JZ1 A;  1YUB A;  2KA6 B;  1Q3C A;  3FTC A;  5IZ7 D;  4I8O A;  2KRK A;  4FVF A;  4X66 M;  2Y0Q A;  4MGI E;  5ITU A;  2X8A A;  2F4V M;  4NE6 B;  4AKG A;  2K0B X;  4IIW A;  4DRA E;  3PXG A;  4MH0 E;  1B6Z A;  4UN2 B;  3JAM S;  4CHT B;  5JI2 E;  2CUZ A;  1OKS A;  3I04 M;  2F5P A;  5GKN A;  3T15 A;  3MK6 A;  4LF9 M;  1TGU A;  4HLQ A;  5DYG A;  4DV1 M;  1CUK A;  2A5Y B;  2RGO A;  4IBI A;  5ITQ A;  2JXN A;  2DVW B;  2O01 G;  3GPP A;  1K3X A;  2Z3X A;  4GHA A;  2UXD M;  3R9X B;  3GLH A;  2RPB A;  1IFY A;  1W5S A;  2DXI A;  2OQ4 A;  1TDZ A;  4KO8 A;  2JUJ A;  4X62 M;  4IBB A;  3U5Z B;  1OAI A;  1VDL A;  4G6Z A;  3ZCB B;  3AOE C;  1VQ1 A;  5KPR A;  1WIV A;  2FOI C;  4G4N A;  2QNJ A;  4REZ A;  2DI0 A;  1B66 A;  5BPV A;  3K2L A;  3HU3 A;  4I4L A;  2JY6 B;  2BNK A;  4NSO B;  4QNR A;  3ILK A;  2QSF X;  4NE3 B;  3AV0 A;  3H4M A;  1A9C A;  2KR1 A;  1D0K A;  1XXH A;  2DAK A;  2JNH A;  2D7E A;  4LY6 A;  5KQD A;  3AKZ A;  2QHO B;  3IG8 A;  1YLA A;  3FTE A;  4JI7 M;  2FFJ A;  2XFS A;  3BMB A;  4DR6 M;  3WHL A;  5ITT A;  2X4A A;  1NV9 A;  1A5T A;  1R4G A;  2G64 A;  1GL7 A;  3PFI A;  3GLI E;  1JR3 E;  3UZU A;  3HJS A;  2GNO A;  3SAW A;  1ZMW A;  2LH0 A;  3GRV A;  2I7N A;  4XBO A;  2APL A;  4FVJ A;  4ZPX A;  3SBJ A;  2CHG A;  1VEG A;  4AQY M;  1GL6 A;  3IEC A;  4QHS A;  2QEN A;  2LO0 A;  4QNM A;  5IT9 S;  4LF4 M;  4LG2 A;  2ZBK B;  5EXX A;  3VDP A;  3GLI A;  1JR3 A;  1DV0 A;  3KOZ E;  1OFI A;  3K9O A;  4F1I A;  1Z6T A;  4P16 A;  4OVZ A;  4JI3 M;  2R45 A;  5KO3 A;  3AOE A;  2Z8Y M;  3VKG A;  4M9X A;  1R7R A;  5JI3 E;  1W5T A;  3TE6 A;  3QWL A;  4BBA A;  3KDS E;  4LFB M;  5DFL A;  3GLG A;  2R6F A;  1Y13 A;  2DZN B;  4DV7 M;  3GLH B;  4MM3 B;  1WUQ A;  1TH2 A;  3GPY A;  4IBG A;  2GQF A;  3FRI A;  2C9C A;  4L15 A;  4NSR A;  2HCB A;  3HKP A;  4GMQ A;  4RF0 A;  3TWK A;  3SAR A;  1DGB A;  2DAI A;  4KT0 F;  4X64 M;  1DO0 A;  3TPZ A;  2G8L A;  1N3S A;  5EQT A;  4QPM A;  2WSE K;  3E21 A;  1QUT A;  4FCV A;  3CTW B;  3I4Y A;  3UJN A;  1EIJ A;  2LTU A;  2WSF K;  1PRB A;  3K9P A;  3RE8 A;  1Z5A A;  7CAT A;  2EKK A;  3KOY E;  1TF0 B;  3LZE A;  1GJT A;  3QN0 A;  4JI2 M;  2OO9 A;  1TTE A;  2LVO C;  3GRY A;  3L28 A;  5IRE B;  4IBK A;  2LVQ D;  1I94 M;  2LVN C;  5EXP A;  2KNA A;  1XXH B;  4L78 A;  4GKJ M;  4QOZ C;  2J5Y A;  1K82 A;  2YFQ A;  3RGS A;  4M9Z A;  1N34 M;  1IXR C;  2N35 A;  4M9S A;  3KW6 A;  1OIP A;  1XMO M;  2DJ6 A;  1TDH A;  1QDT A;  2UUC M;  1ORY B;  3LVW A;  1Q3B A;  3K1J A;  1HQY E;  2KXE A;  1GVN A;  1SXJ C;  2MGW A;  3M0N A;  1HT2 E;  4NL4 H;  2C9O A;  1UFZ A;  2LNZ A;  3K92 A;  1IQP A;  1IN6 A;  1J7K A;  2FS1 A;  5H37 D;  1AUA A;  1NNJ A;  3HHZ A;  4B7F A;  2ZAO A;  2R65 A;  1QQW A;  1QUS A;  1QZE A;  2XH9 A;  1J09 A;  2KW0 A;  2JY8 A;  1IS7 A;  1G4A E;  2DKL A;  4GIP A;  2CHV A;  3RFW A;  3QYE A;  2R4E A;  3GLI B;  3T1Y M;  1GJS A;  3SC3 A;  1E94 E;  4OVZ B;  4JA3 A;  2KHH A;  2BJV A;  4JI8 M;  1L2C A;  3C3D A;  3LCV B;  5FTK A;  3DZD A;  1T3T A;  4JI4 M;  1JB0 F;  1QAN A;  5LMU M;  1ZMV A;  1IY0 A;  3C3E A;  5ITY A;  1YE9 A;  3VK8 A;  4RNA A;  3LX3 A;  3GLF A;  3GLG B;  1NJG A;  1IN4 A;  1ZV1 A;  3L26 A;  4B08 A;  2UXC M;  3DOA A;  2C96 A;  2D7G A;  1SXJ E;  1PJQ A;  2Z7J A;  4RKU F;  2LHC A;  4I81 A;  5ITX E;  4LF8 M;  4ANR A;  5DMZ A;  5EP3 A;  5IWA M;  1L1Z A;  1QVR A;  2UXB M;  2HAK A;  4NXM M;  2JP7 A;  4Z6Y A;  5KPZ A;  4G4Q A;  2XGN A;  2MH8 A;  5C18 A;  2Y0T A;  4FD2 A;  1GTP A;  2CEA A;  4FWD A;  4MB7 A;  4FVG A;  2DTT A;  4CIS A;  3L27 A;  3GPU A;  1SXJ A;  3Q8G A;  2KZS A;  1IXZ A;  5ITX A;  4DV0 M;  1MU5 A;  2JY5 A;  2K6B A;  2OOA A;  2XSZ A;  3KP0 E;  3SYK A;  2KNV A;  3GRR A;  2UUB M;  1KSF X;  2L4F A;  3J80 S;  3TQS A;  3U6P A;  3DA1 A;  1Z59 A;  3LMM A;  4LJ5 A;  1N33 M;  5FTL A;  5L8R F;  3J2P B;  4G3O A;  3R8F A;  1N78 A;  2FE8 A;  2DWN A;  1QAO A;  4GHL A;  1PJJ A;  4IBJ A;  2WSE F;  1L2B A;  3T6P A;  3PNV A;  3AFH A;  1IBM M;  2WSF F;  1OAO C;  3GQ5 A;  2WZJ A;  1D0L A;  3ZC7 B;  5F3W A;  4FCT A;  2BWB A;  4NTM A;  2DEN A;  4Z8X A;  3THG A;  3SYL A;  2NQ8 C;  1R2Y A;  4FVM A;  3B89 A;  1PJI A;  4AZF A;  2QP9 X;  3GO8 A;  2CWB A;  4QHT A;  3QAU A;  3MHV C;  4IJF A;  1WUR A;  3U61 B;  3B9P A;  1XB2 B;  4G4O A;  1FNN A;  3LVV A;  4GC5 A;  4HL4 A;  4LJ6 A;  3W0F A;  2EA0 A;  3NWL A;  2R44 A;  4WW0 A;  3JR5 A;  4R8Q A;  4DR5 M;  3BK6 A;  1LTM A;  1ZMU A;  2DHR A;  3EIH A;  4L4U A;  2ZAN A;  4WUR A;  3OTO M;  2C5R A;  1VEK A;  1DGH A;  2E5L M;  4GKK M;  4IBD A;  1IBL M;  4K0K M;  3GLF B;  4JN6 A;  1Q39 A;  2MR9 A;  3SMS A;  3U6C A;  4AI6 A;  3BXW A;  1IN7 A;  5FTM A;  3SAS A;  4FWH A;  4Q7J A;  1D2N A;  1FJG M;  4OW0 A;  3B74 A;  1HR0 M;  2F5Q A;  3FTD A;  1N3T A;  4PDG A;  2DNA A;  1AIP C;  4D82 A;  4DR7 M;  4DR1 M;  1XWI A;  3HHY A;  1MJG M;  4R71 A;  3KP1 E;  4LJ4 A;  1WXQ A;  4JV5 M;  2DAE A;  1DO2 A;  4B3R M;  3I2B A;  2HWJ A;  2Z4R A;  4GEW A;  4NTK A;  1K3W A;  2KDL A;  3GRU A;  1E9S A;  3FUV A;  4KLN A;  3V76 A;  2DWL A;  1QDR A;  1SXJ B;  4NOO B;  3CF2 A;  1IY2 A;  1KFV A;  1QAQ A;  3LCU A;  4LFA M;  1E32 A;  2CP8 A;  4FWG A;  2G5G X;  5EXS A;  1GAB A;  1GLN A;  3M7G A;  1WR1 B;  2QZ4 A;  2ZAM A;  3GQ3 A;  2LXE A;  4WP2 A;  3JYG A;  1F4I A;  5EP2 A;  4LF7 M;  1J5E M;  3QN9 A;  1V92 A;  2XEP A;  1NVM A;  2KZU A;  2ERC A;  3AJI B;  3B7Z A;  4MGH A;  2EO2 A;  2YNM D;  3FUW A;  2AHM A;  1NHW C;  1G3I A;  2Z4S A;  3CGW A;  2F5N A;  4JI6 M;  1PJT A;  2WSC F;  4LFC M;  4LJ7 A;  1NJF A;  2MJ5 B;  4R7G A;  2PN0 A;  1G71 A;  3SAU A;  2MRO B;  4LGY A;  1EE8 A;  3U6Q A;  3HJ8 A;  1IBK M;  2CE7 A;  1G59 A;  2UUA M;  3J27 B;  4CGY B;  4W5W A;  1E9R A;  1C1K A;  3FUU A;  1PM5 A;  3NBI A;  1MN3 A;  3GP1 A;  2LNH C;  5E6J A;  1QAM A;  3KOW E;  2M60 A;  4R3D A;  2BWE A;  3UGJ A;  3A46 A;  1PGY A;  2RGH A;  4PT5 A;  1VG5 A;  5E26 A;  3NBX X;  4NC6 A;  3I51 A;  4D81 A;  4NTN A;  1QYR A;  1I4W A;  1IXS A;  1VDD A;  3BOS A;  2V1C A;  2Y20 A;  4KOD A;  2KEB A;  4L6V 6;  3TWL A;  3SAT A;  1DGH B;  4FW9 A;  2R62 A;  1XHB A;  4DBG B;  3B7Q A;  4LGM A;  3TL4 X;  1NSF A;  4JI0 M;  2L7I A;  1N36 M;  3UMM A;  4S12 A;  2B3T A;  1N75 A;  3HHW A;  1Z5C A;  2V1U A;  1GKI A;  3UK6 A;  5LMN M;  3HX3 A;  2O25 A;  1SXJ D;  1NO1 A;  3A42 A;  3VDU A;  3FKE A;  2XSZ D;  4MGY E;  3LQR A;  5KQ8 A;  3L25 A;  2DAM A;  1G41 A;  4OX9 M;  2XFT A; 
#chains in the Genus database with same CATH homology
 2LVP C;  3IEC A;  2K9D A;  4G3O A;  2L4E A;  2LO0 A;  1EL6 A;  3VEJ A;  1IS8 A;  2DZL A;  1DV0 A;  1P3Q Q;  3T6P A;  3K9O A;  1KYI A;  4F1I A;  1IM2 A;  2WZJ A;  1EFU B;  1T6O A;  2BWB A;  2DEN A;  1OQY A;  2JZ0 A;  3F92 A;  5DFL A;  1SG9 A;  2L2D A;  3B89 A;  2CWB A;  1N3R A;  3FE3 A;  1WUQ A;  4E44 B;  1WUR A;  3FRI A;  2P11 A;  3GLH E;  1XB2 B;  2PN0 A;  2LBC A;  2DAI A;  4DRB J;  1DO0 A;  2JY7 A;  4R8Q A;  1VEJ A;  3IHP A;  2EJS A;  1N3S A;  1WPL A;  1HT1 E;  4QPM A;  1ZMU A;  3E21 A;  1VEK A;  1TR8 A;  2RRU A;  3BBZ A;  2LTU A;  1FBX A;  3K9P A;  1TFE A;  2MR9 A;  3B0B C;  3MMP A;  2EKK A;  3GLF E;  4Q7J A;  2OO9 A;  1TTE A;  2LVO C;  1N3T A;  4NE5 B;  2DNA A;  2JZ1 A;  1AIP C;  2OOB A;  2LVQ D;  2LVN C;  2R0I A;  2KNA A;  4R71 A;  3H4J A;  2DAE A;  1FB1 A;  1XXH E;  4F2L A;  1DO2 A;  2HWJ A;  4NE6 B;  4GEW A;  2K0B X;  4DRA E;  4UN2 B;  1NV8 A;  5JI2 E;  1OKS A;  2G3Q A;  1OTR A;  3LCU A;  1HQY E;  1WM9 A;  2MGW A;  2LVA A;  1HT2 E;  2CP8 A;  1CUK A;  2H5X A;  1UFZ A;  2LNZ A;  1WR1 B;  1WGN A;  4WP2 A;  1F4I A;  1V92 A;  3FRH A;  1QZE A;  1IFY A;  1IS7 A;  2JY8 A;  1WHC A;  1G4A E;  2DKL A;  1G3I A;  1E94 E;  4JA3 A;  2KHH A;  3E46 A;  2MJ5 B;  3LCV B;  2JUJ A;  2MRO B;  1OAI A;  1VDL A;  1ZMV A;  1VQ1 A;  2EKF A;  1WIV A;  2QNJ A;  2DI0 A;  1C7Y A;  1A8R A;  1ZV1 A;  1MN3 A;  1WJ7 A;  1WGL A;  2JY6 B;  3GLG E;  4DU6 A;  2QSF X;  4NE3 B;  1Y8G A;  2ZTC A;  5DMZ A;  2BWE A;  1PGY A;  4E45 B;  1VG5 A;  1GO5 A;  1A9C A;  2HAK A;  1IXS A;  2DAK A;  2JNH A;  4HEO A;  2KR1 A;  2JP7 A;  2QHO B;  1YLA A;  2KNZ A;  4DBG B;  1BVS A;  1Q02 A;  1GTP A;  3BMB A;  2B3T A;  1NV9 A;  1A5T A;  1R4G A;  2DHY A;  2DAG A;  1JR3 E;  1T43 A;  3GLI E;  2OOA A;  2JY5 A;  2O25 A;  1ZMW A;  2KNV A;  2L4F A;  2ZTD A;  1HJP A;  2DAM A;  1G41 A;  1VEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...