4Q7JA

Complex structure of viral rna polymerase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
b'TASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Ts
molecule tags Translation/transferase
source organism Escherichia coli
publication title Molecular insights into replication initiation by Q beta replicase using ribosomal protein S1
pubmed doi rcsb
total genus 78
structure length 278
sequence length 278
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4q7jA01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4q7jA04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA03
3IECA 4WP2A 1ZMUA 1MN3A 1R4GA 1QZEA 2QHOB 3MMPA 2JNHA 3BMBA 3GLFE 1YLAA 1WIVA 2EKKA 1EFUB 2HAKA 2DI0A 3IHPA 2H5XA 5DFLA 2KNAA 3F92A 2MGWA 2LTUA 1WGLA 1WGNA 1OKSA 2EJSA 2LBCA 1DV0A 1OAIA 4GEWA 1VEJA 4UN2B 4F1IA 2KNVA 4DBGB 2HWJA 2KNZA 1ZMWA 1A5TA 1WHCA 2JY6B 2RRUA 2ZTCA 1TR8A 1NV9A 3BBZA 2LVAA 1HQYE 2DAKA 2MROB 2JZ1A 3GLIE 1V92A 2MJ5B 1KYIA 1G41A 1Y8GA 2DAGA 2KHHA 2R0IA 1HT2E 2BWEA 2DZLA 1G4AE 3K9OA 4G3OA 1BVSA 2JZ0A 2DENA 1G3IA 1OTRA 2WZJA 1GO5A 1T43A 2G3QA 1XB2B 2QSFX 2PN0A 2LVOC 5JI2E 1VG5A 2JUJA 2L2DA 1AIPC 1HT1E 2O25A 3FRIA 2JP7A 2ZTDA 2K9DA 1SG9A 2QNJA 1OQYA 2LVQD 2EKFA 2DNAA 1Q02A 3E46A 2L4EA 3T6PA 3FRHA 1TTEA 1VDLA 2CP8A 2LVNC 1F4IA 1VQ1A 3LCVB 2OO9A 4F2LA 3K9PA 2DAIA 1P3QQ 1PGYA 1XXHE 1E94E 3FE3A 1WR1B 1CUKA 3B89A 2OOBA 1IM2A 4R71A 2L4FA 2B3TA 1DO2A 1ZV1A 2DKLA 1WJ7A 3GLHE 2DAMA 1HJPA 2JY7A 1T6OA 1VEGA 1IXSA 4HEOA 2JY8A 2JY5A 1ZMVA 2CWBA 3GLGE 1NV8A 2K0BX 1C7YA 1TFEA 2MR9A 2OOAA 4Q7JA 1UFZA 2DHYA 1DO0A 2LVPC 1JR3E 3E21A 2BWBA 1IFYA 3LCUA 2DAEA 3H4JA 1VEKA
chains in the Genus database with same CATH superfamily
4AKGA 1ZMUA 1MN3A 4P16A 3AOGA 4DR1M 1QZEA 2RPBA 4NRVA 4FCTA 2A5YB 4JXJA 5LMNM 2LXEA 4LJ6A 4LJ5A 3B0BC 3KFUG 2DZNB 3UMMA 4Y28F 1SXJC 1Z59A 3D8LA 4XGIA 3SBJA 4LFAM 3VK7A 3KOXE 2C99A 4LF6M 1GABA 1NHGC 2H5XA 2YR0A 3HWSA 4GC9A 1NY5A 1K3XA 4L8RC 2R4EA 5H37D 2VIIA 2O01F 1QVRA 2L7IA 1QZMA 1WGLA 1SXJA 4NTNA 1IXRC 4R3DA 4YY3M 4X64M 2WSFK 1JR3A 3T15A 2KNVA 2DWNA 2KNZA 1K82A 5IZ7D 3B7ZA 3LQRA 5ITQA 3VK8A 2QBYB 1XNRM 2G64A 2XF3A 2CV0A 1I94M 1B6ZA 2DWZB 4DV7M 1IY1A 4L15A 1WURA 3GLIE 1E9SA 2WSEK 4NTKA 2MJ5B 3GLIA 2Y20A 4GH9A 3TE6A 4DRAE 2C5RA 4R7GA 2FOIC 2ZBKB 5DYGA 1MX0A 4G3OA 3HJSA 2WSCK 1J7KA 2H1RA 3V76A 4FCVA 3ZC7B 3U5ZB 1QDRA 3MHVC 1XB2B 3GLHA 3TWMA 3LMMA 2JUJA 1XXHA 3K8ZA 2Y21A 1Z5BA 2O25A 4MM3B 4CIZA 5EQTA 4A3VB 3KSJA 2E5LM 1EIJA 3I04M 1HQCA 2FNAA 2WSFG 3HU2A 5E6JA 3RGSA 4MGHA 2ZTDA 2XEPA 4LJ8A 2K9DA 2C9OA 3SC3A 2XGNA 5KO3A 4NE6B 4B08A 4GHAA 4K0KM 1OQYA 1Q3BA 1WM9A 2LVQD 2R44A 2I7PA 2FE8A 4E44B 2EKFA 5EXXA 1T3TA 1Q02A 2DNAA 3BXWA 4NSRA 3VLFB 2KA6B 2LH0A 2DXIA 2L4EA 4DR5M 4MGYE 3T6PA 1N36M 2G8LA 4KLNA 2OPFA 1VDLA 3C58A 1FNNA 3AOEA 2F5NA 3RFWA 4I5SA 1NHWC 4F2LA 3PVSA 4HL4A 4AKHA 1PGYA 3U60B 3I4YA 3UGJA 1E94E 1B66A 4NXMM 2R45A 2GNOA 3GQ3A 1IN4A 3WHLA 4KT0F 1Q39A 4S12A 4DV0M 2UUCM 1GVNA 3L28A 1N3SA 3L29A 3IG5A 1NSFA 4QHSA 5FTMA 2C98A 3TWLA 4DR3M 3U6EA 1TH4A 1IXSB 2DKLA 2ZM6M 3SMPA 1OIPA 1L1ZA 1MJGM 4L78A 2LNHC 3SYLA 1T6OA 1VEGA 2FFJA 2Y0TA 5KQ8A 2JY8A 2JY5A 4Z8XA 3SAUA 4OW0A 1C7YA 3OTOM 3GLFA 3J2PB 1PM5A 2W82A 3T1YM 3B9PA 3EIEA 4FCWA 1AUAA 1DO0A 1GJTA 4G4QA 3E21A 1QUSA 4JI4M 3SAWA 4BLCA 3E4RA 1IFYA 2R46A 3NBIA 4JV5M 5E26A 5A2QS 4DUZM 4XBOA 3IECA 4WP2A 3FUWA 3QYBA 4EIWA 1QANA 3FUUA 5FTNA 3GLGB 4W5WA 1GKIA 1DGHB 2JWSA 2Q2EB 5EP1A 4YHHM 1IBMM 4PCZA 4NL4H 3LW5F 4B7GA 1EFUB 1FJGM 3SMSA 2NQ8C 2WSEF 1VDDA 5DFLA 2KNAA 2F5SA 1ZAEA 3JR5A 3M0EA 4LCBA 1G59A 2M5ZA 3GP1A 2EJSA 4X65M 1GJSA 3GRVA 2A0SA 4JI1M 1QAOA 2D7EA 2L7HA 4I81A 4F1IA 4GKKM 2HCBA 2HL7A 2DWMA 3JYGA 1X37A 2CE7A 5EJCA 1A5TA 2JY6B 4AG6A 2RRUA 3LQQA 4CHTB 2EA0A 4LFBM 5ITYA 5KQDA 1TR8A 3GO8A 4DV5M 4JI6M 3AL0C 1D2NA 2LVAA 2CFOA 4OVZB 1K3WA 1N3TA 2MROB 4G4RA 4L6V6 2LO0A 4NE5B 7CATA 3QAUA 2KXEA 5FTKA 3FUVA 2C9CA 2YQZA 2VF8A 3HHYA 4JI8M 3CTWB 1G41A 1QQWA 2DAGA 2R0IA 3W0FA 4P17A 3JAMS 3SAVA 4G4NA 1HNZM 4FVFA 1HT2E 4LJAA 2CHGA 5ITXA 3U6MA 1G4AE 2R65A 2LNZA 1BVSA 4OVZA 2XH9A 4LRSA 2LHCA 1G3IA 2K6BA 3A98B 1L8QA 3KW6A 4HLQA 4JI0M 4PT5A 2J7OA 3T1HM 5L8RF 2Z4SA 2QP9X 3M6AA 1TDZA 3U6DA 1VG5A 2L6OA 5KPZA 1V34A 2RGHA 1N78A 2X4AA 3U6OA 3HZJA 4PDIA 2UXCM 1TH3A 5EP3A 3KSXA 1TF0B 2JP7A 5EP4A 1C1KA 4AG5A 3U6CA 4DUYM 1DGBA 4GKJM 3MJ5A 1IXZA 1SG9A 4MGZE 1PJIA 3EIHA 3HU3A 4DV6M 3HU1A 1UM8A 2EO2A 4I8OA 4LJ9A 4B3SM 1A9CA 2V1UA 1D0MA 3VDPA 3C3DA 1NY6A 1IBLM 1DGHA 2R6FA 3K2LA 3PNYA 4IBCA 4IBGA 3GLGA 3FRHA 1TTEA 4DR4M 2P11A 3J27B 4AKIA 3FTEA 2O01G 3DFZA 1VQ1A 2RKOA 3FTFA 3GRRA 3GRUA 1L1TA 2CHVA 1XXHE 1G8PA 3VKHA 1PRBA 2BNKA 1R5LA 5FLXS 3FE3A 1WR1B 3HJ8A 4QHTA 3WHKA 3GLFB 4B7HA 2J5YA 4ZPXA 2OOBA 1IM2A 3QYEA 4NOOB 4DV3M 2B3TA 3UJNA 2QCUA 4G6ZA 3A46A 4AQYM 1I4WA 4D82A 3SATA 4DV2M 1Z6TA 2KDLA 3CF0A 4MH0E 5IWAM 1V33A 2JY7A 3DA1A 2UUAM 1IXSA 2KRUA 4LF5M 2K47A 1ZMVA 4D81A 3MK6A 4Z6YA 1N75A 3PFIA 4LF7M 3R9XB 3LW5K 5EXTA 2OOAA 2DHRA 3U6LA 1TGUA 4M9SA 3KOYE 4NSOB 1UFZA 1IS8A 2QQ8A 4WW0A 3ZCBB 3HHXA 3U60A 4DU6A 2BWBA 3QN0A 3LCUA 2XZFA 4B3TM 1H6UA 3RGPA 3KVWA 3L25A 1QAMA 4XK8F 5BR8M 3ZQJA 1A8RA 1L2BA 2QHOB 3B7NA 3MMPA 2EUCA 4D80A 3QN9A 1E32A 4REZA 3BMBA 1W5TA 2F5QA 2AHMA 3GLFE 3AFHA 2VQFM 5EP2A 3L27A 1WIVA 1HNXM 1GTPA 3TQSA 2F4VM 1GL6A 3GPPA 2HAKA 3AJIB 3DZDA 3HKPA 3IHPA 4B7FA 1XMQM 4L4UA 5ITUA 3FUXA 2LTUA 3TWKA 1N77A 1W5SA 1WGNA 3M7GA 1OKSA 5ITRA 3UZUA 3QNAA 1DV0A 4BB9A 4GEWA 3RE8A 1VEJA 1XXHB 1D0LA 4JI5M 1IN8A 1OFHA 3FUTA 2UU9M 3GLHB 4JYAM 1FB1A 1TDHA 2HWJA 1J09A 2I7NA 3K92A 1XMOM 2YNMD 2ZTCA 2UXBM 3U5ZA 2KZUA 5FTLA 1Y13A 1KFVA 2GQFA 3I2BA 2FS1A 3PNVA 2DAKA 2F5PA 3I4VA 2JZ1A 3R8FA 3J7BA 4NC6A 3PXGA 1R7RA 4E45B 1V92A 1Z5AA 3LVVA 1KYIA 3K1JA 4DR2M 4KHPM 1Y8GA 3GLIB 1NO1A 4IBDA 4JA3A 1JB0F 2Y0QA 4LG2A 3M0NA 2BWEA 4QOZC 3GPXA 1Z5CA 2R62A 3K9OA 1J5EM 2QZ4A 4IBKA 3W67A 4QNMA 2DENA 2DJ6A 1OTRA 4X66M 1T43A 1JQJC 2G3QA 3H4MA 2QBYA 1HNWM 2LHGA 4FWHA 2CV1A 2VF7A 2F5OA 3A45A 4NXNM 4PD2A 3JR4A 2X8AA 3FRIA 2QPAA 1SXJB 3GQ5A 1N33M 5ITXE 3FTDA 1XC8A 1WPLA 4CJ6A 2Z7JA 4IIWA 1ZQ9A 4LF9M 1IN7A 2HHHM 4B3MM 5FTJA 4NTMA 8CATA 5ITTA 5LMUM 2QNJA 3UK6A 4JI3M 3Q8XA 1N34M 1MU5A 5FSWA 3KP0E 4AW4A 4IJEA 1OAOC 3B7QA 1SXJE 2CP8A 4M0DA 1F4IA 1G71A 1R6BX 2OO9A 5DMZA 2CRUA 2DAIA 5KPTA 1YSYA 3KS8A 4LZZA 3SHFA 3GQ4A 3SARA 2FH0A 3B74A 2KR1A 3VFDA 3B89A 1PJSA 1R2ZA 1DGGA 5IT9S 1DO2A 4LGYA 4LFCM 2CHQA 3IG8A 3GLHE 4OX9M 4M9ZA 5EXPA 4FWDA 2D7HA 3KDSE 4ANRA 3QWLA 1OJLA 1HJPA 3LX3A 1YE9A 1IY2A 4FVGA 1NNJA 2CWBA 5BPVA 4JI2M 3GLGE 1NNUC 2XZUA 5F3WA 3ZH9B 4IBJA 4QNRA 3E9SA 4QPMA 2LWXA 4GITA 4LJ7A 4Q7JA 1WXQA 2JA2A 2DHYA 4L16A 1JR3E 2DTTA 3D7JA 2DAEA 3NWLA 2R4JA 5EXSA 4KO8A 3TPZA 2R18A 4IBIA 2WSFF 3T38A 1R4GA 2DWLA 3FTCA 2MH8A 2HKJA 4BBAA 2JNHA 3L2AA 1TFEA 4DRBJ 2XSZA 2G5GX 1XHBA 1YLAA 3FKEA 4KODA 2EKKA 1QUTA 2L09A 3C9PA 3U61A 2CV2A 1QDTA 4PDGA 1S3SA 4IBFA 1XWIA 2DI0A 2XFTA 4OU7A 3GPUA 1IQPA 1QYRA 3F92A 2MGWA 3Q8GA 4GIPA 4WURA 4GHLA 1D0KA 3LVWA 4RKUF 2YFQA 5C1BA 4M0WA 2N35A 1OFIA 2LBCA 2BJWA 3C3EA 4CISA 4CGYB 3U6SA 4RF0A 3CGWA 3AKZA 1OAIA 3HHWA 4UN2B 3SYKA 2ZAMA 3AOEC 2QENA 2C96A 4DBGB 4MB7A 1SXJD 5C18A 1ZMWA 1TH2A 1WHCA 2Z8YM 3HJQA 4RF1A 2VDBB 2UUBM 1NV9A 1QAQA 3BBZA 3DOAA 3FYCA 1HR0M 1HQYE 1PJQA 4GRIA 1IBKM 3CF6E 4LY6A 4NE3B 4FD2A 4I4LA 3I01M 3THGA 2VQEM 4ITQA 4DR6M 4DV4M 2RGOA 2V6ZM 3SASA 2WSCG 1NVMA 4JN6A 2CEAA 2XFSA 2KHHA 3HY5A 3VEJA 1YUBA 1EL6A 2DZLA 4R8QA 3HX3A 1IN5A 1N3RA 2JZ0A 2WSEG 2WZJA 2DVWB 1GO5A 2JXNA 2XLJA 3FYDA 3J80S 2M60A 4LRTA 3A42A 2PN0A 2QSFX 2LVOC 4QOSA 4IJFA 5JI2E 5GKNA 2L2DA 1AIPC 1GTQA 4LF8M 1HT1E 2ZANA 4GC5A 1OIZA 3J81S 3KOZE 4LGMA 2J7NA 4MGKE 3HGIA 1WUQA 1RU3A 2ERCA 3D8BA 4G4OA 1IS7A 4LJ4A 1ORYB 2Z4RA 3KOWE 3FD9A 4JI7M 3U61B 1LV7A 5DNYA 3L26A 1FBXA 2ZAOA 3SHGB 3AV0A 4RNAA 3E46A 4LF4M 4FW9A 3BOSA 2Z3XA 4M9XA 1N32M 3ILKA 2LVNC 2OBAA 3LCVB 2KRKA 3SFZA 1JR3D 2APLA 3K9PA 3W68A 5JI3E 1P3QQ 2WSCF 1GL7A 1Q3CA 2KW0A 2O5RA 2X49A 3CF2A 3I51A 4AZFA 5KPRA 1L2DA 4MGIE 1CUKA 3U6PA 1DGFA 2KZSA 1KSFX 4R71A 2UXDM 4FVMA 1WINA 4FVJA 4DR7M 2L4FA 4IBEA 3KP1E 1ZV1A 4IBBA 3VDUA 1PJJA 2D7GA 5DYIA 3NBXX 4B3RM 4AI6A 1WJ7A 2OQ4A 2CUZA 1PJTA 2DAMA 1NJFA 4HEOA 3HHZA 4DV1M 3U6QA 4TUWA 3BK6A 2BJVA 3KS4A 1IN6A 1E9RA 2KEBA 1IY0A 3GRYA 4NRWA 1R2YA 1NV8A 3TL4X 2K0BX 5IREB 1LTMA 2MR9A 4II7A 1GLNA 1EE8A 2P5TA 1XNQM 3VKGA 1NJGA 4X62M 2DZOB 3KXEC 3LW5G 4FWGA 2LVPC 3GPYA 4GMQA 1L2CA 3J7AS 3LZEA 2V1CA 2XSZD 3H4JA 3W0LB 1VEKA 4LZJA
chains in the Genus database with same CATH topology
3IECA 4WP2A 1ZMUA 1MN3A 1R4GA 1A8RA 1QZEA 2QHOB 3MMPA 2JNHA 4DRBJ 3BMBA 3GLFE 1YLAA 3B0BC 1GTPA 1WIVA 2EKKA 1EFUB 2HAKA 2DI0A 3IHPA 2H5XA 5DFLA 2KNAA 3F92A 2MGWA 2LTUA 1WGLA 1WGNA 1OKSA 2EJSA 2LBCA 1DV0A 1OAIA 4GEWA 1VEJA 4UN2B 4F1IA 1FB1A 2KNVA 4DBGB 2HWJA 2KNZA 1ZMWA 1A5TA 1WHCA 2JY6B 2RRUA 2ZTCA 1N3RA 1TR8A 1NV9A 3BBZA 4NE3B 2LVAA 1HQYE 1N3TA 2LO0A 2DAKA 2MROB 4NE5B 2JZ1A 1WURA 3GLIE 4E45B 1V92A 2MJ5B 1KYIA 4DRAE 1G41A 1Y8GA 2DAGA 2KHHA 2R0IA 4JA3A 3VEJA 1EL6A 1HT2E 2BWEA 2DZLA 1G4AE 3K9OA 4G3OA 2LNZA 4R8QA 1BVSA 2JZ0A 2DENA 1G3IA 1OTRA 2WZJA 1GO5A 1T43A 2G3QA 1XB2B 2QSFX 2PN0A 2LVOC 5JI2E 1VG5A 2JUJA 2L2DA 1AIPC 1HT1E 2O25A 3FRIA 1WPLA 1WUQA 2JP7A 2ZTDA 1IS7A 2K9DA 4NE6B 1SG9A 2QNJA 1OQYA 1WM9A 2LVQD 1A9CA 4E44B 2EKFA 1FBXA 2DNAA 1Q02A 3E46A 2L4EA 3T6PA 3FRHA 1TTEA 2P11A 1VDLA 2CP8A 2LVNC 1F4IA 1VQ1A 3LCVB 2OO9A 4F2LA 3K9PA 5DMZA 2DAIA 1P3QQ 1PGYA 1XXHE 1E94E 2KR1A 3FE3A 1WR1B 1CUKA 3B89A 2OOBA 1IM2A 4R71A 2L4FA 2B3TA 1N3SA 1DO2A 1ZV1A 2DKLA 1WJ7A 3GLHE 2DAMA 1HJPA 2JY7A 1T6OA 1VEGA 1IXSA 4HEOA 2JY8A 2JY5A 1ZMVA 2CWBA 3GLGE 1NV8A 2K0BX 1C7YA 1TFEA 2MR9A 2OOAA 4QPMA 4Q7JA 1UFZA 1IS8A 2DHYA 1DO0A 2LVPC 1JR3E 3E21A 2BWBA 1IFYA 3LCUA 2DAEA 4DU6A 3H4JA 1VEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEC A;  4WP2 A;  1ZMU A;  1MN3 A;  1R4G A;  1QZE A;  2QHO B;  3MMP A;  2JNH A;  3BMB A;  3GLF E;  1YLA A;  1WIV A;  2EKK A;  1EFU B;  2HAK A;  2DI0 A;  3IHP A;  2H5X A;  5DFL A;  2KNA A;  3F92 A;  2MGW A;  2LTU A;  1WGL A;  1WGN A;  1OKS A;  2EJS A;  2LBC A;  1DV0 A;  1OAI A;  4GEW A;  1VEJ A;  4UN2 B;  4F1I A;  2KNV A;  4DBG B;  2HWJ A;  2KNZ A;  1ZMW A;  1A5T A;  1WHC A;  2JY6 B;  2RRU A;  2ZTC A;  1TR8 A;  1NV9 A;  3BBZ A;  2LVA A;  1HQY E;  2DAK A;  2MRO B;  2JZ1 A;  3GLI E;  1V92 A;  2MJ5 B;  1KYI A;  1G41 A;  1Y8G A;  2DAG A;  2KHH A;  2R0I A;  1HT2 E;  2BWE A;  2DZL A;  1G4A E;  3K9O A;  4G3O A;  1BVS A;  2JZ0 A;  2DEN A;  1G3I A;  1OTR A;  2WZJ A;  1GO5 A;  1T43 A;  2G3Q A;  1XB2 B;  2QSF X;  2PN0 A;  2LVO C;  5JI2 E;  1VG5 A;  2JUJ A;  2L2D A;  1AIP C;  1HT1 E;  2O25 A;  3FRI A;  2JP7 A;  2ZTD A;  2K9D A;  1SG9 A;  2QNJ A;  1OQY A;  2LVQ D;  2EKF A;  2DNA A;  1Q02 A;  3E46 A;  2L4E A;  3T6P A;  3FRH A;  1TTE A;  1VDL A;  2CP8 A;  2LVN C;  1F4I A;  1VQ1 A;  3LCV B;  2OO9 A;  4F2L A;  3K9P A;  2DAI A;  1P3Q Q;  1PGY A;  1XXH E;  1E94 E;  3FE3 A;  1WR1 B;  1CUK A;  3B89 A;  2OOB A;  1IM2 A;  4R71 A;  2L4F A;  2B3T A;  1DO2 A;  1ZV1 A;  2DKL A;  1WJ7 A;  3GLH E;  2DAM A;  1HJP A;  2JY7 A;  1T6O A;  1VEG A;  1IXS A;  4HEO A;  2JY8 A;  2JY5 A;  1ZMV A;  2CWB A;  3GLG E;  1NV8 A;  2K0B X;  1C7Y A;  1TFE A;  2MR9 A;  2OOA A;  4Q7J A;  1UFZ A;  2DHY A;  1DO0 A;  2LVP C;  1JR3 E;  3E21 A;  2BWB A;  1IFY A;  3LCU A;  2DAE A;  3H4J A;  1VEK A; 
#chains in the Genus database with same CATH topology
 4AKG A;  1ZMU A;  1MN3 A;  4P16 A;  3AOG A;  4DR1 M;  1QZE A;  2RPB A;  4NRV A;  4FCT A;  2A5Y B;  4JXJ A;  5LMN M;  2LXE A;  4LJ6 A;  4LJ5 A;  3B0B C;  3KFU G;  2DZN B;  3UMM A;  4Y28 F;  1SXJ C;  1Z59 A;  3D8L A;  4XGI A;  3SBJ A;  4LFA M;  3VK7 A;  3KOX E;  2C99 A;  4LF6 M;  1GAB A;  1NHG C;  2H5X A;  2YR0 A;  3HWS A;  4GC9 A;  1NY5 A;  1K3X A;  4L8R C;  2R4E A;  5H37 D;  2VII A;  2O01 F;  1QVR A;  2L7I A;  1QZM A;  1WGL A;  1SXJ A;  4NTN A;  1IXR C;  4R3D A;  4YY3 M;  4X64 M;  2WSF K;  1JR3 A;  3T15 A;  2KNV A;  2DWN A;  2KNZ A;  1K82 A;  5IZ7 D;  3B7Z A;  3LQR A;  5ITQ A;  3VK8 A;  2QBY B;  1XNR M;  2G64 A;  2XF3 A;  2CV0 A;  1I94 M;  1B6Z A;  2DWZ B;  4DV7 M;  1IY1 A;  4L15 A;  1WUR A;  3GLI E;  1E9S A;  2WSE K;  4NTK A;  2MJ5 B;  3GLI A;  2Y20 A;  4GH9 A;  3TE6 A;  4DRA E;  2C5R A;  4R7G A;  2FOI C;  2ZBK B;  5DYG A;  1MX0 A;  4G3O A;  3HJS A;  2WSC K;  1J7K A;  2H1R A;  3V76 A;  4FCV A;  3ZC7 B;  3U5Z B;  1QDR A;  3MHV C;  1XB2 B;  3GLH A;  3TWM A;  3LMM A;  2JUJ A;  1XXH A;  3K8Z A;  2Y21 A;  1Z5B A;  2O25 A;  4MM3 B;  4CIZ A;  5EQT A;  4A3V B;  3KSJ A;  2E5L M;  1EIJ A;  3I04 M;  1HQC A;  2FNA A;  2WSF G;  3HU2 A;  5E6J A;  3RGS A;  4MGH A;  2ZTD A;  2XEP A;  4LJ8 A;  2K9D A;  2C9O A;  3SC3 A;  2XGN A;  5KO3 A;  4NE6 B;  4B08 A;  4GHA A;  4K0K M;  1OQY A;  1Q3B A;  1WM9 A;  2LVQ D;  2R44 A;  2I7P A;  2FE8 A;  4E44 B;  2EKF A;  5EXX A;  1T3T A;  1Q02 A;  2DNA A;  3BXW A;  4NSR A;  3VLF B;  2KA6 B;  2LH0 A;  2DXI A;  2L4E A;  4DR5 M;  4MGY E;  3T6P A;  1N36 M;  2G8L A;  4KLN A;  2OPF A;  1VDL A;  3C58 A;  1FNN A;  3AOE A;  2F5N A;  3RFW A;  4I5S A;  1NHW C;  4F2L A;  3PVS A;  4HL4 A;  4AKH A;  1PGY A;  3U60 B;  3I4Y A;  3UGJ A;  1E94 E;  1B66 A;  4NXM M;  2R45 A;  2GNO A;  3GQ3 A;  1IN4 A;  3WHL A;  4KT0 F;  1Q39 A;  4S12 A;  4DV0 M;  2UUC M;  1GVN A;  3L28 A;  1N3S A;  3L29 A;  3IG5 A;  1NSF A;  4QHS A;  5FTM A;  2C98 A;  3TWL A;  4DR3 M;  3U6E A;  1TH4 A;  1IXS B;  2DKL A;  2ZM6 M;  3SMP A;  1OIP A;  1L1Z A;  1MJG M;  4L78 A;  2LNH C;  3SYL A;  1T6O A;  1VEG A;  2FFJ A;  2Y0T A;  5KQ8 A;  2JY8 A;  2JY5 A;  4Z8X A;  3SAU A;  4OW0 A;  1C7Y A;  3OTO M;  3GLF A;  3J2P B;  1PM5 A;  2W82 A;  3T1Y M;  3B9P A;  3EIE A;  4FCW A;  1AUA A;  1DO0 A;  1GJT A;  4G4Q A;  3E21 A;  1QUS A;  4JI4 M;  3SAW A;  4BLC A;  3E4R A;  1IFY A;  2R46 A;  3NBI A;  4JV5 M;  5E26 A;  5A2Q S;  4DUZ M;  4XBO A;  3IEC A;  4WP2 A;  3FUW A;  3QYB A;  4EIW A;  1QAN A;  3FUU A;  5FTN A;  3GLG B;  4W5W A;  1GKI A;  1DGH B;  2JWS A;  2Q2E B;  5EP1 A;  4YHH M;  1IBM M;  4PCZ A;  4NL4 H;  3LW5 F;  4B7G A;  1EFU B;  1FJG M;  3SMS A;  2NQ8 C;  2WSE F;  1VDD A;  5DFL A;  2KNA A;  2F5S A;  1ZAE A;  3JR5 A;  3M0E A;  4LCB A;  1G59 A;  2M5Z A;  3GP1 A;  2EJS A;  4X65 M;  1GJS A;  3GRV A;  2A0S A;  4JI1 M;  1QAO A;  2D7E A;  2L7H A;  4I81 A;  4F1I A;  4GKK M;  2HCB A;  2HL7 A;  2DWM A;  3JYG A;  1X37 A;  2CE7 A;  5EJC A;  1A5T A;  2JY6 B;  4AG6 A;  2RRU A;  3LQQ A;  4CHT B;  2EA0 A;  4LFB M;  5ITY A;  5KQD A;  1TR8 A;  3GO8 A;  4DV5 M;  4JI6 M;  3AL0 C;  1D2N A;  2LVA A;  2CFO A;  4OVZ B;  1K3W A;  1N3T A;  2MRO B;  4G4R A;  4L6V 6;  2LO0 A;  4NE5 B;  7CAT A;  3QAU A;  2KXE A;  5FTK A;  3FUV A;  2C9C A;  2YQZ A;  2VF8 A;  3HHY A;  4JI8 M;  3CTW B;  1G41 A;  1QQW A;  2DAG A;  2R0I A;  3W0F A;  4P17 A;  3JAM S;  3SAV A;  4G4N A;  1HNZ M;  4FVF A;  1HT2 E;  4LJA A;  2CHG A;  5ITX A;  3U6M A;  1G4A E;  2R65 A;  2LNZ A;  1BVS A;  4OVZ A;  2XH9 A;  4LRS A;  2LHC A;  1G3I A;  2K6B A;  3A98 B;  1L8Q A;  3KW6 A;  4HLQ A;  4JI0 M;  4PT5 A;  2J7O A;  3T1H M;  5L8R F;  2Z4S A;  2QP9 X;  3M6A A;  1TDZ A;  3U6D A;  1VG5 A;  2L6O A;  5KPZ A;  1V34 A;  2RGH A;  1N78 A;  2X4A A;  3U6O A;  3HZJ A;  4PDI A;  2UXC M;  1TH3 A;  5EP3 A;  3KSX A;  1TF0 B;  2JP7 A;  5EP4 A;  1C1K A;  4AG5 A;  3U6C A;  4DUY M;  1DGB A;  4GKJ M;  3MJ5 A;  1IXZ A;  1SG9 A;  4MGZ E;  1PJI A;  3EIH A;  3HU3 A;  4DV6 M;  3HU1 A;  1UM8 A;  2EO2 A;  4I8O A;  4LJ9 A;  4B3S M;  1A9C A;  2V1U A;  1D0M A;  3VDP A;  3C3D A;  1NY6 A;  1IBL M;  1DGH A;  2R6F A;  3K2L A;  3PNY A;  4IBC A;  4IBG A;  3GLG A;  3FRH A;  1TTE A;  4DR4 M;  2P11 A;  3J27 B;  4AKI A;  3FTE A;  2O01 G;  3DFZ A;  1VQ1 A;  2RKO A;  3FTF A;  3GRR A;  3GRU A;  1L1T A;  2CHV A;  1XXH E;  1G8P A;  3VKH A;  1PRB A;  2BNK A;  1R5L A;  5FLX S;  3FE3 A;  1WR1 B;  3HJ8 A;  4QHT A;  3WHK A;  3GLF B;  4B7H A;  2J5Y A;  4ZPX A;  2OOB A;  1IM2 A;  3QYE A;  4NOO B;  4DV3 M;  2B3T A;  3UJN A;  2QCU A;  4G6Z A;  3A46 A;  4AQY M;  1I4W A;  4D82 A;  3SAT A;  4DV2 M;  1Z6T A;  2KDL A;  3CF0 A;  4MH0 E;  5IWA M;  1V33 A;  2JY7 A;  3DA1 A;  2UUA M;  1IXS A;  2KRU A;  4LF5 M;  2K47 A;  1ZMV A;  4D81 A;  3MK6 A;  4Z6Y A;  1N75 A;  3PFI A;  4LF7 M;  3R9X B;  3LW5 K;  5EXT A;  2OOA A;  2DHR A;  3U6L A;  1TGU A;  4M9S A;  3KOY E;  4NSO B;  1UFZ A;  1IS8 A;  2QQ8 A;  4WW0 A;  3ZCB B;  3HHX A;  3U60 A;  4DU6 A;  2BWB A;  3QN0 A;  3LCU A;  2XZF A;  4B3T M;  1H6U A;  3RGP A;  3KVW A;  3L25 A;  1QAM A;  4XK8 F;  5BR8 M;  3ZQJ A;  1A8R A;  1L2B A;  2QHO B;  3B7N A;  3MMP A;  2EUC A;  4D80 A;  3QN9 A;  1E32 A;  4REZ A;  3BMB A;  1W5T A;  2F5Q A;  2AHM A;  3GLF E;  3AFH A;  2VQF M;  5EP2 A;  3L27 A;  1WIV A;  1HNX M;  1GTP A;  3TQS A;  2F4V M;  1GL6 A;  3GPP A;  2HAK A;  3AJI B;  3DZD A;  3HKP A;  3IHP A;  4B7F A;  1XMQ M;  4L4U A;  5ITU A;  3FUX A;  2LTU A;  3TWK A;  1N77 A;  1W5S A;  1WGN A;  3M7G A;  1OKS A;  5ITR A;  3UZU A;  3QNA A;  1DV0 A;  4BB9 A;  4GEW A;  3RE8 A;  1VEJ A;  1XXH B;  1D0L A;  4JI5 M;  1IN8 A;  1OFH A;  3FUT A;  2UU9 M;  3GLH B;  4JYA M;  1FB1 A;  1TDH A;  2HWJ A;  1J09 A;  2I7N A;  3K92 A;  1XMO M;  2YNM D;  2ZTC A;  2UXB M;  3U5Z A;  2KZU A;  5FTL A;  1Y13 A;  1KFV A;  2GQF A;  3I2B A;  2FS1 A;  3PNV A;  2DAK A;  2F5P A;  3I4V A;  2JZ1 A;  3R8F A;  3J7B A;  4NC6 A;  3PXG A;  1R7R A;  4E45 B;  1V92 A;  1Z5A A;  3LVV A;  1KYI A;  3K1J A;  4DR2 M;  4KHP M;  1Y8G A;  3GLI B;  1NO1 A;  4IBD A;  4JA3 A;  1JB0 F;  2Y0Q A;  4LG2 A;  3M0N A;  2BWE A;  4QOZ C;  3GPX A;  1Z5C A;  2R62 A;  3K9O A;  1J5E M;  2QZ4 A;  4IBK A;  3W67 A;  4QNM A;  2DEN A;  2DJ6 A;  1OTR A;  4X66 M;  1T43 A;  1JQJ C;  2G3Q A;  3H4M A;  2QBY A;  1HNW M;  2LHG A;  4FWH A;  2CV1 A;  2VF7 A;  2F5O A;  3A45 A;  4NXN M;  4PD2 A;  3JR4 A;  2X8A A;  3FRI A;  2QPA A;  1SXJ B;  3GQ5 A;  1N33 M;  5ITX E;  3FTD A;  1XC8 A;  1WPL A;  4CJ6 A;  2Z7J A;  4IIW A;  1ZQ9 A;  4LF9 M;  1IN7 A;  2HHH M;  4B3M M;  5FTJ A;  4NTM A;  8CAT A;  5ITT A;  5LMU M;  2QNJ A;  3UK6 A;  4JI3 M;  3Q8X A;  1N34 M;  1MU5 A;  5FSW A;  3KP0 E;  4AW4 A;  4IJE A;  1OAO C;  3B7Q A;  1SXJ E;  2CP8 A;  4M0D A;  1F4I A;  1G71 A;  1R6B X;  2OO9 A;  5DMZ A;  2CRU A;  2DAI A;  5KPT A;  1YSY A;  3KS8 A;  4LZZ A;  3SHF A;  3GQ4 A;  3SAR A;  2FH0 A;  3B74 A;  2KR1 A;  3VFD A;  3B89 A;  1PJS A;  1R2Z A;  1DGG A;  5IT9 S;  1DO2 A;  4LGY A;  4LFC M;  2CHQ A;  3IG8 A;  3GLH E;  4OX9 M;  4M9Z A;  5EXP A;  4FWD A;  2D7H A;  3KDS E;  4ANR A;  3QWL A;  1OJL A;  1HJP A;  3LX3 A;  1YE9 A;  1IY2 A;  4FVG A;  1NNJ A;  2CWB A;  5BPV A;  4JI2 M;  3GLG E;  1NNU C;  2XZU A;  5F3W A;  3ZH9 B;  4IBJ A;  4QNR A;  3E9S A;  4QPM A;  2LWX A;  4GIT A;  4LJ7 A;  4Q7J A;  1WXQ A;  2JA2 A;  2DHY A;  4L16 A;  1JR3 E;  2DTT A;  3D7J A;  2DAE A;  3NWL A;  2R4J A;  5EXS A;  4KO8 A;  3TPZ A;  2R18 A;  4IBI A;  2WSF F;  3T38 A;  1R4G A;  2DWL A;  3FTC A;  2MH8 A;  2HKJ A;  4BBA A;  2JNH A;  3L2A A;  1TFE A;  4DRB J;  2XSZ A;  2G5G X;  1XHB A;  1YLA A;  3FKE A;  4KOD A;  2EKK A;  1QUT A;  2L09 A;  3C9P A;  3U61 A;  2CV2 A;  1QDT A;  4PDG A;  1S3S A;  4IBF A;  1XWI A;  2DI0 A;  2XFT A;  4OU7 A;  3GPU A;  1IQP A;  1QYR A;  3F92 A;  2MGW A;  3Q8G A;  4GIP A;  4WUR A;  4GHL A;  1D0K A;  3LVW A;  4RKU F;  2YFQ A;  5C1B A;  4M0W A;  2N35 A;  1OFI A;  2LBC A;  2BJW A;  3C3E A;  4CIS A;  4CGY B;  3U6S A;  4RF0 A;  3CGW A;  3AKZ A;  1OAI A;  3HHW A;  4UN2 B;  3SYK A;  2ZAM A;  3AOE C;  2QEN A;  2C96 A;  4DBG B;  4MB7 A;  1SXJ D;  5C18 A;  1ZMW A;  1TH2 A;  1WHC A;  2Z8Y M;  3HJQ A;  4RF1 A;  2VDB B;  2UUB M;  1NV9 A;  1QAQ A;  3BBZ A;  3DOA A;  3FYC A;  1HR0 M;  1HQY E;  1PJQ A;  4GRI A;  1IBK M;  3CF6 E;  4LY6 A;  4NE3 B;  4FD2 A;  4I4L A;  3I01 M;  3THG A;  2VQE M;  4ITQ A;  4DR6 M;  4DV4 M;  2RGO A;  2V6Z M;  3SAS A;  2WSC G;  1NVM A;  4JN6 A;  2CEA A;  2XFS A;  2KHH A;  3HY5 A;  3VEJ A;  1YUB A;  1EL6 A;  2DZL A;  4R8Q A;  3HX3 A;  1IN5 A;  1N3R A;  2JZ0 A;  2WSE G;  2WZJ A;  2DVW B;  1GO5 A;  2JXN A;  2XLJ A;  3FYD A;  3J80 S;  2M60 A;  4LRT A;  3A42 A;  2PN0 A;  2QSF X;  2LVO C;  4QOS A;  4IJF A;  5JI2 E;  5GKN A;  2L2D A;  1AIP C;  1GTQ A;  4LF8 M;  1HT1 E;  2ZAN A;  4GC5 A;  1OIZ A;  3J81 S;  3KOZ E;  4LGM A;  2J7N A;  4MGK E;  3HGI A;  1WUQ A;  1RU3 A;  2ERC A;  3D8B A;  4G4O A;  1IS7 A;  4LJ4 A;  1ORY B;  2Z4R A;  3KOW E;  3FD9 A;  4JI7 M;  3U61 B;  1LV7 A;  5DNY A;  3L26 A;  1FBX A;  2ZAO A;  3SHG B;  3AV0 A;  4RNA A;  3E46 A;  4LF4 M;  4FW9 A;  3BOS A;  2Z3X A;  4M9X A;  1N32 M;  3ILK A;  2LVN C;  2OBA A;  3LCV B;  2KRK A;  3SFZ A;  1JR3 D;  2APL A;  3K9P A;  3W68 A;  5JI3 E;  1P3Q Q;  2WSC F;  1GL7 A;  1Q3C A;  2KW0 A;  2O5R A;  2X49 A;  3CF2 A;  3I51 A;  4AZF A;  5KPR A;  1L2D A;  4MGI E;  1CUK A;  3U6P A;  1DGF A;  2KZS A;  1KSF X;  4R71 A;  2UXD M;  4FVM A;  1WIN A;  4FVJ A;  4DR7 M;  2L4F A;  4IBE A;  3KP1 E;  1ZV1 A;  4IBB A;  3VDU A;  1PJJ A;  2D7G A;  5DYI A;  3NBX X;  4B3R M;  4AI6 A;  1WJ7 A;  2OQ4 A;  2CUZ A;  1PJT A;  2DAM A;  1NJF A;  4HEO A;  3HHZ A;  4DV1 M;  3U6Q A;  4TUW A;  3BK6 A;  2BJV A;  3KS4 A;  1IN6 A;  1E9R A;  2KEB A;  1IY0 A;  3GRY A;  4NRW A;  1R2Y A;  1NV8 A;  3TL4 X;  2K0B X;  5IRE B;  1LTM A;  2MR9 A;  4II7 A;  1GLN A;  1EE8 A;  2P5T A;  1XNQ M;  3VKG A;  1NJG A;  4X62 M;  2DZO B;  3KXE C;  3LW5 G;  4FWG A;  2LVP C;  3GPY A;  4GMQ A;  1L2C A;  3J7A S;  3LZE A;  2V1C A;  2XSZ D;  3H4J A;  3W0L B;  1VEK A;  4LZJ A; 
#chains in the Genus database with same CATH homology
 3IEC A;  4WP2 A;  1ZMU A;  1MN3 A;  1R4G A;  1A8R A;  1QZE A;  2QHO B;  3MMP A;  2JNH A;  4DRB J;  3BMB A;  3GLF E;  1YLA A;  3B0B C;  1GTP A;  1WIV A;  2EKK A;  1EFU B;  2HAK A;  2DI0 A;  3IHP A;  2H5X A;  5DFL A;  2KNA A;  3F92 A;  2MGW A;  2LTU A;  1WGL A;  1WGN A;  1OKS A;  2EJS A;  2LBC A;  1DV0 A;  1OAI A;  4GEW A;  1VEJ A;  4UN2 B;  4F1I A;  1FB1 A;  2KNV A;  4DBG B;  2HWJ A;  2KNZ A;  1ZMW A;  1A5T A;  1WHC A;  2JY6 B;  2RRU A;  2ZTC A;  1N3R A;  1TR8 A;  1NV9 A;  3BBZ A;  4NE3 B;  2LVA A;  1HQY E;  1N3T A;  2LO0 A;  2DAK A;  2MRO B;  4NE5 B;  2JZ1 A;  1WUR A;  3GLI E;  4E45 B;  1V92 A;  2MJ5 B;  1KYI A;  4DRA E;  1G41 A;  1Y8G A;  2DAG A;  2KHH A;  2R0I A;  4JA3 A;  3VEJ A;  1EL6 A;  1HT2 E;  2BWE A;  2DZL A;  1G4A E;  3K9O A;  4G3O A;  2LNZ A;  4R8Q A;  1BVS A;  2JZ0 A;  2DEN A;  1G3I A;  1OTR A;  2WZJ A;  1GO5 A;  1T43 A;  2G3Q A;  1XB2 B;  2QSF X;  2PN0 A;  2LVO C;  5JI2 E;  1VG5 A;  2JUJ A;  2L2D A;  1AIP C;  1HT1 E;  2O25 A;  3FRI A;  1WPL A;  1WUQ A;  2JP7 A;  2ZTD A;  1IS7 A;  2K9D A;  4NE6 B;  1SG9 A;  2QNJ A;  1OQY A;  1WM9 A;  2LVQ D;  1A9C A;  4E44 B;  2EKF A;  1FBX A;  2DNA A;  1Q02 A;  3E46 A;  2L4E A;  3T6P A;  3FRH A;  1TTE A;  2P11 A;  1VDL A;  2CP8 A;  2LVN C;  1F4I A;  1VQ1 A;  3LCV B;  2OO9 A;  4F2L A;  3K9P A;  5DMZ A;  2DAI A;  1P3Q Q;  1PGY A;  1XXH E;  1E94 E;  2KR1 A;  3FE3 A;  1WR1 B;  1CUK A;  3B89 A;  2OOB A;  1IM2 A;  4R71 A;  2L4F A;  2B3T A;  1N3S A;  1DO2 A;  1ZV1 A;  2DKL A;  1WJ7 A;  3GLH E;  2DAM A;  1HJP A;  2JY7 A;  1T6O A;  1VEG A;  1IXS A;  4HEO A;  2JY8 A;  2JY5 A;  1ZMV A;  2CWB A;  3GLG E;  1NV8 A;  2K0B X;  1C7Y A;  1TFE A;  2MR9 A;  2OOA A;  4QPM A;  4Q7J A;  1UFZ A;  1IS8 A;  2DHY A;  1DO0 A;  2LVP C;  1JR3 E;  3E21 A;  2BWB A;  1IFY A;  3LCU A;  2DAE A;  4DU6 A;  3H4J A;  1VEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...