4Q7JA

Complex structure of viral rna polymerase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
TASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor Ts
publication title Molecular insights into replication initiation by Q beta replicase using ribosomal protein S1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation/transferase
total genus 78
structure length 278
sequence length 278
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4q7jA01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4q7jA04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA03
2ZTDA 1E94E 2ZTCA 2K9DA 2LTUA 2MGWA 2L4FA 2BWEA 2G3QA 2MJ5B 2QHOB 1F4IA 4GEWA 2LVOC 3FRHA 1Y8GA 3GLFE 1PGYA 2KNZA 1WIVA 4Q7JA 3LCUA 1OTRA 1IFYA 3K9OA 1XXHE 2JZ1A 2B3TA 1IM2A 2WZJA 4HEOA 1MN3A 2HAKA 1G4AE 2EKKA 2DAEA 1TR8A 1WJ7A 2JP7A 1DO0A 2JY7A 1WGLA 2DHYA 1T6OA 3BMBA 2DAGA 1KYIA 2CP8A 3BBZA 2OO9A 1NV8A 1WR1B 1OQYA 2DAMA 1AIPC 2O25A 1C7YA 2MR9A 1ZMUA 1DO2A 1NV9A 2LBCA 3LCVB 1ZMWA 1HT1E 2CWBA 2HWJA 2LVPC 1EFUB 1CUKA 1WGNA 3K9PA 2LVAA 1VDLA 2PN0A 2DZLA 2LVNC 2RRUA 3FE3A 1A5TA 2KNVA 2DKLA 1VEKA 2DI0A 3B89A 4WP2A 1TFEA 2JZ0A 1R4GA 3F92A 1WHCA 2L2DA 1T43A 3H4JA 4F2LA 2QSFX 5JI2E 1Q02A 4DBGB 1YLAA 1HQYE 2MROB 2KHHA 1VEGA 2DAKA 2KNAA 2JUJA 5DFLA 1TTEA 1UFZA 2EKFA 4G3OA 2DNAA 1V92A 2OOBA 1IXSA 3E21A 1G3IA 1JR3E 2BWBA 3GLHE 2OOAA 2DENA 4UN2B 2LVQD 4F1IA 3E46A 2L4EA 1VG5A 1HT2E 1QZEA 1OAIA 2QNJA 2DAIA 3GLGE 2K0BX 1XB2B 1GO5A 2H5XA 2JY5A 3MMPA 1VEJA 1HJPA 3GLIE 3FRIA 1SG9A 2R0IA 1BVSA 3T6PA 1P3QQ 2JNHA 3IECA 4R71A 2JY6B 1OKSA 1G41A 1ZV1A 2JY8A 1DV0A 3IHPA 1ZMVA 2EJSA 1VQ1A
chains in the Genus database with same CATH superfamily
4MM3B 3HU2A 4RF0A 4QNMA 5EXTA 2Y0QA 2JWSA 2MGWA 1L1ZA 2BWEA 2G3QA 1F4IA 2QHOB 4JV5M 3U6CA 2XEPA 1QAQA 3HX3A 3L2AA 1Y8GA 3J27B 5EQTA 1FJGM 1WIVA 3U6LA 4IBGA 1GVNA 3FUWA 2JXNA 1N32M 3K9OA 3KFUG 2OQ4A 2CRUA 3U60A 2B3TA 1NNJA 1N34M 1R7RA 3JR5A 1LV7A 4L8RC 4BBAA 1N36M 2W82A 3A42A 3KOXE 3M7GA 4JI3M 1XMQM 1QAOA 1TR8A 1IXSB 1TH2A 1WJ7A 1T3TA 4G4RA 4DRAE 2JY7A 1WGLA 2WSEF 4MGZE 2DHYA 3BMBA 3PXGA 1QANA 2CP8A 2Z7JA 4LFBM 2KR1A 4IBFA 3U6PA 3B7ZA 2R45A 2DWZB 2I7NA 2LH0A 1D2NA 2OO9A 3FD9A 4B3SM 1NV8A 5IZ7D 3R9XB 1N3RA 3GPUA 1C7YA 3LQQA 5A2QS 2QQ8A 2RKOA 3HU3A 1HNWM 2LBCA 4LJ4A 2OBAA 3Q8GA 5KQDA 1QUSA 1TH4A 2D7EA 1ZMWA 2V1CA 4FCTA 4II7A 4NXNM 5ITXE 2LVPC 3B74A 2VF7A 3K9PA 3C3DA 2CHVA 5DNYA 3RGPA 3HGIA 4XGIA 4AZFA 4GKKM 1R2YA 2EO2A 2KNVA 3SASA 2XGNA 4GC5A 3TWLA 1D0LA 1XXHB 1J7KA 4DR2M 4WP2A 1TFEA 3FUVA 3HHZA 4KHPM 3F92A 3K1JA 2LO0A 1L2BA 2R46A 1QDRA 3TWMA 2KRUA 2O01F 4F2LA 3SAUA 2X8AA 3QYBA 3GLIA 3DOAA 4MH0E 4ITQA 2C96A 2I7PA 2KHHA 1VEGA 3L25A 1AUAA 3BK6A 1N78A 1KSFX 3T1HM 4RF1A 1N33M 1NHWC 1WUQA 2VQFM 1G8PA 1YUBA 1Z5AA 3E4RA 3VDUA 5ITUA 4X65M 5LMUM 3LX3A 3A45A 4NTNA 4FWHA 4NTKA 1XXHA 4NE6B 1R6BX 2DZNB 3C58A 2R4JA 5KO3A 3E46A 2Z8YM 3K2LA 2QNJA 3NBXX 4AKIA 2DAIA 3AOEC 3CTWB 3KSJA 4X64M 4LY6A 2DZOB 3A98B 3GLGE 3J80S 4RNAA 4D82A 4DV5M 1A9CA 2DTTA 4JI2M 3HJSA 4REZA 5DYGA 5EXSA 5KPRA 1OFIA 4B7GA 4LGMA 2WSFG 2G8LA 4OW0A 3SMSA 3U61B 4IBJA 2F4VM 1C1KA 3SBJA 2R0IA 3T6PA 3AV0A 4R71A 1G71A 2JNHA 1D0MA 3IECA 3KOWE 4B7FA 2DXIA 3SAVA 3VKGA 4M9ZA 3GLGB 1OKSA 4GKJM 2Y0TA 1G41A 4WW0A 1ZV1A 2J7NA 3V76A 3LVVA 3IG8A 1J5EM 1DV0A 3IHPA 5FTJA 3TPZA 3L26A 1Z5BA 2HKJA 2V1UA 3LW5F 4LF6M 4GHLA 1E94E 3ZC7B 3CF6E 3EIEA 4IBBA 4DR5M 4LZJA 2LTUA 4JI6M 2L4FA 2Q2EB 3W0FA 4DR7M 4KLNA 4P17A 3UJNA 4GEWA 3LW5K 2JA2A 4IBCA 4NRVA 3GLFE 4JI4M 1PGYA 1GTQA 3E9SA 2BJWA 3GLHB 5L8RF 4LJ9A 3B7QA 3FUXA 2WSCG 4NE3B 2YNMD 4AW4A 1MN3A 2R4EA 2VF8A 4CJ6A 5C18A 1QQWA 3U6QA 1I94M 1NO1A 2ZANA 4DV1M 1VDDA 4I4LA 2FNAA 3B9PA 2FFJA 5BPVA 2N35A 3OTOM 3GLFB 3SYLA 3GP1A 2JP7A 4R3DA 3UGJA 2DWLA 2DJ6A 4X66M 1N75A 4GH9A 4LGYA 2UUCM 4Z6YA 3B0BC 3KP1E 1DGBA 4PD2A 5EXPA 4B3RM 4QHTA 2QPAA 3SARA 4LRTA 3Q8XA 3I51A 1IBMM 1DGFA 4JI5M 4K0KM 2F5OA 3AL0C 1GL7A 4IIWA 1QZMA 5F3WA 1ZAEA 1NY6A 1K3WA 1N3TA 2ZAOA 3KDSE 1GL6A 5FLXS 1DO2A 4FVJA 1NJFA 2D7GA 4W5WA 3J7AS 1NV9A 1MU5A 4DV2M 4DV7M 2R65A 1SXJC 2LHGA 2CWBA 1HT1E 3CF0A 3LCVB 4KODA 3KS8A 5IT9S 4L6V6 1GABA 3I4YA 1WPLA 2DVWB 2XF3A 1VDLA 1L2CA 4I81A 3I01M 4KO8A 1NY5A 2UXCM 1IS7A 2PN0A 4FD2A 1TF0B 3FE3A 2QBYB 2YQZA 3CF2A 2XZUA 2DI0A 3CGWA 5KQ8A 2HHHM 3C9PA 1MJGM 2JZ0A 1R4GA 4AQYM 3KXEC 2XSZD 2A5YB 2MH8A 1OIPA 1XMOM 5EP4A 1PJIA 1GJTA 2LNZA 4I5SA 1W5SA 4DBGB 1HQCA 1ORYB 1HQYE 1B66A 3B7NA 1XHBA 2XH9A 2M60A 2DAKA 3H4MA 4QHSA 5EXXA 3T15A 4QPMA 2KZSA 2KNAA 3M0EA 1IQPA 5DFLA 3T1YM 4EIWA 3ZCBB 2HCBA 1IS8A 2EKFA 4G3OA 7CATA 4DRBJ 3FUTA 1QAMA 3ILKA 4LJ7A 4BB9A 3U6SA 1IXSA 2FE8A 2APLA 2CV2A 1JR3E 3TE6A 2OOAA 1IY0A 3HKPA 2LVQD 5FTLA 4MB7A 3HHWA 5E6JA 2QENA 2EUCA 4AI6A 3JAMS 3D7JA 5FTNA 2H1RA 4GRIA 3TQSA 1Y13A 1IY2A 1QZEA 1OAIA 1OIZA 1TGUA 1PM5A 3GO8A 5DYIA 2Z3XA 4CISA 1MX0A 4R7GA 2K0BX 4HLQA 1FB1A 1H6UA 2KRKA 2P5TA 4XK8F 3QN9A 3NWLA 1IN4A 2VQEM 1PJQA 3I2BA 3LMMA 3R8FA 3MMPA 3A46A 5KPTA 3L29A 4E45B 1WINA 1SXJE 2R18A 2Z4RA 1Z6TA 3MK6A 3FRIA 2C98A 4L16A 4OVZB 1EE8A 1SG9A 1BVSA 2GQFA 1P3QQ 3QYEA 3W0LB 3EIHA 1PJJA 3THGA 4GITA 2JY6B 3SHFA 4DV4M 4JN6A 2C5RA 4NOOB 1IXRC 3M6AA 4PCZA 3KSXA 5GKNA 3PNYA 5ITYA 1ZMVA 4LCBA 3RFWA 3SMPA 4MGKE 2C9CA 3W67A 1A8RA 2ZTDA 3AJIB 4IBEA 3VK7A 2XZFA 4GIPA 1SXJB 5ITXA 3M0NA 2K9DA 3QWLA 2MJ5B 1S3SA 5H37D 3GRUA 4L4UA 2A0SA 3WHKA 1NHGC 2AHMA 2LVOC 4FCWA 4NL4H 4LF7M 2J5YA 3U5ZB 2V6ZM 4Q7JA 4QNRA 3LCUA 1WM9A 2LWXA 1IFYA 4JYAM 4DUZM 1N3SA 4E44B 1NNUC 2YR0A 2Z4SA 3L28A 4HEOA 3U6DA 2KXEA 2L7HA 3MHVC 3SATA 1K3XA 2HAKA 1DGGA 4YHHM 1DGHB 1G4AE 4AG5A 2FH0A 2EKKA 2HL7A 4GHAA 2DAEA 1V34A 2UXDM 3JR4A 4IJFA 4PDIA 1DO0A 2Y21A 2CHGA 2L09A 8CATA 5IWAM 2BNKA 2GNOA 2VIIA 3FTCA 4FWDA 2CV1A 4JI7M 4LF8M 3VEJA 2LNHC 1TDHA 2DAGA 3GRRA 3GQ5A 1HR0M 3JYGA 4CGYB 4TUWA 1QVRA 1E32A 3BBZA 1XNQM 2OPFA 1XNRM 1HNZM 5FSWA 1PRBA 1WR1B 1OQYA 4L15A 2XFTA 1EIJA 4WURA 1B6ZA 3HJQA 2MR9A 1ZMUA 2RGHA 4FVGA 4AG6A 5DMZA 3U61A 3HJ8A 2F5SA 1GJSA 2QP9X 3U6OA 4JA3A 2HWJA 2M5ZA 4FCVA 5EJCA 3GLGA 4I8OA 4DR4M 1WGNA 1NJGA 1QDTA 4KT0F 2LVAA 1YE9A 2DZLA 2LVNC 2XFSA 3I4VA 3MJ5A 4LJ5A 2CUZA 2DKLA 1VEKA 3B89A 3SAWA 1YSYA 3HZJA 3HY5A 2C99A 4NXMM 3I04M 2K6BA 1HNXM 2WSEG 4DU6A 3FKEA 3AFHA 1IN8A 3H4JA 4LFAM 4QOSA 2WSFF 3GLHA 4BLCA 1OAOC 4D81A 4LG2A 2MROB 4NSRA 2R6FA 5LMNM 4JI1M 2CFOA 1OFHA 2XSZA 2JUJA 1LTMA 4FW9A 3VKHA 2WSFK 3PNVA 3U60B 3FTEA 3K8ZA 2L6OA 3HWSA 3GLFA 3HHXA 4B3TM 2E5LM 2P11A 4DR3M 3D8LA 1G3IA 2BWBA 3QN0A 2DENA 2RGOA 3GPYA 4UN2B 4XBOA 2CHQA 4LF5M 2L4EA 4LFCM 3KVWA 3AKZA 1TH3A 3DA1A 4DV3M 4G4NA 4DR1M 3U6EA 4GC9A 2G5GX 2FOIC 1IN5A 1I4WA 4L78A 4RKUF 4S12A 2UXBM 2H5XA 2WSCF 3PVSA 1IBKM 4Y28F 2J7OA 1QYRA 3RGSA 2JY5A 2O01G 1NVMA 2VDBB 4M0DA 5EP2A 4IJEA 4LZZA 5KPZA 5ITQA 3AOEA 2WSCK 5EP3A 3RE8A 1FBXA 3UK6A 3UZUA 1ZQ9A 4G4QA 2D7HA 2UUAM 3LZEA 2QBYA 1G59A 1Q3CA 3GRVA 4LJ6A 3GLIE 4R8QA 2O5RA 4PDGA 4ZPXA 1E9RA 4PT5A 2ZTCA 4M9XA 1GLNA 2ZM6M 4MGIE 4P16A 1L2DA 2F5QA 2WSEK 2G64A 1K82A 3W68A 1IY1A 2ZBKB 3FRHA 1W5TA 2ERCA 2KNZA 1IBLM 3C3EA 4DR6M 1OTRA 4LJ8A 3GLIB 2KZUA 1XXHE 3AOGA 1L8QA 2QCUA 2JZ1A 4FWGA 4CIZA 3PFIA 1IM2A 2WZJA 4LF9M 1IN7A 3VK8A 1QUTA 2CV0A 3KP0E 3U6MA 1PJTA 3FTDA 1R2ZA 2RPBA 1NSFA 3DZDA 3FYCA 2DWMA 4NRWA 4QOZC 1T6OA 4Z8XA 3VLFB 1KYIA 1WXQA 4M0WA 2DWNA 5JI3E 3LQRA 1IN6A 2EA0A 3LW5G 1Q3BA 2YFQA 2DAMA 4DUYM 1AIPC 2O25A 1R5LA 1JR3A 3D8BA 1WURA 4DV6M 2R62A 4OX9M 4LRSA 2C9OA 4GMQA 4OVZA 3KOZE 4IBKA 3J7BA 2KDLA 3VDPA 3GQ4A 4B3MM 3J2PB 4JI8M 2NQ8C 4HL4A 2KA6B 2R44A 3QNAA 3J81S 1E9SA 5E26A 1EFUB 5FTKA 3GPXA 1CUKA 1RU3A 1N77A 4A3VB 2UU9M 2L7IA 4NC6A 3GPPA 3FTFA 2Y20A 3BOSA 2RRUA 2CEAA 4ANRA 4FVFA 1A5TA 1JR3D 4M9SA 1SXJA 1IXZA 5ITRA 2UUBM 2BJVA 3IG5A 5ITTA 3NBIA 4AKGA 1EL6A 1WHCA 2L2DA 1PJSA 1T43A 2QZ4A 2ZAMA 3HU1A 5FTMA 3GRYA 3VFDA 3U5ZA 2QSFX 5JI2E 4IBDA 1Q02A 4LF4M 1YLAA 4NE5B 5IREB 2KEBA 2X49A 3TL4X 4CHTB 3ZH9B 2XLJA 3L27A 3GQ3A 1Z5CA 3KOYE 1TTEA 2LXEA 3FUUA 1SXJD 1DGHA 1UFZA 2DNAA 3UMMA 3SC3A 1JQJC 1V92A 2OOBA 3T38A 5EP1A 3QAUA 3E21A 4MGHA 4G4OA 3SYKA 1KFVA 1JB0F 2LHCA 3GLHE 4B08A 3BXWA 2CE7A 3LVWA 4FVMA 3KW6A 3KS4A 4F1IA 1TDZA 1VG5A 3FYDA 1HT2E 1GTPA 3ZQJA 2F5NA 3DFZA 2KW0A 4LJAA 1D0KA 4NSOB 1Z59A 1X37A 1L1TA 1XB2B 4D80A 1GO5A 3SFZA 4DV0M 2DHRA 1V33A 5C1BA 4IBIA 4JXJA 1VEJA 3HHYA 5BR8M 4AKHA 1HJPA 2K47A 4YY3M 3SHGB 1Q39A 3K92A 3TWKA 1XWIA 2F5PA 2FS1A 1XC8A 4MGYE 1GKIA 1J09A 1OJLA 2X4AA 4X62M 2JY8A 4OU7A 4B7HA 4G6ZA 1UM8A 4JI0M 1FNNA 2EJSA 4NTMA 3WHLA 1VQ1A
chains in the Genus database with same CATH topology
2ZTDA 1E94E 2ZTCA 2K9DA 2LTUA 2MGWA 2L4FA 2BWEA 2G3QA 2MJ5B 2QHOB 1F4IA 4GEWA 2LVOC 3FRHA 1Y8GA 3GLFE 1PGYA 2KNZA 1WIVA 4Q7JA 3LCUA 1OTRA 1IFYA 1N3SA 1WM9A 4E44B 3K9OA 1XXHE 2JZ1A 2B3TA 1IM2A 2WZJA 4HEOA 4NE3B 1MN3A 2HAKA 1G4AE 2EKKA 2DAEA 1TR8A 1WJ7A 2JP7A 1DO0A 4DRAE 2JY7A 1WGLA 3VEJA 2DHYA 1T6OA 3BMBA 2DAGA 1KYIA 2CP8A 3B0BC 2KR1A 3BBZA 2OO9A 1NV8A 1WR1B 1N3RA 1OQYA 2DAMA 1AIPC 2O25A 1C7YA 2MR9A 1WURA 1N3TA 1ZMUA 1DO2A 5DMZA 1NV9A 2LBCA 3LCVB 1ZMWA 1HT1E 2CWBA 4JA3A 2HWJA 2LVPC 1EFUB 1CUKA 1WGNA 3K9PA 1WPLA 2LVAA 1VDLA 1IS7A 2PN0A 2DZLA 2LVNC 2RRUA 3FE3A 1A5TA 2KNVA 2DKLA 1VEKA 2DI0A 3B89A 4WP2A 1TFEA 2JZ0A 1R4GA 1EL6A 3F92A 2LO0A 4DU6A 1WHCA 2L2DA 1T43A 3H4JA 4F2LA 2QSFX 2LNZA 5JI2E 1Q02A 4DBGB 1YLAA 4NE5B 1HQYE 2MROB 2KHHA 1VEGA 2DAKA 4QPMA 2KNAA 2JUJA 5DFLA 1TTEA 1IS8A 1WUQA 1UFZA 2EKFA 4G3OA 2DNAA 4DRBJ 1V92A 2OOBA 1IXSA 2P11A 3E21A 1G3IA 1JR3E 2BWBA 3GLHE 2OOAA 2DENA 4NE6B 4UN2B 2LVQD 4F1IA 3E46A 2L4EA 1VG5A 1HT2E 1GTPA 1QZEA 1OAIA 2QNJA 2DAIA 3GLGE 2K0BX 1XB2B 1GO5A 1A9CA 2H5XA 1FB1A 2JY5A 3MMPA 1VEJA 4E45B 1HJPA 3GLIE 3FRIA 1SG9A 2R0IA 1BVSA 3T6PA 1P3QQ 2JNHA 3IECA 4R71A 1FBXA 2JY6B 1OKSA 1G41A 1ZV1A 2JY8A 1DV0A 3IHPA 1ZMVA 1A8RA 2EJSA 4R8QA 1VQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  1E94 E;  2ZTC A;  2K9D A;  2LTU A;  2MGW A;  2L4F A;  2BWE A;  2G3Q A;  2MJ5 B;  2QHO B;  1F4I A;  4GEW A;  2LVO C;  3FRH A;  1Y8G A;  3GLF E;  1PGY A;  2KNZ A;  1WIV A;  4Q7J A;  3LCU A;  1OTR A;  1IFY A;  3K9O A;  1XXH E;  2JZ1 A;  2B3T A;  1IM2 A;  2WZJ A;  4HEO A;  1MN3 A;  2HAK A;  1G4A E;  2EKK A;  2DAE A;  1TR8 A;  1WJ7 A;  2JP7 A;  1DO0 A;  2JY7 A;  1WGL A;  2DHY A;  1T6O A;  3BMB A;  2DAG A;  1KYI A;  2CP8 A;  3BBZ A;  2OO9 A;  1NV8 A;  1WR1 B;  1OQY A;  2DAM A;  1AIP C;  2O25 A;  1C7Y A;  2MR9 A;  1ZMU A;  1DO2 A;  1NV9 A;  2LBC A;  3LCV B;  1ZMW A;  1HT1 E;  2CWB A;  2HWJ A;  2LVP C;  1EFU B;  1CUK A;  1WGN A;  3K9P A;  2LVA A;  1VDL A;  2PN0 A;  2DZL A;  2LVN C;  2RRU A;  3FE3 A;  1A5T A;  2KNV A;  2DKL A;  1VEK A;  2DI0 A;  3B89 A;  4WP2 A;  1TFE A;  2JZ0 A;  1R4G A;  3F92 A;  1WHC A;  2L2D A;  1T43 A;  3H4J A;  4F2L A;  2QSF X;  5JI2 E;  1Q02 A;  4DBG B;  1YLA A;  1HQY E;  2MRO B;  2KHH A;  1VEG A;  2DAK A;  2KNA A;  2JUJ A;  5DFL A;  1TTE A;  1UFZ A;  2EKF A;  4G3O A;  2DNA A;  1V92 A;  2OOB A;  1IXS A;  3E21 A;  1G3I A;  1JR3 E;  2BWB A;  3GLH E;  2OOA A;  2DEN A;  4UN2 B;  2LVQ D;  4F1I A;  3E46 A;  2L4E A;  1VG5 A;  1HT2 E;  1QZE A;  1OAI A;  2QNJ A;  2DAI A;  3GLG E;  2K0B X;  1XB2 B;  1GO5 A;  2H5X A;  2JY5 A;  3MMP A;  1VEJ A;  1HJP A;  3GLI E;  3FRI A;  1SG9 A;  2R0I A;  1BVS A;  3T6P A;  1P3Q Q;  2JNH A;  3IEC A;  4R71 A;  2JY6 B;  1OKS A;  1G41 A;  1ZV1 A;  2JY8 A;  1DV0 A;  3IHP A;  1ZMV A;  2EJS A;  1VQ1 A; 
#chains in the Genus database with same CATH topology
 4MM3 B;  3HU2 A;  4RF0 A;  4QNM A;  5EXT A;  2Y0Q A;  2JWS A;  2MGW A;  1L1Z A;  2BWE A;  2G3Q A;  1F4I A;  2QHO B;  4JV5 M;  3U6C A;  2XEP A;  1QAQ A;  3HX3 A;  3L2A A;  1Y8G A;  3J27 B;  5EQT A;  1FJG M;  1WIV A;  3U6L A;  4IBG A;  1GVN A;  3FUW A;  2JXN A;  1N32 M;  3K9O A;  3KFU G;  2OQ4 A;  2CRU A;  3U60 A;  2B3T A;  1NNJ A;  1N34 M;  1R7R A;  3JR5 A;  1LV7 A;  4L8R C;  4BBA A;  1N36 M;  2W82 A;  3A42 A;  3KOX E;  3M7G A;  4JI3 M;  1XMQ M;  1QAO A;  1TR8 A;  1IXS B;  1TH2 A;  1WJ7 A;  1T3T A;  4G4R A;  4DRA E;  2JY7 A;  1WGL A;  2WSE F;  4MGZ E;  2DHY A;  3BMB A;  3PXG A;  1QAN A;  2CP8 A;  2Z7J A;  4LFB M;  2KR1 A;  4IBF A;  3U6P A;  3B7Z A;  2R45 A;  2DWZ B;  2I7N A;  2LH0 A;  1D2N A;  2OO9 A;  3FD9 A;  4B3S M;  1NV8 A;  5IZ7 D;  3R9X B;  1N3R A;  3GPU A;  1C7Y A;  3LQQ A;  5A2Q S;  2QQ8 A;  2RKO A;  3HU3 A;  1HNW M;  2LBC A;  4LJ4 A;  2OBA A;  3Q8G A;  5KQD A;  1QUS A;  1TH4 A;  2D7E A;  1ZMW A;  2V1C A;  4FCT A;  4II7 A;  4NXN M;  5ITX E;  2LVP C;  3B74 A;  2VF7 A;  3K9P A;  3C3D A;  2CHV A;  5DNY A;  3RGP A;  3HGI A;  4XGI A;  4AZF A;  4GKK M;  1R2Y A;  2EO2 A;  2KNV A;  3SAS A;  2XGN A;  4GC5 A;  3TWL A;  1D0L A;  1XXH B;  1J7K A;  4DR2 M;  4WP2 A;  1TFE A;  3FUV A;  3HHZ A;  4KHP M;  3F92 A;  3K1J A;  2LO0 A;  1L2B A;  2R46 A;  1QDR A;  3TWM A;  2KRU A;  2O01 F;  4F2L A;  3SAU A;  2X8A A;  3QYB A;  3GLI A;  3DOA A;  4MH0 E;  4ITQ A;  2C96 A;  2I7P A;  2KHH A;  1VEG A;  3L25 A;  1AUA A;  3BK6 A;  1N78 A;  1KSF X;  3T1H M;  4RF1 A;  1N33 M;  1NHW C;  1WUQ A;  2VQF M;  1G8P A;  1YUB A;  1Z5A A;  3E4R A;  3VDU A;  5ITU A;  4X65 M;  5LMU M;  3LX3 A;  3A45 A;  4NTN A;  4FWH A;  4NTK A;  1XXH A;  4NE6 B;  1R6B X;  2DZN B;  3C58 A;  2R4J A;  5KO3 A;  3E46 A;  2Z8Y M;  3K2L A;  2QNJ A;  3NBX X;  4AKI A;  2DAI A;  3AOE C;  3CTW B;  3KSJ A;  4X64 M;  4LY6 A;  2DZO B;  3A98 B;  3GLG E;  3J80 S;  4RNA A;  4D82 A;  4DV5 M;  1A9C A;  2DTT A;  4JI2 M;  3HJS A;  4REZ A;  5DYG A;  5EXS A;  5KPR A;  1OFI A;  4B7G A;  4LGM A;  2WSF G;  2G8L A;  4OW0 A;  3SMS A;  3U61 B;  4IBJ A;  2F4V M;  1C1K A;  3SBJ A;  2R0I A;  3T6P A;  3AV0 A;  4R71 A;  1G71 A;  2JNH A;  1D0M A;  3IEC A;  3KOW E;  4B7F A;  2DXI A;  3SAV A;  3VKG A;  4M9Z A;  3GLG B;  1OKS A;  4GKJ M;  2Y0T A;  1G41 A;  4WW0 A;  1ZV1 A;  2J7N A;  3V76 A;  3LVV A;  3IG8 A;  1J5E M;  1DV0 A;  3IHP A;  5FTJ A;  3TPZ A;  3L26 A;  1Z5B A;  2HKJ A;  2V1U A;  3LW5 F;  4LF6 M;  4GHL A;  1E94 E;  3ZC7 B;  3CF6 E;  3EIE A;  4IBB A;  4DR5 M;  4LZJ A;  2LTU A;  4JI6 M;  2L4F A;  2Q2E B;  3W0F A;  4DR7 M;  4KLN A;  4P17 A;  3UJN A;  4GEW A;  3LW5 K;  2JA2 A;  4IBC A;  4NRV A;  3GLF E;  4JI4 M;  1PGY A;  1GTQ A;  3E9S A;  2BJW A;  3GLH B;  5L8R F;  4LJ9 A;  3B7Q A;  3FUX A;  2WSC G;  4NE3 B;  2YNM D;  4AW4 A;  1MN3 A;  2R4E A;  2VF8 A;  4CJ6 A;  5C18 A;  1QQW A;  3U6Q A;  1I94 M;  1NO1 A;  2ZAN A;  4DV1 M;  1VDD A;  4I4L A;  2FNA A;  3B9P A;  2FFJ A;  5BPV A;  2N35 A;  3OTO M;  3GLF B;  3SYL A;  3GP1 A;  2JP7 A;  4R3D A;  3UGJ A;  2DWL A;  2DJ6 A;  4X66 M;  1N75 A;  4GH9 A;  4LGY A;  2UUC M;  4Z6Y A;  3B0B C;  3KP1 E;  1DGB A;  4PD2 A;  5EXP A;  4B3R M;  4QHT A;  2QPA A;  3SAR A;  4LRT A;  3Q8X A;  3I51 A;  1IBM M;  1DGF A;  4JI5 M;  4K0K M;  2F5O A;  3AL0 C;  1GL7 A;  4IIW A;  1QZM A;  5F3W A;  1ZAE A;  1NY6 A;  1K3W A;  1N3T A;  2ZAO A;  3KDS E;  1GL6 A;  5FLX S;  1DO2 A;  4FVJ A;  1NJF A;  2D7G A;  4W5W A;  3J7A S;  1NV9 A;  1MU5 A;  4DV2 M;  4DV7 M;  2R65 A;  1SXJ C;  2LHG A;  2CWB A;  1HT1 E;  3CF0 A;  3LCV B;  4KOD A;  3KS8 A;  5IT9 S;  4L6V 6;  1GAB A;  3I4Y A;  1WPL A;  2DVW B;  2XF3 A;  1VDL A;  1L2C A;  4I81 A;  3I01 M;  4KO8 A;  1NY5 A;  2UXC M;  1IS7 A;  2PN0 A;  4FD2 A;  1TF0 B;  3FE3 A;  2QBY B;  2YQZ A;  3CF2 A;  2XZU A;  2DI0 A;  3CGW A;  5KQ8 A;  2HHH M;  3C9P A;  1MJG M;  2JZ0 A;  1R4G A;  4AQY M;  3KXE C;  2XSZ D;  2A5Y B;  2MH8 A;  1OIP A;  1XMO M;  5EP4 A;  1PJI A;  1GJT A;  2LNZ A;  4I5S A;  1W5S A;  4DBG B;  1HQC A;  1ORY B;  1HQY E;  1B66 A;  3B7N A;  1XHB A;  2XH9 A;  2M60 A;  2DAK A;  3H4M A;  4QHS A;  5EXX A;  3T15 A;  4QPM A;  2KZS A;  2KNA A;  3M0E A;  1IQP A;  5DFL A;  3T1Y M;  4EIW A;  3ZCB B;  2HCB A;  1IS8 A;  2EKF A;  4G3O A;  7CAT A;  4DRB J;  3FUT A;  1QAM A;  3ILK A;  4LJ7 A;  4BB9 A;  3U6S A;  1IXS A;  2FE8 A;  2APL A;  2CV2 A;  1JR3 E;  3TE6 A;  2OOA A;  1IY0 A;  3HKP A;  2LVQ D;  5FTL A;  4MB7 A;  3HHW A;  5E6J A;  2QEN A;  2EUC A;  4AI6 A;  3JAM S;  3D7J A;  5FTN A;  2H1R A;  4GRI A;  3TQS A;  1Y13 A;  1IY2 A;  1QZE A;  1OAI A;  1OIZ A;  1TGU A;  1PM5 A;  3GO8 A;  5DYI A;  2Z3X A;  4CIS A;  1MX0 A;  4R7G A;  2K0B X;  4HLQ A;  1FB1 A;  1H6U A;  2KRK A;  2P5T A;  4XK8 F;  3QN9 A;  3NWL A;  1IN4 A;  2VQE M;  1PJQ A;  3I2B A;  3LMM A;  3R8F A;  3MMP A;  3A46 A;  5KPT A;  3L29 A;  4E45 B;  1WIN A;  1SXJ E;  2R18 A;  2Z4R A;  1Z6T A;  3MK6 A;  3FRI A;  2C98 A;  4L16 A;  4OVZ B;  1EE8 A;  1SG9 A;  1BVS A;  2GQF A;  1P3Q Q;  3QYE A;  3W0L B;  3EIH A;  1PJJ A;  3THG A;  4GIT A;  2JY6 B;  3SHF A;  4DV4 M;  4JN6 A;  2C5R A;  4NOO B;  1IXR C;  3M6A A;  4PCZ A;  3KSX A;  5GKN A;  3PNY A;  5ITY A;  1ZMV A;  4LCB A;  3RFW A;  3SMP A;  4MGK E;  2C9C A;  3W67 A;  1A8R A;  2ZTD A;  3AJI B;  4IBE A;  3VK7 A;  2XZF A;  4GIP A;  1SXJ B;  5ITX A;  3M0N A;  2K9D A;  3QWL A;  2MJ5 B;  1S3S A;  5H37 D;  3GRU A;  4L4U A;  2A0S A;  3WHK A;  1NHG C;  2AHM A;  2LVO C;  4FCW A;  4NL4 H;  4LF7 M;  2J5Y A;  3U5Z B;  2V6Z M;  4Q7J A;  4QNR A;  3LCU A;  1WM9 A;  2LWX A;  1IFY A;  4JYA M;  4DUZ M;  1N3S A;  4E44 B;  1NNU C;  2YR0 A;  2Z4S A;  3L28 A;  4HEO A;  3U6D A;  2KXE A;  2L7H A;  3MHV C;  3SAT A;  1K3X A;  2HAK A;  1DGG A;  4YHH M;  1DGH B;  1G4A E;  4AG5 A;  2FH0 A;  2EKK A;  2HL7 A;  4GHA A;  2DAE A;  1V34 A;  2UXD M;  3JR4 A;  4IJF A;  4PDI A;  1DO0 A;  2Y21 A;  2CHG A;  2L09 A;  8CAT A;  5IWA M;  2BNK A;  2GNO A;  2VII A;  3FTC A;  4FWD A;  2CV1 A;  4JI7 M;  4LF8 M;  3VEJ A;  2LNH C;  1TDH A;  2DAG A;  3GRR A;  3GQ5 A;  1HR0 M;  3JYG A;  4CGY B;  4TUW A;  1QVR A;  1E32 A;  3BBZ A;  1XNQ M;  2OPF A;  1XNR M;  1HNZ M;  5FSW A;  1PRB A;  1WR1 B;  1OQY A;  4L15 A;  2XFT A;  1EIJ A;  4WUR A;  1B6Z A;  3HJQ A;  2MR9 A;  1ZMU A;  2RGH A;  4FVG A;  4AG6 A;  5DMZ A;  3U61 A;  3HJ8 A;  2F5S A;  1GJS A;  2QP9 X;  3U6O A;  4JA3 A;  2HWJ A;  2M5Z A;  4FCV A;  5EJC A;  3GLG A;  4I8O A;  4DR4 M;  1WGN A;  1NJG A;  1QDT A;  4KT0 F;  2LVA A;  1YE9 A;  2DZL A;  2LVN C;  2XFS A;  3I4V A;  3MJ5 A;  4LJ5 A;  2CUZ A;  2DKL A;  1VEK A;  3B89 A;  3SAW A;  1YSY A;  3HZJ A;  3HY5 A;  2C99 A;  4NXM M;  3I04 M;  2K6B A;  1HNX M;  2WSE G;  4DU6 A;  3FKE A;  3AFH A;  1IN8 A;  3H4J A;  4LFA M;  4QOS A;  2WSF F;  3GLH A;  4BLC A;  1OAO C;  4D81 A;  4LG2 A;  2MRO B;  4NSR A;  2R6F A;  5LMN M;  4JI1 M;  2CFO A;  1OFH A;  2XSZ A;  2JUJ A;  1LTM A;  4FW9 A;  3VKH A;  2WSF K;  3PNV A;  3U60 B;  3FTE A;  3K8Z A;  2L6O A;  3HWS A;  3GLF A;  3HHX A;  4B3T M;  2E5L M;  2P11 A;  4DR3 M;  3D8L A;  1G3I A;  2BWB A;  3QN0 A;  2DEN A;  2RGO A;  3GPY A;  4UN2 B;  4XBO A;  2CHQ A;  4LF5 M;  2L4E A;  4LFC M;  3KVW A;  3AKZ A;  1TH3 A;  3DA1 A;  4DV3 M;  4G4N A;  4DR1 M;  3U6E A;  4GC9 A;  2G5G X;  2FOI C;  1IN5 A;  1I4W A;  4L78 A;  4RKU F;  4S12 A;  2UXB M;  2H5X A;  2WSC F;  3PVS A;  1IBK M;  4Y28 F;  2J7O A;  1QYR A;  3RGS A;  2JY5 A;  2O01 G;  1NVM A;  2VDB B;  4M0D A;  5EP2 A;  4IJE A;  4LZZ A;  5KPZ A;  5ITQ A;  3AOE A;  2WSC K;  5EP3 A;  3RE8 A;  1FBX A;  3UK6 A;  3UZU A;  1ZQ9 A;  4G4Q A;  2D7H A;  2UUA M;  3LZE A;  2QBY A;  1G59 A;  1Q3C A;  3GRV A;  4LJ6 A;  3GLI E;  4R8Q A;  2O5R A;  4PDG A;  4ZPX A;  1E9R A;  4PT5 A;  2ZTC A;  4M9X A;  1GLN A;  2ZM6 M;  4MGI E;  4P16 A;  1L2D A;  2F5Q A;  2WSE K;  2G64 A;  1K82 A;  3W68 A;  1IY1 A;  2ZBK B;  3FRH A;  1W5T A;  2ERC A;  2KNZ A;  1IBL M;  3C3E A;  4DR6 M;  1OTR A;  4LJ8 A;  3GLI B;  2KZU A;  1XXH E;  3AOG A;  1L8Q A;  2QCU A;  2JZ1 A;  4FWG A;  4CIZ A;  3PFI A;  1IM2 A;  2WZJ A;  4LF9 M;  1IN7 A;  3VK8 A;  1QUT A;  2CV0 A;  3KP0 E;  3U6M A;  1PJT A;  3FTD A;  1R2Z A;  2RPB A;  1NSF A;  3DZD A;  3FYC A;  2DWM A;  4NRW A;  4QOZ C;  1T6O A;  4Z8X A;  3VLF B;  1KYI A;  1WXQ A;  4M0W A;  2DWN A;  5JI3 E;  3LQR A;  1IN6 A;  2EA0 A;  3LW5 G;  1Q3B A;  2YFQ A;  2DAM A;  4DUY M;  1AIP C;  2O25 A;  1R5L A;  1JR3 A;  3D8B A;  1WUR A;  4DV6 M;  2R62 A;  4OX9 M;  4LRS A;  2C9O A;  4GMQ A;  4OVZ A;  3KOZ E;  4IBK A;  3J7B A;  2KDL A;  3VDP A;  3GQ4 A;  4B3M M;  3J2P B;  4JI8 M;  2NQ8 C;  4HL4 A;  2KA6 B;  2R44 A;  3QNA A;  3J81 S;  1E9S A;  5E26 A;  1EFU B;  5FTK A;  3GPX A;  1CUK A;  1RU3 A;  1N77 A;  4A3V B;  2UU9 M;  2L7I A;  4NC6 A;  3GPP A;  3FTF A;  2Y20 A;  3BOS A;  2RRU A;  2CEA A;  4ANR A;  4FVF A;  1A5T A;  1JR3 D;  4M9S A;  1SXJ A;  1IXZ A;  5ITR A;  2UUB M;  2BJV A;  3IG5 A;  5ITT A;  3NBI A;  4AKG A;  1EL6 A;  1WHC A;  2L2D A;  1PJS A;  1T43 A;  2QZ4 A;  2ZAM A;  3HU1 A;  5FTM A;  3GRY A;  3VFD A;  3U5Z A;  2QSF X;  5JI2 E;  4IBD A;  1Q02 A;  4LF4 M;  1YLA A;  4NE5 B;  5IRE B;  2KEB A;  2X49 A;  3TL4 X;  4CHT B;  3ZH9 B;  2XLJ A;  3L27 A;  3GQ3 A;  1Z5C A;  3KOY E;  1TTE A;  2LXE A;  3FUU A;  1SXJ D;  1DGH A;  1UFZ A;  2DNA A;  3UMM A;  3SC3 A;  1JQJ C;  1V92 A;  2OOB A;  3T38 A;  5EP1 A;  3QAU A;  3E21 A;  4MGH A;  4G4O A;  3SYK A;  1KFV A;  1JB0 F;  2LHC A;  3GLH E;  4B08 A;  3BXW A;  2CE7 A;  3LVW A;  4FVM A;  3KW6 A;  3KS4 A;  4F1I A;  1TDZ A;  1VG5 A;  3FYD A;  1HT2 E;  1GTP A;  3ZQJ A;  2F5N A;  3DFZ A;  2KW0 A;  4LJA A;  1D0K A;  4NSO B;  1Z59 A;  1X37 A;  1L1T A;  1XB2 B;  4D80 A;  1GO5 A;  3SFZ A;  4DV0 M;  2DHR A;  1V33 A;  5C1B A;  4IBI A;  4JXJ A;  1VEJ A;  3HHY A;  5BR8 M;  4AKH A;  1HJP A;  2K47 A;  4YY3 M;  3SHG B;  1Q39 A;  3K92 A;  3TWK A;  1XWI A;  2F5P A;  2FS1 A;  1XC8 A;  4MGY E;  1GKI A;  1J09 A;  1OJL A;  2X4A A;  4X62 M;  2JY8 A;  4OU7 A;  4B7H A;  4G6Z A;  1UM8 A;  4JI0 M;  1FNN A;  2EJS A;  4NTM A;  3WHL A;  1VQ1 A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  1E94 E;  2ZTC A;  2K9D A;  2LTU A;  2MGW A;  2L4F A;  2BWE A;  2G3Q A;  2MJ5 B;  2QHO B;  1F4I A;  4GEW A;  2LVO C;  3FRH A;  1Y8G A;  3GLF E;  1PGY A;  2KNZ A;  1WIV A;  4Q7J A;  3LCU A;  1OTR A;  1IFY A;  1N3S A;  1WM9 A;  4E44 B;  3K9O A;  1XXH E;  2JZ1 A;  2B3T A;  1IM2 A;  2WZJ A;  4HEO A;  4NE3 B;  1MN3 A;  2HAK A;  1G4A E;  2EKK A;  2DAE A;  1TR8 A;  1WJ7 A;  2JP7 A;  1DO0 A;  4DRA E;  2JY7 A;  1WGL A;  3VEJ A;  2DHY A;  1T6O A;  3BMB A;  2DAG A;  1KYI A;  2CP8 A;  3B0B C;  2KR1 A;  3BBZ A;  2OO9 A;  1NV8 A;  1WR1 B;  1N3R A;  1OQY A;  2DAM A;  1AIP C;  2O25 A;  1C7Y A;  2MR9 A;  1WUR A;  1N3T A;  1ZMU A;  1DO2 A;  5DMZ A;  1NV9 A;  2LBC A;  3LCV B;  1ZMW A;  1HT1 E;  2CWB A;  4JA3 A;  2HWJ A;  2LVP C;  1EFU B;  1CUK A;  1WGN A;  3K9P A;  1WPL A;  2LVA A;  1VDL A;  1IS7 A;  2PN0 A;  2DZL A;  2LVN C;  2RRU A;  3FE3 A;  1A5T A;  2KNV A;  2DKL A;  1VEK A;  2DI0 A;  3B89 A;  4WP2 A;  1TFE A;  2JZ0 A;  1R4G A;  1EL6 A;  3F92 A;  2LO0 A;  4DU6 A;  1WHC A;  2L2D A;  1T43 A;  3H4J A;  4F2L A;  2QSF X;  2LNZ A;  5JI2 E;  1Q02 A;  4DBG B;  1YLA A;  4NE5 B;  1HQY E;  2MRO B;  2KHH A;  1VEG A;  2DAK A;  4QPM A;  2KNA A;  2JUJ A;  5DFL A;  1TTE A;  1IS8 A;  1WUQ A;  1UFZ A;  2EKF A;  4G3O A;  2DNA A;  4DRB J;  1V92 A;  2OOB A;  1IXS A;  2P11 A;  3E21 A;  1G3I A;  1JR3 E;  2BWB A;  3GLH E;  2OOA A;  2DEN A;  4NE6 B;  4UN2 B;  2LVQ D;  4F1I A;  3E46 A;  2L4E A;  1VG5 A;  1HT2 E;  1GTP A;  1QZE A;  1OAI A;  2QNJ A;  2DAI A;  3GLG E;  2K0B X;  1XB2 B;  1GO5 A;  1A9C A;  2H5X A;  1FB1 A;  2JY5 A;  3MMP A;  1VEJ A;  4E45 B;  1HJP A;  3GLI E;  3FRI A;  1SG9 A;  2R0I A;  1BVS A;  3T6P A;  1P3Q Q;  2JNH A;  3IEC A;  4R71 A;  1FBX A;  2JY6 B;  1OKS A;  1G41 A;  1ZV1 A;  2JY8 A;  1DV0 A;  3IHP A;  1ZMV A;  1A8R A;  2EJS A;  4R8Q A;  1VQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...