4Q7JA

Complex structure of viral rna polymerase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
278
structure length
278
Chain Sequence
TASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/transferase
molecule keywords Elongation factor Ts
publication title Molecular insights into replication initiation by Q beta replicase using ribosomal protein S1
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 278
sequence length 278
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00889 EF_TS Elongation factor TS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4q7jA01
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4q7jA04
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA02
3.30.479.20 Alpha Beta 2-Layer Sandwich Tetrahydropterin Synthase; Chain A Elongation factor Ts, dimerisation domain 4q7jA03
1QZEA 3IECA 3LCVB 1T43A 1KYIA 3K9OA 1V92A 1ZMWA 4Q7JA 1ZMUA 2MROB 1ZV1A 1G3IA 1E94E 1NV8A 1HJPA 3FE3A 2HWJA 1WIVA 3T6PA 1A5TA 2DENA 1VDLA 2KNAA 2JY5A 1IFYA 1R4GA 1HQYE 3FRHA 2ZTCA 3MMPA 2JY6B 1OQYA 1Q02A 1VEJA 2L4EA 2LVAA 1ZMVA 4F2LA 3GLFE 2QSFX 2DAIA 2JZ0A 2MJ5B 2L2DA 2JNHA 1DV0A 2DHYA 4UN2B 2QHOB 2WZJA 2KNVA 2JY7A 2BWBA 2DAEA 2EJSA 2QNJA 3F92A 1WGNA 2R0IA 1NV9A 1XB2B 1VEGA 2K9DA 1AIPC 1VQ1A 2CP8A 1WHCA 2OOAA 2ZTDA 2JY8A 4HEOA 3LCUA 2L4FA 2LVNC 4DBGB 1G4AE 2DKLA 2EKKA 4G3OA 2DZLA 1TFEA 2JP7A 2DAMA 2LVOC 2DAKA 2OOBA 2KHHA 2G3QA 1WGLA 3BMBA 2LVPC 1JR3E 2MR9A 2LBCA 1EFUB 3GLGE 2O25A 4GEWA 2K0BX 1WJ7A 1VG5A 2B3TA 5JI2E 3H4JA 2PN0A 1UFZA 5DFLA 4R71A 1T6OA 2CWBA 1MN3A 1F4IA 2DNAA 2JUJA 1IXSA 1TTEA 1OKSA 1CUKA 1PGYA 1DO0A 2DAGA 2KNZA 3BBZA 3B89A 1WR1B 1G41A 1HT1E 1GO5A 2LVQD 3E21A 1OTRA 1BVSA 2JZ1A 1XXHE 1IM2A 1C7YA 1OAIA 1SG9A 1Y8GA 1TR8A 2MGWA 3E46A 4WP2A 1DO2A 1P3QQ 2OO9A 2DI0A 3FRIA 2BWEA 2LTUA 2EKFA 1VEKA 4F1IA 2HAKA 3GLIE 3GLHE 3IHPA 1YLAA 2RRUA 2H5XA 3K9PA 1HT2E
chains in the Genus database with same CATH superfamily
1QZEA 3IECA 3LCVB 1T43A 5BR8M 3PXGA 1KYIA 4RF0A 2VF7A 2Y20A 3BOSA 1OJLA 3FUXA 3GLHB 3KOWE 1ZMUA 4XK8F 1W5TA 3HHXA 1E94E 3HU1A 5JI3E 3FE3A 5ITUA 3OTOM 2M60A 2Z4RA 3E9SA 3MJ5A 3SAVA 2WSCG 1NHWC 5EXXA 2WSEG 2KZSA 4JI1M 2UUAM 4DUZM 4LRTA 1QAOA 2KNAA 4XBOA 4LJ4A 1IFYA 1GL6A 2DWZB 2FH0A 4REZA 2XGNA 5EXPA 1IXSB 3MMPA 4AKHA 2AHMA 5FTNA 1VEJA 4W5WA 1ZAEA 3LX3A 2DAIA 1NSFA 2MJ5B 2L2DA 3RFWA 1HQCA 4L8RC 3W68A 4NOOB 4P17A 1XWIA 1N3SA 2DAEA 5FLXS 1XC8A 4CGYB 3MHVC 2QNJA 4IBCA 4PD2A 2J5YA 4NC6A 4TUWA 2HL7A 4QHTA 4DV6M 2XH9A 1QVRA 1VEGA 2UUBM 1I94M 2K9DA 1NY5A 2W82A 1RU3A 2OOAA 4LGMA 3GPXA 1XMQM 2JY8A 3A42A 5LMNM 4HEOA 3LCUA 4AG5A 4DBGB 1PM5A 3VEJA 4DV4M 4DU6A 4LJAA 1G4AE 3L2AA 4G3OA 2DZLA 2QZ4A 2JP7A 1IN7A 3I2BA 3H4MA 1Z5CA 2DAMA 2LVOC 3B0BC 4WW0A 2YNMD 4L15A 2UXCM 4D82A 3LW5K 7CATA 2MH8A 3DA1A 4JI6M 2G3QA 3PVSA 4LJ5A 4DR2M 1GTQA 3BMBA 3UGJA 1JR3E 3HKPA 3QWLA 4MGYE 4NSRA 4QOSA 5FTMA 1QDRA 3SMPA 3GLHA 4HLQA 4B08A 3GLGE 3J7AS 3AFHA 2KEBA 2CUZA 4MB7A 4IBFA 4K0KM 4B3RM 2APLA 3TE6A 3GRRA 4QHSA 5F3WA 1IN6A 1PRBA 1VG5A 1WJ7A 2B3TA 2EUCA 3SYKA 3H4JA 1DGGA 4FVMA 2F5QA 1IXZA 1QYRA 1IY1A 1A9CA 5DFLA 4LZZA 3SASA 3WHLA 2CWBA 2DNAA 3KVWA 4CHTB 1IXSA 1TTEA 1OKSA 4OW0A 3GLGB 2CV0A 4JI2M 3M6AA 1GABA 2GQFA 3EIHA 4IBIA 3ZQJA 5KPRA 3JR4A 1TGUA 1R5LA 2QP9X 1V33A 3Q8XA 3FTFA 2Q2EB 1H6UA 2YQZA 3B74A 5EP2A 1OIPA 2F5PA 3ZCBB 3A45A 3R8FA 3SBJA 1NVMA 2O01F 4JI0M 1HR0M 1HNZM 1W5SA 5KPZA 3I01M 4DR5M 1PJSA 2JA2A 3T15A 3JR5A 4WURA 1WURA 1OAIA 2P11A 4WP2A 2BJVA 2FOIC 4Y28F 1DO2A 4GRIA 4AI6A 1Z5AA 2OO9A 1J7KA 2K47A 3UMMA 4G6ZA 2KZUA 4PDGA 1E32A 1VEKA 3QYEA 2HAKA 3KS8A 1GJSA 4NTKA 2H5XA 4NRWA 4DV3M 3U6DA 2ZANA 1L2BA 4LF8M 4ANRA 1WPLA 4RF1A 2VQEM 2RGHA 1J09A 1EIJA 3U6MA 2UUCM 3CF6E 1JQJC 5ITXA 4M0DA 2L7HA 1QUTA 3GRVA 3HGIA 2A5YB 2LHCA 3AKZA 1IBKM 4LG2A 4Q7JA 5EP1A 4R8QA 3TWKA 3SC3A 1HJPA 1N75A 2G8LA 3HY5A 4CIZA 1R2YA 1WINA 3TQSA 4X64M 3KFUG 1WIVA 3U6SA 3QN0A 3T6PA 3U6EA 2L7IA 4RKUF 3QYBA 2A0SA 4CJ6A 3GLGA 4GITA 3GPUA 2CEAA 3WHKA 1L1ZA 2JY5A 3BXWA 2VIIA 1R4GA 4G4QA 1HQYE 2FS1A 2FNAA 1OQYA 3LMMA 2QCUA 3LW5F 1LV7A 1ZMVA 1R6BX 2D7HA 3KSJA 4KODA 4F2LA 3U6OA 4OVZB 3QN9A 2X8AA 1DGFA 4KT0F 4IBEA 2JNHA 3U6PA 1L2DA 3VKGA 3AL0C 1L8QA 2DHYA 2J7NA 2JXNA 1G8PA 5FTJA 1NO1A 4DV1M 4I81A 4G4OA 1NV9A 2X4AA 1NNUC 3B7ZA 3GLFB 1XB2B 2WSCF 3FUVA 3UZUA 2WSEF 4L16A 1K3WA 1JR3D 1AIPC 1VQ1A 1WHCA 2X49A 3FUTA 3HU3A 2G64A 1QANA 2C9CA 3FUWA 3HWSA 4JXJA 5DMZA 4GC5A 2EKKA 2RGOA 3I4YA 1AUAA 2N35A 1QAMA 1GKIA 1ZQ9A 2DAKA 2C96A 3DZDA 4KO8A 3HZJA 1HNWM 1NHGC 1Y13A 2RPBA 4NSOB 1OFIA 4B3SM 4NE5B 2KR1A 4YHHM 2QENA 3AV0A 2MR9A 4HL4A 4KHPM 3KSXA 2C98A 5KPTA 5C1BA 2VQFM 3I04M 2QQ8A 3FTEA 3SAWA 1I4WA 1E9SA 3A98B 3FTDA 2KRUA 3T1HM 2LHGA 4FVGA 4NXNM 5JI2E 4II7A 2PN0A 4AQYM 1WM9A 4GKKM 3K2LA 5KO3A 2BJWA 1JB0F 1T6OA 2CRUA 2ZAOA 3LQRA 2V1CA 2XEPA 2R65A 2QPAA 1Z5BA 1CUKA 3AOEA 5ITTA 2GNOA 5ITXE 1OFHA 1HNXM 3K8ZA 1DO0A 1DGHA 3CTWB 4OVZA 2DWNA 4RNAA 1YSYA 3SHGB 1QUSA 3C3DA 3BBZA 1XMOM 2DWLA 3B89A 3HJSA 2WSFG 4P16A 3UK6A 5EP3A 3SHFA 3U6CA 2E5LM 1WR1B 1G41A 4Z6YA 1IN8A 1HT1E 3E21A 3GLIB 1OTRA 3GLFE 5EXTA 3KP0E 3CGWA 3QAUA 1BVSA 3FYCA 3D7JA 4B3MM 3GLFA 2JZ1A 3HHYA 1NNJA 1Z6TA 2CHVA 1C7YA 4LCBA 1GL7A 1SG9A 1Y8GA 1TR8A 3KOYE 1D2NA 1QZMA 1N77A 2WSCK 2WSEK 1NJFA 4BLCA 1P3QQ 4R7GA 4FWGA 2DI0A 4DRBJ 4JI5M 2BWEA 4LF9M 8CATA 4L4UA 1QDTA 4G4RA 4LFBM 3Q8GA 3K92A 5KQ8A 3GPPA 5FTKA 2OBAA 3K9PA 4QNRA 1S3SA 4LY6A 3SYLA 4LFAM 3VK8A 4LJ6A 4DR1M 2C5RA 4LF6M 4X66M 2VDBB 3HJ8A 4QNMA 1Q39A 4ITQA 1K82A 4KLNA 1Q3CA 2XSZA 5EXSA 3VFDA 2Y21A 2OQ4A 5IZ7D 3TPZA 4JI7M 1YE9A 2Y0TA 5EQTA 2MROB 1ZV1A 3JYGA 2CV1A 2Z3XA 1D0LA 2HWJA 4LGYA 4D81A 1N3TA 2EA0A 3KS4A 2OPFA 4NE6B 3I4VA 1A5TA 3W0LB 1Q3BA 3I51A 3PNYA 4IBBA 2J7OA 3U6QA 4NTMA 1XXHA 1SXJE 1KSFX 4DR3M 1R2ZA 2CE7A 3LVWA 4LJ7A 4AKIA 2ZTCA 4DUYM 2DVWB 1TF0B 1Q02A 1FB1A 2L4EA 1PJJA 2LNZA 1PJQA 2LO0A 2QSFX 4IBDA 2JZ0A 3GRUA 3GLIA 3U5ZA 2O5RA 3RE8A 4UN2B 1IXRC 2QHOB 2WZJA 2KNVA 2XSZD 2M5ZA 2R46A 4MGIE 4X62M 2H1RA 2BWBA 2O01G 1SXJB 4LF7M 4E44B 3TL4X 3F92A 2R0IA 3AJIB 3IG8A 1L1TA 4DR7M 1MX0A 3GQ5A 3VDPA 1XHBA 3GQ3A 4EIWA 1QQWA 2DTTA 2ZTDA 1D0MA 4IIWA 2R62A 4IJFA 2L4FA 1NJGA 4FD2A 1N33M 1XNQM 2LH0A 3C58A 2HHHM 3BK6A 3KDSE 3GO8A 1FBXA 4NXMM 1TFEA 2OOBA 3W0FA 4QPMA 2LNHC 4NRVA 1N34M 2DJ6A 1DGHB 5ITQA 2LVPC 3T1YM 3VLFB 3K1JA 1G71A 2EO2A 2LBCA 3FKEA 4G4NA 5IREB 2O25A 1Z59A 3FD9A 2VF8A 4MGZE 3J7BA 4Z8XA 3TWMA 2KA6B 5FTLA 4E45B 1UM8A 2K0BX 3D8LA 4M9SA 2FFJA 3B7QA 1N36M 3C3EA 2Z7JA 4MGKE 4LRSA 5IWAM 4L6V6 2P5TA 1MN3A 2XFTA 1K3XA 3QNAA 3SMSA 3KW6A 1DGBA 4FWHA 3EIEA 4BBAA 1IQPA 3GPYA 3U61B 1IY2A 2DXIA 3HU2A 3RGSA 4X65M 4FVFA 4IBJA 3THGA 4NE3B 2DAGA 2F5OA 3VK7A 2KNZA 2F5SA 3LW5G 1IS8A 3RGPA 3GQ4A 1T3TA 2KW0A 4B7HA 2V6ZM 3U60A 5ITRA 3CF2A 2R6FA 4I8OA 4DR6M 4LFCM 4JYAM 1SXJA 4JI8M 2UXDM 2LVQD 1J5EM 4JV5M 2CFOA 2ERCA 2I7NA 1GJTA 4LJ8A 1XXHE 2JWSA 5DYIA 3M0EA 2KXEA 1FNNA 1IM2A 1PJIA 4B7FA 3AOEC 3E46A 2HKJA 5DNYA 4YY3M 4DV2M 1B66A 4NTNA 3KOZE 3JAMS 2L6OA 1WXQA 2ZM6M 3FRIA 4GHLA 1V34A 1YUBA 3KP1E 2EKFA 3FYDA 5GKNA 4F1IA 3GLIE 1N3RA 2DZNB 2F4VM 2LWXA 2R4EA 4LF4M 2RRUA 1XXHB 3V76A 4QOZC 4DRAE 4FWDA 4L78A 2R4JA 1HT2E 5IT9S 2WSFF 3GP1A 5DYGA 4A3VB 1A8RA 1WUQA 4R3DA 3LQQA 1IN4A 4OX9M 1EL6A 1SXJD 2CHQA 1L2CA 2C99A 3HJQA 3K9OA 2Z8YM 1V92A 3U5ZB 1ZMWA 2F5NA 2YFQA 1IS7A 3HX3A 1G3IA 4I4LA 1NV8A 3W67A 2K6BA 1IBLM 4I5SA 1ORYB 3R9XB 4PCZA 3L27A 4D80A 2DENA 2DHRA 3U61A 1VDLA 2QBYB 2KRKA 4PDIA 3FRHA 5L8RF 3D8BA 2JY6B 3LZEA 3J2PB 2LVAA 5C18A 2FE8A 4DV7M 4GC9A 1NY6A 1OAOC 3SARA 2RKOA 1B6ZA 1DV0A 2BNKA 1IBMM 3U6LA 4AG6A 5E6JA 5ITYA 5A2QS 3HHZA 2XZUA 4CISA 2JY7A 4ZPXA 4GH9A 2EJSA 3NBXX 1WGNA 2XF3A 1KFVA 2D7GA 1FJGM 4AZFA 3LVVA 3NWLA 4FVJA 4B7GA 5FSWA 3ILKA 2V1UA 1EE8A 4IBGA 2CP8A 3L28A 4DV5M 2XFSA 2UXBM 2XLJA 2LVNC 4OU7A 4BB9A 4GKJM 2DKLA 3M0NA 1X37A 3VDUA 2NQ8C 5E26A 2I7PA 4S12A 4MGHA 3VKHA 2YR0A 2KHHA 4PT5A 1WGLA 3L25A 1GLNA 2Y0QA 3NBIA 2LXEA 2DWMA 2WSFK 2R18A 3DOAA 4DR4M 2ZAMA 4MM3B 1EFUB 1TH3A 4JN6A 3U60B 4LF5M 4GMQA 4GEWA 1LTMA 4M9ZA 1E9RA 2L09A 3M7GA 4FCTA 3SFZA 2ZBKB 2C9OA 1MU5A 3MK6A 5H37D 3FUUA 3SAUA 3UJNA 1UFZA 3HHWA 3A46A 1TH4A 2XZFA 2R45A 3PFIA 4AKGA 4R71A 5LMUM 1IN5A 4M0WA 2QBYA 4FCVA 4JA3A 3E4RA 1F4IA 3SATA 2DZOB 5BPVA 2JUJA 3IG5A 1R7RA 3ZH9B 2HCBA 3C9PA 1PGYA 3PNVA 4JI4M 3AOGA 1GVNA 4DV0M 1PJTA 2KDLA 4IBKA 4AW4A 1GTPA 1MJGM 3KXEC 5EP4A 3B9PA 3B7NA 3TWLA 4GHAA 1N78A 1IY0A 1VDDA 1C1KA 1TH2A 3L26A 1TDHA 2CV2A 1GO5A 5EJCA 4FW9A 3J27B 4LJ9A 4NL4H 4XGIA 3J81S 1D0KA 4IJEA 1QAQA 2CHGA 1JR3A 4MH0E 1G59A 3FTCA 3DFZA 2MGWA 3L29A 3J80S 2G5GX 2D7EA 4LZJA 4JI3M 2R44A 3GRYA 1TDZA 4B3TM 2LTUA 4FCWA 3T38A 3CF0A 2Z4SA 3GLHE 3IHPA 3ZC7B 4GIPA 1YLAA 3KOXE 4M9XA 2UU9M 5KQDA 1N32M 1SXJC 1XNRM 1OIZA
chains in the Genus database with same CATH topology
1WPLA 1QZEA 1A8RA 3IECA 3LCVB 1WUQA 1T43A 1KYIA 1EL6A 3K9OA 1V92A 1ZMWA 4Q7JA 1IS7A 1ZMUA 2MROB 1ZV1A 1G3IA 1E94E 4R8QA 1NV8A 1HJPA 3FE3A 2HWJA 1N3TA 1WIVA 3T6PA 4NE6B 1A5TA 2DENA 1VDLA 2KNAA 2JY5A 1IFYA 1R4GA 1HQYE 3FRHA 2ZTCA 3MMPA 2JY6B 1OQYA 1Q02A 1VEJA 2L4EA 2LVAA 1ZMVA 4F2LA 3GLFE 1FB1A 2LNZA 2LO0A 2QSFX 2DAIA 2JZ0A 2MJ5B 2L2DA 2JNHA 1DV0A 2DHYA 4UN2B 2QHOB 2WZJA 2KNVA 2JY7A 1N3SA 2BWBA 2DAEA 4E44B 2EJSA 2QNJA 3F92A 1WGNA 2R0IA 1NV9A 1XB2B 1VEGA 2K9DA 1AIPC 1VQ1A 2CP8A 1WHCA 2OOAA 2ZTDA 2JY8A 4HEOA 3LCUA 2L4FA 2LVNC 4DBGB 3VEJA 4DU6A 1G4AE 2DKLA 5DMZA 2EKKA 4G3OA 2DZLA 1TFEA 1FBXA 2JP7A 2DAMA 3B0BC 2LVOC 2DAKA 2OOBA 4QPMA 2KHHA 2G3QA 4NE5B 2KR1A 1WGLA 3BMBA 2LVPC 1JR3E 2MR9A 2LBCA 1EFUB 3GLGE 2O25A 4GEWA 4E45B 2K0BX 1WJ7A 1VG5A 2B3TA 5JI2E 3H4JA 2PN0A 1UFZA 1WM9A 1A9CA 5DFLA 4R71A 1T6OA 4JA3A 2CWBA 1MN3A 1F4IA 2DNAA 2JUJA 1IXSA 1TTEA 1OKSA 1CUKA 1PGYA 1DO0A 4NE3B 2DAGA 2KNZA 1IS8A 1GTPA 3BBZA 3B89A 1WR1B 1G41A 1HT1E 1GO5A 2LVQD 3E21A 1OTRA 1BVSA 2JZ1A 1XXHE 1WURA 1IM2A 1C7YA 1OAIA 2P11A 1SG9A 1Y8GA 1TR8A 2MGWA 3E46A 4WP2A 1DO2A 1P3QQ 2OO9A 2DI0A 4DRBJ 3FRIA 2BWEA 2LTUA 2EKFA 1VEKA 4F1IA 2HAKA 3GLIE 1N3RA 3GLHE 3IHPA 1YLAA 2RRUA 2H5XA 4DRAE 3K9PA 1HT2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  3IEC A;  3LCV B;  1T43 A;  1KYI A;  3K9O A;  1V92 A;  1ZMW A;  4Q7J A;  1ZMU A;  2MRO B;  1ZV1 A;  1G3I A;  1E94 E;  1NV8 A;  1HJP A;  3FE3 A;  2HWJ A;  1WIV A;  3T6P A;  1A5T A;  2DEN A;  1VDL A;  2KNA A;  2JY5 A;  1IFY A;  1R4G A;  1HQY E;  3FRH A;  2ZTC A;  3MMP A;  2JY6 B;  1OQY A;  1Q02 A;  1VEJ A;  2L4E A;  2LVA A;  1ZMV A;  4F2L A;  3GLF E;  2QSF X;  2DAI A;  2JZ0 A;  2MJ5 B;  2L2D A;  2JNH A;  1DV0 A;  2DHY A;  4UN2 B;  2QHO B;  2WZJ A;  2KNV A;  2JY7 A;  2BWB A;  2DAE A;  2EJS A;  2QNJ A;  3F92 A;  1WGN A;  2R0I A;  1NV9 A;  1XB2 B;  1VEG A;  2K9D A;  1AIP C;  1VQ1 A;  2CP8 A;  1WHC A;  2OOA A;  2ZTD A;  2JY8 A;  4HEO A;  3LCU A;  2L4F A;  2LVN C;  4DBG B;  1G4A E;  2DKL A;  2EKK A;  4G3O A;  2DZL A;  1TFE A;  2JP7 A;  2DAM A;  2LVO C;  2DAK A;  2OOB A;  2KHH A;  2G3Q A;  1WGL A;  3BMB A;  2LVP C;  1JR3 E;  2MR9 A;  2LBC A;  1EFU B;  3GLG E;  2O25 A;  4GEW A;  2K0B X;  1WJ7 A;  1VG5 A;  2B3T A;  5JI2 E;  3H4J A;  2PN0 A;  1UFZ A;  5DFL A;  4R71 A;  1T6O A;  2CWB A;  1MN3 A;  1F4I A;  2DNA A;  2JUJ A;  1IXS A;  1TTE A;  1OKS A;  1CUK A;  1PGY A;  1DO0 A;  2DAG A;  2KNZ A;  3BBZ A;  3B89 A;  1WR1 B;  1G41 A;  1HT1 E;  1GO5 A;  2LVQ D;  3E21 A;  1OTR A;  1BVS A;  2JZ1 A;  1XXH E;  1IM2 A;  1C7Y A;  1OAI A;  1SG9 A;  1Y8G A;  1TR8 A;  2MGW A;  3E46 A;  4WP2 A;  1DO2 A;  1P3Q Q;  2OO9 A;  2DI0 A;  3FRI A;  2BWE A;  2LTU A;  2EKF A;  1VEK A;  4F1I A;  2HAK A;  3GLI E;  3GLH E;  3IHP A;  1YLA A;  2RRU A;  2H5X A;  3K9P A;  1HT2 E; 
#chains in the Genus database with same CATH topology
 1QZE A;  3IEC A;  3LCV B;  1T43 A;  5BR8 M;  3PXG A;  1KYI A;  4RF0 A;  2VF7 A;  2Y20 A;  3BOS A;  1OJL A;  3FUX A;  3GLH B;  3KOW E;  1ZMU A;  4XK8 F;  1W5T A;  3HHX A;  1E94 E;  3HU1 A;  5JI3 E;  3FE3 A;  5ITU A;  3OTO M;  2M60 A;  2Z4R A;  3E9S A;  3MJ5 A;  3SAV A;  2WSC G;  1NHW C;  5EXX A;  2WSE G;  2KZS A;  4JI1 M;  2UUA M;  4DUZ M;  4LRT A;  1QAO A;  2KNA A;  4XBO A;  4LJ4 A;  1IFY A;  1GL6 A;  2DWZ B;  2FH0 A;  4REZ A;  2XGN A;  5EXP A;  1IXS B;  3MMP A;  4AKH A;  2AHM A;  5FTN A;  1VEJ A;  4W5W A;  1ZAE A;  3LX3 A;  2DAI A;  1NSF A;  2MJ5 B;  2L2D A;  3RFW A;  1HQC A;  4L8R C;  3W68 A;  4NOO B;  4P17 A;  1XWI A;  1N3S A;  2DAE A;  5FLX S;  1XC8 A;  4CGY B;  3MHV C;  2QNJ A;  4IBC A;  4PD2 A;  2J5Y A;  4NC6 A;  4TUW A;  2HL7 A;  4QHT A;  4DV6 M;  2XH9 A;  1QVR A;  1VEG A;  2UUB M;  1I94 M;  2K9D A;  1NY5 A;  2W82 A;  1RU3 A;  2OOA A;  4LGM A;  3GPX A;  1XMQ M;  2JY8 A;  3A42 A;  5LMN M;  4HEO A;  3LCU A;  4AG5 A;  4DBG B;  1PM5 A;  3VEJ A;  4DV4 M;  4DU6 A;  4LJA A;  1G4A E;  3L2A A;  4G3O A;  2DZL A;  2QZ4 A;  2JP7 A;  1IN7 A;  3I2B A;  3H4M A;  1Z5C A;  2DAM A;  2LVO C;  3B0B C;  4WW0 A;  2YNM D;  4L15 A;  2UXC M;  4D82 A;  3LW5 K;  7CAT A;  2MH8 A;  3DA1 A;  4JI6 M;  2G3Q A;  3PVS A;  4LJ5 A;  4DR2 M;  1GTQ A;  3BMB A;  3UGJ A;  1JR3 E;  3HKP A;  3QWL A;  4MGY E;  4NSR A;  4QOS A;  5FTM A;  1QDR A;  3SMP A;  3GLH A;  4HLQ A;  4B08 A;  3GLG E;  3J7A S;  3AFH A;  2KEB A;  2CUZ A;  4MB7 A;  4IBF A;  4K0K M;  4B3R M;  2APL A;  3TE6 A;  3GRR A;  4QHS A;  5F3W A;  1IN6 A;  1PRB A;  1VG5 A;  1WJ7 A;  2B3T A;  2EUC A;  3SYK A;  3H4J A;  1DGG A;  4FVM A;  2F5Q A;  1IXZ A;  1QYR A;  1IY1 A;  1A9C A;  5DFL A;  4LZZ A;  3SAS A;  3WHL A;  2CWB A;  2DNA A;  3KVW A;  4CHT B;  1IXS A;  1TTE A;  1OKS A;  4OW0 A;  3GLG B;  2CV0 A;  4JI2 M;  3M6A A;  1GAB A;  2GQF A;  3EIH A;  4IBI A;  3ZQJ A;  5KPR A;  3JR4 A;  1TGU A;  1R5L A;  2QP9 X;  1V33 A;  3Q8X A;  3FTF A;  2Q2E B;  1H6U A;  2YQZ A;  3B74 A;  5EP2 A;  1OIP A;  2F5P A;  3ZCB B;  3A45 A;  3R8F A;  3SBJ A;  1NVM A;  2O01 F;  4JI0 M;  1HR0 M;  1HNZ M;  1W5S A;  5KPZ A;  3I01 M;  4DR5 M;  1PJS A;  2JA2 A;  3T15 A;  3JR5 A;  4WUR A;  1WUR A;  1OAI A;  2P11 A;  4WP2 A;  2BJV A;  2FOI C;  4Y28 F;  1DO2 A;  4GRI A;  4AI6 A;  1Z5A A;  2OO9 A;  1J7K A;  2K47 A;  3UMM A;  4G6Z A;  2KZU A;  4PDG A;  1E32 A;  1VEK A;  3QYE A;  2HAK A;  3KS8 A;  1GJS A;  4NTK A;  2H5X A;  4NRW A;  4DV3 M;  3U6D A;  2ZAN A;  1L2B A;  4LF8 M;  4ANR A;  1WPL A;  4RF1 A;  2VQE M;  2RGH A;  1J09 A;  1EIJ A;  3U6M A;  2UUC M;  3CF6 E;  1JQJ C;  5ITX A;  4M0D A;  2L7H A;  1QUT A;  3GRV A;  3HGI A;  2A5Y B;  2LHC A;  3AKZ A;  1IBK M;  4LG2 A;  4Q7J A;  5EP1 A;  4R8Q A;  3TWK A;  3SC3 A;  1HJP A;  1N75 A;  2G8L A;  3HY5 A;  4CIZ A;  1R2Y A;  1WIN A;  3TQS A;  4X64 M;  3KFU G;  1WIV A;  3U6S A;  3QN0 A;  3T6P A;  3U6E A;  2L7I A;  4RKU F;  3QYB A;  2A0S A;  4CJ6 A;  3GLG A;  4GIT A;  3GPU A;  2CEA A;  3WHK A;  1L1Z A;  2JY5 A;  3BXW A;  2VII A;  1R4G A;  4G4Q A;  1HQY E;  2FS1 A;  2FNA A;  1OQY A;  3LMM A;  2QCU A;  3LW5 F;  1LV7 A;  1ZMV A;  1R6B X;  2D7H A;  3KSJ A;  4KOD A;  4F2L A;  3U6O A;  4OVZ B;  3QN9 A;  2X8A A;  1DGF A;  4KT0 F;  4IBE A;  2JNH A;  3U6P A;  1L2D A;  3VKG A;  3AL0 C;  1L8Q A;  2DHY A;  2J7N A;  2JXN A;  1G8P A;  5FTJ A;  1NO1 A;  4DV1 M;  4I81 A;  4G4O A;  1NV9 A;  2X4A A;  1NNU C;  3B7Z A;  3GLF B;  1XB2 B;  2WSC F;  3FUV A;  3UZU A;  2WSE F;  4L16 A;  1K3W A;  1JR3 D;  1AIP C;  1VQ1 A;  1WHC A;  2X49 A;  3FUT A;  3HU3 A;  2G64 A;  1QAN A;  2C9C A;  3FUW A;  3HWS A;  4JXJ A;  5DMZ A;  4GC5 A;  2EKK A;  2RGO A;  3I4Y A;  1AUA A;  2N35 A;  1QAM A;  1GKI A;  1ZQ9 A;  2DAK A;  2C96 A;  3DZD A;  4KO8 A;  3HZJ A;  1HNW M;  1NHG C;  1Y13 A;  2RPB A;  4NSO B;  1OFI A;  4B3S M;  4NE5 B;  2KR1 A;  4YHH M;  2QEN A;  3AV0 A;  2MR9 A;  4HL4 A;  4KHP M;  3KSX A;  2C98 A;  5KPT A;  5C1B A;  2VQF M;  3I04 M;  2QQ8 A;  3FTE A;  3SAW A;  1I4W A;  1E9S A;  3A98 B;  3FTD A;  2KRU A;  3T1H M;  2LHG A;  4FVG A;  4NXN M;  5JI2 E;  4II7 A;  2PN0 A;  4AQY M;  1WM9 A;  4GKK M;  3K2L A;  5KO3 A;  2BJW A;  1JB0 F;  1T6O A;  2CRU A;  2ZAO A;  3LQR A;  2V1C A;  2XEP A;  2R65 A;  2QPA A;  1Z5B A;  1CUK A;  3AOE A;  5ITT A;  2GNO A;  5ITX E;  1OFH A;  1HNX M;  3K8Z A;  1DO0 A;  1DGH A;  3CTW B;  4OVZ A;  2DWN A;  4RNA A;  1YSY A;  3SHG B;  1QUS A;  3C3D A;  3BBZ A;  1XMO M;  2DWL A;  3B89 A;  3HJS A;  2WSF G;  4P16 A;  3UK6 A;  5EP3 A;  3SHF A;  3U6C A;  2E5L M;  1WR1 B;  1G41 A;  4Z6Y A;  1IN8 A;  1HT1 E;  3E21 A;  3GLI B;  1OTR A;  3GLF E;  5EXT A;  3KP0 E;  3CGW A;  3QAU A;  1BVS A;  3FYC A;  3D7J A;  4B3M M;  3GLF A;  2JZ1 A;  3HHY A;  1NNJ A;  1Z6T A;  2CHV A;  1C7Y A;  4LCB A;  1GL7 A;  1SG9 A;  1Y8G A;  1TR8 A;  3KOY E;  1D2N A;  1QZM A;  1N77 A;  2WSC K;  2WSE K;  1NJF A;  4BLC A;  1P3Q Q;  4R7G A;  4FWG A;  2DI0 A;  4DRB J;  4JI5 M;  2BWE A;  4LF9 M;  8CAT A;  4L4U A;  1QDT A;  4G4R A;  4LFB M;  3Q8G A;  3K92 A;  5KQ8 A;  3GPP A;  5FTK A;  2OBA A;  3K9P A;  4QNR A;  1S3S A;  4LY6 A;  3SYL A;  4LFA M;  3VK8 A;  4LJ6 A;  4DR1 M;  2C5R A;  4LF6 M;  4X66 M;  2VDB B;  3HJ8 A;  4QNM A;  1Q39 A;  4ITQ A;  1K82 A;  4KLN A;  1Q3C A;  2XSZ A;  5EXS A;  3VFD A;  2Y21 A;  2OQ4 A;  5IZ7 D;  3TPZ A;  4JI7 M;  1YE9 A;  2Y0T A;  5EQT A;  2MRO B;  1ZV1 A;  3JYG A;  2CV1 A;  2Z3X A;  1D0L A;  2HWJ A;  4LGY A;  4D81 A;  1N3T A;  2EA0 A;  3KS4 A;  2OPF A;  4NE6 B;  3I4V A;  1A5T A;  3W0L B;  1Q3B A;  3I51 A;  3PNY A;  4IBB A;  2J7O A;  3U6Q A;  4NTM A;  1XXH A;  1SXJ E;  1KSF X;  4DR3 M;  1R2Z A;  2CE7 A;  3LVW A;  4LJ7 A;  4AKI A;  2ZTC A;  4DUY M;  2DVW B;  1TF0 B;  1Q02 A;  1FB1 A;  2L4E A;  1PJJ A;  2LNZ A;  1PJQ A;  2LO0 A;  2QSF X;  4IBD A;  2JZ0 A;  3GRU A;  3GLI A;  3U5Z A;  2O5R A;  3RE8 A;  4UN2 B;  1IXR C;  2QHO B;  2WZJ A;  2KNV A;  2XSZ D;  2M5Z A;  2R46 A;  4MGI E;  4X62 M;  2H1R A;  2BWB A;  2O01 G;  1SXJ B;  4LF7 M;  4E44 B;  3TL4 X;  3F92 A;  2R0I A;  3AJI B;  3IG8 A;  1L1T A;  4DR7 M;  1MX0 A;  3GQ5 A;  3VDP A;  1XHB A;  3GQ3 A;  4EIW A;  1QQW A;  2DTT A;  2ZTD A;  1D0M A;  4IIW A;  2R62 A;  4IJF A;  2L4F A;  1NJG A;  4FD2 A;  1N33 M;  1XNQ M;  2LH0 A;  3C58 A;  2HHH M;  3BK6 A;  3KDS E;  3GO8 A;  1FBX A;  4NXM M;  1TFE A;  2OOB A;  3W0F A;  4QPM A;  2LNH C;  4NRV A;  1N34 M;  2DJ6 A;  1DGH B;  5ITQ A;  2LVP C;  3T1Y M;  3VLF B;  3K1J A;  1G71 A;  2EO2 A;  2LBC A;  3FKE A;  4G4N A;  5IRE B;  2O25 A;  1Z59 A;  3FD9 A;  2VF8 A;  4MGZ E;  3J7B A;  4Z8X A;  3TWM A;  2KA6 B;  5FTL A;  4E45 B;  1UM8 A;  2K0B X;  3D8L A;  4M9S A;  2FFJ A;  3B7Q A;  1N36 M;  3C3E A;  2Z7J A;  4MGK E;  4LRS A;  5IWA M;  4L6V 6;  2P5T A;  1MN3 A;  2XFT A;  1K3X A;  3QNA A;  3SMS A;  3KW6 A;  1DGB A;  4FWH A;  3EIE A;  4BBA A;  1IQP A;  3GPY A;  3U61 B;  1IY2 A;  2DXI A;  3HU2 A;  3RGS A;  4X65 M;  4FVF A;  4IBJ A;  3THG A;  4NE3 B;  2DAG A;  2F5O A;  3VK7 A;  2KNZ A;  2F5S A;  3LW5 G;  1IS8 A;  3RGP A;  3GQ4 A;  1T3T A;  2KW0 A;  4B7H A;  2V6Z M;  3U60 A;  5ITR A;  3CF2 A;  2R6F A;  4I8O A;  4DR6 M;  4LFC M;  4JYA M;  1SXJ A;  4JI8 M;  2UXD M;  2LVQ D;  1J5E M;  4JV5 M;  2CFO A;  2ERC A;  2I7N A;  1GJT A;  4LJ8 A;  1XXH E;  2JWS A;  5DYI A;  3M0E A;  2KXE A;  1FNN A;  1IM2 A;  1PJI A;  4B7F A;  3AOE C;  3E46 A;  2HKJ A;  5DNY A;  4YY3 M;  4DV2 M;  1B66 A;  4NTN A;  3KOZ E;  3JAM S;  2L6O A;  1WXQ A;  2ZM6 M;  3FRI A;  4GHL A;  1V34 A;  1YUB A;  3KP1 E;  2EKF A;  3FYD A;  5GKN A;  4F1I A;  3GLI E;  1N3R A;  2DZN B;  2F4V M;  2LWX A;  2R4E A;  4LF4 M;  2RRU A;  1XXH B;  3V76 A;  4QOZ C;  4DRA E;  4FWD A;  4L78 A;  2R4J A;  1HT2 E;  5IT9 S;  2WSF F;  3GP1 A;  5DYG A;  4A3V B;  1A8R A;  1WUQ A;  4R3D A;  3LQQ A;  1IN4 A;  4OX9 M;  1EL6 A;  1SXJ D;  2CHQ A;  1L2C A;  2C99 A;  3HJQ A;  3K9O A;  2Z8Y M;  1V92 A;  3U5Z B;  1ZMW A;  2F5N A;  2YFQ A;  1IS7 A;  3HX3 A;  1G3I A;  4I4L A;  1NV8 A;  3W67 A;  2K6B A;  1IBL M;  4I5S A;  1ORY B;  3R9X B;  4PCZ A;  3L27 A;  4D80 A;  2DEN A;  2DHR A;  3U61 A;  1VDL A;  2QBY B;  2KRK A;  4PDI A;  3FRH A;  5L8R F;  3D8B A;  2JY6 B;  3LZE A;  3J2P B;  2LVA A;  5C18 A;  2FE8 A;  4DV7 M;  4GC9 A;  1NY6 A;  1OAO C;  3SAR A;  2RKO A;  1B6Z A;  1DV0 A;  2BNK A;  1IBM M;  3U6L A;  4AG6 A;  5E6J A;  5ITY A;  5A2Q S;  3HHZ A;  2XZU A;  4CIS A;  2JY7 A;  4ZPX A;  4GH9 A;  2EJS A;  3NBX X;  1WGN A;  2XF3 A;  1KFV A;  2D7G A;  1FJG M;  4AZF A;  3LVV A;  3NWL A;  4FVJ A;  4B7G A;  5FSW A;  3ILK A;  2V1U A;  1EE8 A;  4IBG A;  2CP8 A;  3L28 A;  4DV5 M;  2XFS A;  2UXB M;  2XLJ A;  2LVN C;  4OU7 A;  4BB9 A;  4GKJ M;  2DKL A;  3M0N A;  1X37 A;  3VDU A;  2NQ8 C;  5E26 A;  2I7P A;  4S12 A;  4MGH A;  3VKH A;  2YR0 A;  2KHH A;  4PT5 A;  1WGL A;  3L25 A;  1GLN A;  2Y0Q A;  3NBI A;  2LXE A;  2DWM A;  2WSF K;  2R18 A;  3DOA A;  4DR4 M;  2ZAM A;  4MM3 B;  1EFU B;  1TH3 A;  4JN6 A;  3U60 B;  4LF5 M;  4GMQ A;  4GEW A;  1LTM A;  4M9Z A;  1E9R A;  2L09 A;  3M7G A;  4FCT A;  3SFZ A;  2ZBK B;  2C9O A;  1MU5 A;  3MK6 A;  5H37 D;  3FUU A;  3SAU A;  3UJN A;  1UFZ A;  3HHW A;  3A46 A;  1TH4 A;  2XZF A;  2R45 A;  3PFI A;  4AKG A;  4R71 A;  5LMU M;  1IN5 A;  4M0W A;  2QBY A;  4FCV A;  4JA3 A;  3E4R A;  1F4I A;  3SAT A;  2DZO B;  5BPV A;  2JUJ A;  3IG5 A;  1R7R A;  3ZH9 B;  2HCB A;  3C9P A;  1PGY A;  3PNV A;  4JI4 M;  3AOG A;  1GVN A;  4DV0 M;  1PJT A;  2KDL A;  4IBK A;  4AW4 A;  1GTP A;  1MJG M;  3KXE C;  5EP4 A;  3B9P A;  3B7N A;  3TWL A;  4GHA A;  1N78 A;  1IY0 A;  1VDD A;  1C1K A;  1TH2 A;  3L26 A;  1TDH A;  2CV2 A;  1GO5 A;  5EJC A;  4FW9 A;  3J27 B;  4LJ9 A;  4NL4 H;  4XGI A;  3J81 S;  1D0K A;  4IJE A;  1QAQ A;  2CHG A;  1JR3 A;  4MH0 E;  1G59 A;  3FTC A;  3DFZ A;  2MGW A;  3L29 A;  3J80 S;  2G5G X;  2D7E A;  4LZJ A;  4JI3 M;  2R44 A;  3GRY A;  1TDZ A;  4B3T M;  2LTU A;  4FCW A;  3T38 A;  3CF0 A;  2Z4S A;  3GLH E;  3IHP A;  3ZC7 B;  4GIP A;  1YLA A;  3KOX E;  4M9X A;  2UU9 M;  5KQD A;  1N32 M;  1SXJ C;  1XNR M;  1OIZ A; 
#chains in the Genus database with same CATH homology
 1WPL A;  1QZE A;  1A8R A;  3IEC A;  3LCV B;  1WUQ A;  1T43 A;  1KYI A;  1EL6 A;  3K9O A;  1V92 A;  1ZMW A;  4Q7J A;  1IS7 A;  1ZMU A;  2MRO B;  1ZV1 A;  1G3I A;  1E94 E;  4R8Q A;  1NV8 A;  1HJP A;  3FE3 A;  2HWJ A;  1N3T A;  1WIV A;  3T6P A;  4NE6 B;  1A5T A;  2DEN A;  1VDL A;  2KNA A;  2JY5 A;  1IFY A;  1R4G A;  1HQY E;  3FRH A;  2ZTC A;  3MMP A;  2JY6 B;  1OQY A;  1Q02 A;  1VEJ A;  2L4E A;  2LVA A;  1ZMV A;  4F2L A;  3GLF E;  1FB1 A;  2LNZ A;  2LO0 A;  2QSF X;  2DAI A;  2JZ0 A;  2MJ5 B;  2L2D A;  2JNH A;  1DV0 A;  2DHY A;  4UN2 B;  2QHO B;  2WZJ A;  2KNV A;  2JY7 A;  1N3S A;  2BWB A;  2DAE A;  4E44 B;  2EJS A;  2QNJ A;  3F92 A;  1WGN A;  2R0I A;  1NV9 A;  1XB2 B;  1VEG A;  2K9D A;  1AIP C;  1VQ1 A;  2CP8 A;  1WHC A;  2OOA A;  2ZTD A;  2JY8 A;  4HEO A;  3LCU A;  2L4F A;  2LVN C;  4DBG B;  3VEJ A;  4DU6 A;  1G4A E;  2DKL A;  5DMZ A;  2EKK A;  4G3O A;  2DZL A;  1TFE A;  1FBX A;  2JP7 A;  2DAM A;  3B0B C;  2LVO C;  2DAK A;  2OOB A;  4QPM A;  2KHH A;  2G3Q A;  4NE5 B;  2KR1 A;  1WGL A;  3BMB A;  2LVP C;  1JR3 E;  2MR9 A;  2LBC A;  1EFU B;  3GLG E;  2O25 A;  4GEW A;  4E45 B;  2K0B X;  1WJ7 A;  1VG5 A;  2B3T A;  5JI2 E;  3H4J A;  2PN0 A;  1UFZ A;  1WM9 A;  1A9C A;  5DFL A;  4R71 A;  1T6O A;  4JA3 A;  2CWB A;  1MN3 A;  1F4I A;  2DNA A;  2JUJ A;  1IXS A;  1TTE A;  1OKS A;  1CUK A;  1PGY A;  1DO0 A;  4NE3 B;  2DAG A;  2KNZ A;  1IS8 A;  1GTP A;  3BBZ A;  3B89 A;  1WR1 B;  1G41 A;  1HT1 E;  1GO5 A;  2LVQ D;  3E21 A;  1OTR A;  1BVS A;  2JZ1 A;  1XXH E;  1WUR A;  1IM2 A;  1C7Y A;  1OAI A;  2P11 A;  1SG9 A;  1Y8G A;  1TR8 A;  2MGW A;  3E46 A;  4WP2 A;  1DO2 A;  1P3Q Q;  2OO9 A;  2DI0 A;  4DRB J;  3FRI A;  2BWE A;  2LTU A;  2EKF A;  1VEK A;  4F1I A;  2HAK A;  3GLI E;  1N3R A;  3GLH E;  3IHP A;  1YLA A;  2RRU A;  2H5X A;  4DRA E;  3K9P A;  1HT2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...