The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
115
|
structure length |
105
|
Chain Sequence |
MKSRIIVRTSFDAAHAHGHTFFLEVAIEGEIKNGYVMDFLELRKIVEEITKELDHRNLNNIFENPTTENIALWIGERIRDKLPPYVKLKRVVLWEGKDNGVELEW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from Pyrococcus horikoshii OT3
rcsb |
molecule tags |
Lyase
|
source organism |
Pyrococcus horikoshii
|
molecule keywords |
Hypothetical protein PH0634
|
total genus |
26
|
structure length |
105
|
sequence length |
115
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2006-07-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01242 | PTPS | 6-pyruvoyl tetrahydropterin synthase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Tetrahydropterin Synthase; Chain A | Tetrahydropterin Synthase; Chain A |
#chains in the Genus database with same CATH superfamily 3I2B A; 3JYG A; 4NTK A; 4NTN A; 1GTQ A; 3LZE A; 1B66 A; 3D7J A; 2OBA A; 3LX3 A; 3M0N A; 1B6Z A; 1Y13 A; 4NTM A; 3QNA A; 3QN0 A; 3QN9 A; 2A0S A; 2DJ6 A; 2G64 A; 2DTT A; #chains in the Genus database with same CATH topology 4FVG A; 1XB2 B; 3I2B A; 1AIP C; 3JYG A; 4FVJ A; 4FVF A; 4NTK A; 4NTN A; 4Q7J A; 1GTQ A; 3LZE A; 1B66 A; 1EFU B; 3D7J A; 2OBA A; 3LX3 A; 3M0N A; 1B6Z A; 1Y13 A; 1WIN A; 4NTM A; 1TFE A; 3QNA A; 3QN0 A; 3QN9 A; 2A0S A; 3BK6 A; 2DJ6 A; 2G64 A; 2RPB A; 2DTT A; #chains in the Genus database with same CATH homology 4FVG A; 3I2B A; 3JYG A; 4FVJ A; 4FVF A; 4NTK A; 4NTN A; 1GTQ A; 3LZE A; 1B66 A; 3D7J A; 2OBA A; 3LX3 A; 3M0N A; 1B6Z A; 1Y13 A; 1WIN A; 4NTM A; 3QNA A; 3QN0 A; 3QN9 A; 2A0S A; 3BK6 A; 2DJ6 A; 2G64 A; 2RPB A; 2DTT A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...