The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
AMSYSLYGTTLEQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRSSR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein, oncoprotein
|
molecule keywords |
Protein E6
|
publication title |
Structural and functional analysis of E6 oncoprotein: insights in the molecular pathways of human papillomavirus-mediated pathogenesis
pubmed doi rcsb |
source organism |
Human papillomavirus type 16
|
total genus |
10
|
structure length |
67
|
sequence length |
67
|
ec nomenclature | |
pdb deposition date | 2006-01-04 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | CRO Repressor | CRO Repressor |
#chains in the Genus database with same CATH superfamily 2LJY A; 2LJZ A; 2LJX A; 4GIZ C; 2M3L A; 2FK4 A; 4XR8 F; #chains in the Genus database with same CATH topology 1D1L A; 2OVG A; 1D1M A; 1WU7 A; 4XR8 F; 2LJY A; 3ORC A; 3C6F A; 5CRO A; 6CRO A; 2LJZ A; 4GIZ C; 2M3L A; 1ORC A; 2FK4 A; 2LJX A; 1COP D; 2A63 A; 2ECS A; 2ORC A; 2CW1 A; #chains in the Genus database with same CATH homology 1D1L A; 2OVG A; 1D1M A; 1WU7 A; 4XR8 F; 2LJY A; 3ORC A; 5CRO A; 6CRO A; 2LJZ A; 4GIZ C; 2M3L A; 1ORC A; 2FK4 A; 2LJX A; 1COP D; 2A63 A; 2ECS A; 2ORC A; 2CW1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...