1WU7A

Crystal structure of histidyl-trna synthetase from thermoplasma acidophilum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
424
Chain Sequence
b'RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidyl-tRNA synthetase
publication title Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Ligase
total genus 117
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.240.30 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 1wu7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wu7A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1wu7A03
3HRKA 1B8AA 3UGQA 1BIBA 4XEMA 1NYQA 1EOVA 1KOGA 1W66A 3MF2A 12ASA 4YRKA 2XTIA 4H2TA 2DEQA 1FYFA 2E41A 4H2SA 1NJ8A 3ICAA 2C8MA 4LNSA 2EJFA 4XTVA 4XTXA 2ODRD 3V8LA 2DTOA 4XU2A 5C51B 2PMFA 4TTVA 4UP8A 4YRMA 4TVYA 4CH4A 4CS2A 4YRGA 4OLFA 1LYLA 4RQEA 3HXZA 3RF1A 4DPGA 2DXUA 3RKWA 1EVLA 1YB3A 3RIRA 2ZT7A 2P0LA 2I4OA 4J15A 4YRFA 4H2XB 4P73C 3RKXA 2J3MA 3L4GB 3NETA 3EFSA 2ALYA 4P73A 4HWSA 2QHVA 4RMFA 3REXA 1ATIA 3HFZA 4UPAA 3TEGA 4XU3A 4E51A 4WJ3M 1E1TA 1NJ2A 5HGQA 3A5YA 4AH6A 1N9WA 4P74C 2ZZGA 3UGTA 3A32A 2RHSB 3HTZA 2DU7A 4P74A 3BFMA 1YFSA 3M4QA 2ZXFA 1ADYA 2DVEA 3V7RA 2ZCEA 3EFRA 4O2DA 4H2UA 1HTTA 2E65A 3PCOA 4HWOA 4YRJA 4XU0A 3V7CA 3IG2A 1BBWA 5C53B 1X54A 3NENA 4X5OA 2DJZA 4YRSA 2QHTA 2J3LA 3VQYA 3FJPA 4H2YA 1WPYA 4CH5A 2DTHA 4P75C 4YREA 3BJUA 4YCWA 1KMMA 5ELNA 1USYC 2Q7EA 1BIAA 4G84A 4ZTUB 2E5AA 2ZZEA 3L2ZA 4YRPA 3REUA 1USYA 2Q7HA 2CJ9A 3HFVA 3HY1A 2Q7GA 4KR3A 2ZNIA 2ALYB 4PG3A 4YCUA 2EJGA 3HFZB 3P8VA 4TQFA 2IY5B 2I4NA 2ZGWA 1B76A 1H4SA 1V95A 2AKWA 2I4MA 2ZINA 1HXDA 1RIQA 1G5IA 3HXVA 3VQVA 1IL2A 5K1XA 3RGLA 1X55A 3QTCA 3TEHA 5E3IA 4WF2A 4YRNA 1E1OA 2DDZA 4P71C 4YRLA 3LC0A 3PCOB 1EQRA 3OD1A 3W3SA 3I7FA 3QNEA 4P71A 1E22A 2ZT8A 1WLEA 2ZIOA 4CS4A 4BWAA 1PYSB 2RHQA 4P72A 1SERA 4DQ2A 4ZTZB 4HWRA 2QHSA 2QHUA 1YFRA 3HXXA 3WQZA 2IY5A 3DSQA 4XTZA 3RACA 1HC7A 3HXUA 3QO8A 2LW7A 1J5WA 1G5HA 3TUPA 3VBBA 1NYRA 2E1HA 3UFGA 4YDQA 4Q6GA 4XU1A 2ZR3A 3M4PA 3A7RA 4KR2A 4TVAB 1G51A 3P8TA 4H2WA 4HWPA 4YP0A 1B70A 4RQFA 2AKWB 4HVCA 1PYSA 3MF1A 3ERRA 3G1ZA 4XTUA 4P3OA 3RKYA 1X56A 1H4TA 2DKGA 1NJ6A 3TEHB 2CJAA 4G85A 2DQ0A 2DU5A 2AMCA 1BBUA 1JJCA 2EL9A 2XGTA 3MEYA 1EVKA 1NJ1A 3QO7A 2ZZFA 3VQWA 3LSSA 3HY0A 2RHQB 3E9IA 3NEMA 4TVAA 1ADJA 4XTWA 4HA8A 1WQ7A 5KNNA 3IALA 3QO5A 1B7YA 4TQDA 3V8KA 4YRIA 4CS3A 1NJ5A 2FYKA 3IKLA 3A7UA 2PMEA 2I4LA 1NNHA 2EWNA 2CGHA 2ZT6A 1SRYA 2ARSA 2DXTA 1E24A 3IKMB 4H02A 2ZR2A 3NELA 4TVWA 5C52B 1B70B 2ARTA 4P72C 2DZ9A 3A5ZA 2ZTGA 1WQWA 4XTYA 4EO4A 3LSQA 1QF6A 4HWTA 2Q5HA 1Z7NA 3A7AA 3R07A 2E64A 2AMCB 3A31A 4Q15A 1X01A 2HNIA 1JJCB 4L87A 3VQXA 1C0AA 1YFTA 3PZCA 4BW9A 1ASYA 2E3CA 4K88A 2ODRC 1EIYB 1WU7A 3KFUA 5ELOA 2E10A 11ASA 2ZT5A 1SESA 2Q5IA 2P5IA 1EFWA 1B7YB 4OP0A 4WI1A 4YPFA 3P8YA 4YRQA 5F5WA 4RDXA 2C7IA 2DTIA 4NCXA 4CH6A 4KQEA 1H4QA 2ZNJA 3V7SA 3RUXA 4WJ4A 4XEOA 1QE0A 1L0WA 4EX5A 4P3NA 3HXYA 4P3PA 1GGMA 2G4CA 1Z7MA 3UH0A 4CH3A 4H2VA 4TWAA 3E9HA 4H2XA 4K86A 2DZCA 3L4GA 2EJ9A 4YRCA 4ZIBA 3CMQA 1WYDA 2DQ3A 2CJBA 4YRRA 1EIYA 1ASZA 1X2HA 2ARUA 4K87A 3HXWA 4UP7A 1YGBA 4YYEA 3L1AA 1H4VB 2CIMA 1WNLA 1X2GA 5K1PA 3RL6A 2ZIMA 1SETA 4PHCA 4YCVA 3V8JA 4P75A 1KMNA 4UP9A 1VQZA 2RHSA 3A74A 4YROA 2EAYA 4YRTA 3HRIA
chains in the Genus database with same CATH superfamily
3AFMA 3AW9A 3HRKA 4XIFA 3W79A 3KVNA 1WS6A 2Z3ZA 1CNEA 2ODQA 1K7FB 2WV9A 3K6SA 1FSPA 3BIXA 1ZX1A 4GR5A 1IL0A 1Q77A 3RD5A 3HCRA 3DL0A 1JNXX 2XYGA 3D4OA 4PNPA 2QZSA 4O3MA 4G1BA 1A9ZA 4BCCA 2DFVA 3DKIA 3ETEA 1FYFA 3G2OA 3VHRA 4K46A 5TQVA 1NASA 4AYXA 4UTVA 1PVOA 2Q6LA 1NJ8A 1RAEA 2H1HA 4DMUB 3CT4A 2FN3A 1MBZA 2VZEA 3LY9A 2VPIA 1ZRHA 2G07A 1IU9A 1NG1A 2PLRA 3C8MA 2M6LA 5KOJA 3PDUA 4H77A 1VL0A 3FGNA 1QZXA 3MTAA 3HL4A 3ITEA 4LZOA 4WRRA 1JIXA 4U00A 1DKOA 2G77B 1L4MA 1O3YA 2DKNA 1DG9A 4NU5A 3VC2A 2VHCA 4Z5XA 3TECE 5JDCA 1MTZA 5H16A 1YIOA 3WL3A 4D8UA 3UFBA 4HX2A 1NQ5A 5SYMA 4MJXA 1M1ZA 1I1HA 4M49A 2ONKA 4NATA 1FEZA 3EFBA 3I2JA 5DXAA 1DHTA 1NLFA 1JH8A 3PLRA 2FMKA 3CWQA 5B36A 1IBCA 2Z6VA 3ZH9B 1U5AA 4D0RA 2WPDD 4BO5A 1ZN8A 4R7TA 1DDOA 4B6JA 4RKEA 5J4HA 4UU8A 1Q1ZA 2IHBA 4FLMA 4V0NA 4X3CA 2II6A 1LLQA 1N75A 1R6XA 1LA2A 1T34A 2I33A 2OB1A 3NEAA 4J3FA 4NESA 3UBMA 4QJ5A 4JQOA 4ALLA 4KZKA 5BVHB 3E7PA 1WQ3A 4O4HF 4X93A 4TM7A 4Z9YA 3DFZA 4OL9A 1GARA 4OGFA 1EA5A 2QMUA 1WZ2A 1GZDA 3BMOB 4P80A 5D2CA 1CFZA 4IRMA 4XTRA 4OK5A 4P73A 2ZI3A 5EUQB 5IBCA 4PZZA 5FV4A 5K20A 3N8KA 2BFCA 4L5CA 5A02A 2H11A 3HFZA 4OHVA 3THXA 1NY5A 5KMGB 3WIBA 5CVEA 1GO2A 2I7VA 2Q6VA 4CG3A 1IZ8A 4C3OB 2WD7A 4QSHA 4B8YA 2RK4A 2R7AA 1DTWA 1XQ1A 1FNMA 1PGOA 3GLQA 3GYGA 3KVYA 3QF4B 4OGLA 4X8LA 1Y7PA 5BN4A 4A27A 4EMBA 3IP3A 3QI7A 5L8VA 3FPEA 1JP7A 3IEMA 1UANA 1WP9A 1FS5A 2VNSA 3H65A 4J6FA 4RQTA 5CB8A 5FOQA 2AFIA 5M7EA 2QRGA 3ISJA 3T54A 3OUZA 4CM9D 1BOOA 2XX3A 2XZTA 2BN4A 1D4AA 2AJTA 2SKDA 3D7NA 4U2DA 3UWOA 2C2WA 4Q7KA 3OIYA 4B7CA 2V54A 5TJHA 3EOZA 1OLSA 1XYVA 2OGTA 1YFSA 2HDHA 3DCNA 1HYEA 2ZXFA 4GRDA 5AK5A 4C0WA 5BNTA 5IANA 1C0LA 2JBAB 1YZNA 3ORRA 4FYIA 5BSUA 1M1UA 5KQLA 2JIQA 2F6RA 3DEHA 2X7JA 3KNZA 2P5YA 4H7PA 4Y9SA 5J9FA 2YWCA 1ZINA 5TPZD 5G0UA 4I50A 3V7YA 2X5NA 2QRLA 4HX5A 5F3DA 5DBFA 3W05A 1EINA 2WA1A 3TOCA 3VYVA 3B78A 4E2WA 1PAUA 2JFVA 4BMYA 2ZANA 5F2EA 2MMCA 1NATA 2GEVA 3NWOA 3A3YA 3SVLA 1Z6PA 5C53B 1GRVA 2C2BA 3UW3A 5IKXA 4JBHA 2OZLB 4XYMA 1DWUA 3DT8A 6ADHA 4EB8A 4DQLA 2ATCA 2ZI4A 1MEOA 4BQOA 4ALIA 4CF5A 1WULS 2HQSA 4LFBB 2I6FA 4QGFA 1LLUA 5B7QA 4NYIR 5DI9A 1SUAA 4YV7A 4QQFA 1VOTA 2DTHA 1KK3A 1RXSA 1HTBA 2BH9A 2G9UA 4KGDA 5EZ5A 5IZCC 2FZKA 2FR8A 1YCGA 1TGYA 4I4CA 3G13A 2R751 3QU5A 2IW1A 1BIAA 1UK7A 4JU8A 1R5BA 5ESDA 1A9TA 3B1KA 2Z6UA 3DNMA 3QVGB 4E3ZA 4QDOA 1P2DA 3B7WA 4GF5A 1T5HX 1W8IA 3HXKA 4O2BA 2X8JB 3P2EA 2GS9A 4UCQA 1W4RA 2CJ9A 2C29D 1CT9A 2AWOA 2PBFA 3EPRA 4FJ0A 4OQEA 5ALTA 5E7QA 2NU9B 2QX9A 3WXMA 5C7YA 1RHJA 4ZHQF 4RTNA 4RBNA 1OAKA 2V97A 4OL0A 2PZBA 5DW3A 3O7MA 1N9KA 3KT6A 4FFSA 5I01A 5KYGA 5A9TA 4QFMA 2O1EA 3ELDA 3LCUA 5I7WA 1IDOA 1N4DA 3UMRA 3GT7A 1EWQA 3TTSA 3PDIA 3ZDQA 1WTCA 4QYSA 1EWRA 1Z4LA 2B8NA 3VOSA 4B76A 5LN1A 4TMWA 3EY9A 1ZAYA 5C7IO 2IDKA 1CIVA 2IEDA 4LZLA 3C2QA 2VTBA 2YTZA 4KRXA 5IBQA 1M66A 1TK9A 2IDMA 4TSFD 2Z9DA 1PWHA 2YQ4A 4F8EA 2NU8B 3QHAA 1E1NA 1RJGA 1DCKA 1Q0HA 1SKMA 2CWWA 5G53C 1K7CA 3VR5A 3VZSA 3BBPA 2FPIA 3K9NA 1CK4A 1ECJA 4NARA 4WGFA 3OPVA 5KU1A 3VQVA 3SZGA 3ZWOA 2E82A 4I4TB 3KT8A 4HNGA 4NCJA 2HU8A 3I6ZA 5DNAA 3OEED 3RVRA 2IDZA 3B6MA 5B7PA 3CSSA 4GEGA 4K2AA 1G6OA 4BQEA 3K16A 4KMMA 4EY5A 4M2LA 3S2SA 2XB6A 3OLYA 3ZWNA 4P71C 3VKFA 3QWIA 2WILA 2PRJA 2P65A 2WSIA 3BIJA 2FMFA 3D6TB 4KXMA 2EKQA 2WHYA 2E1RA 3C87A 5H68A 4C30A 3TW8B 4F93B 2XUOA 4DEVA 3I92A 4AP5A 1PWEA 3O83A 4N12A 1DEXA 1Q7RA 3Q85A 1BX0A 1MVNA 5EQJB 3VC7A 3QNEA 2V45A 1NF2A 2YS7A 1KZ4A 2XHEA 4DMKA 3MJEA 3N7AA 4RCYA 2DLDA 1BJKA 4K9DA 5SV2A 4EAQA 3KWLA 2H07A 1Y7IA 4H31A 1M33A 2Q4BA 3O31A 3RI3A 2RAVA 4BNHA 3IMKA 3RYIA 4PYMA 5EJ2A 3K0CC 2BCEA 1OA0A 4W5NA 2J33A 1F51E 4GW3A 5E1BA 4ERNA 2RD2A 1DUSA 2LV8A 1STOA 3D2BA 4RA9A 1F2UB 3H5NA 4S1NA 5KJEA 1JPUA 1K92A 4AJ1A 5E0OA 2ZB8A 2H48A 3QH4A 2N42A 3DSQA 3C1TA 3N0WA 1PBNA 3JQPA 3G2JA 2HH9A 3MUFA 3NHYA 5EJEA 4QE3A 4BMCA 5CNIA 4GOMD 1HO3A 3QO8A 1UWVA 1FY2A 2H5JA 3MINB 3R9KA 3FIJA 4HAYA 4K0KB 3OOEA 1T2DA 3TUPA 1XRSB 2YS6A 1E4EA 3AF0A 3ZHYA 4CR7A 4MUYA 4DMGA 3LRTA 1U2TA 4WGGA 1FYDA 5EIBD 4L8VA 1QU2A 4OQXA 2W0SA 4V3CA 1UFVA 2EX0A 3CEJA 1Z68A 4DTIA 3CXUA 3G5UA 3STVA 1CUVA 5ESXA 1EZ1A 2XAUA 4IIJA 2O6LA 4UQLA 1AHNA 1F2DA 1U28C 3HXLA 4B34A 1HK7A 1LS6A 1X8XA 5AKEA 4YUYA 2QIPA 2WJIA 4BNXA 4FE3A 2XKKA 5KJFA 1DMSA 1NLMA 1YFZA 2FMXA 4GP6A 1BX1A 4IPTA 4MW1A 4UUOA 2NWQA 3RRJA 1QHHB 1VPDA 4Q3EA 1HWYA 1KEPA 2PG3A 2ETXA 3A58B 4OH7A 4RF5A 4RNDB 4RLQA 3A1TA 3VQTA 4XWTA 1U1EA 3PK0A 2GF2A 2RHJA 1I3CA 4BEVA 1IXSB 4Z49A 2BYTA 3ZD6A 3AJAA 5GAJA 2JI4A 5KTNA 5A06A 3LXMA 3B1YA 3L7CA 4MI1A 1H6AA 1QK3A 5JG7A 3V8VA 4COOA 4DLTA 1ZSYA 4F9EA 2IH5A 1HMYA 3IELA 1IHYA 3OIUA 1I6LA 1P5RA 2VTVA 1DGQA 4JELA 4EEZA 1T2UA 1N32B 4RE6A 2XNCA 2HR1A 1D07A 3D8RA 2Q8NA 4KK3A 2JCBA 4F56A 2O8CA 3H11B 1AOXA 2F3PA 4ZRNA 4EA7A 5JS1A 1X70A 2HU2A 3IX7A 4W5WA 1QHSA 3WHPA 1XHFA 1W0JD 2G67A 1L0BA 3PQ6A 4FGJA 3JALA 1U8UA 2B34A 2WTAA 1OLXB 3SCZA 3OO1A 3SM3A 4A9AA 2OV3A 1H2XA 1OPXA 3ILVA 1SY7A 1VIVA 4IFEA 3U81A 5FTLA 4HN4B 4MGHA 4DMFA 5L40A 1LPMA 2RHQB 3EEIA 4GI7A 3DBIA 3UO8B 2F90A 2YUTA 4WFJA 5A05A 4KXLA 3MOGA 5U1PA 3REOA 4B85A 4CKZA 3VMFA 3LZCA 2VDWA 1AS3A 4B7UA 4Q4AB 1KR2A 2AYXA 3OA2A 1X7XB 2H65A 4CIXA 2AN5A 2FGJA 4IJ5A 2R5NA 1ISSA 3BMXA 3LK7A 1LEHA 5JWRA 3THYB 3UICA 3PGA1 3A3OA 2HU5A 3F5MA 4X84A 3NH9A 2GYYA 1OV6A 5TS2A 4EG0A 4QG7A 1U7OA 2QG6A 1VBNA 2ZRGA 4CG0A 3AR9A 3VOBA 4TKZA 5H02A 3G0BA 4S0XA 3HJFA 5E3HA 4KV9A 3RFXA 1I1NA 1WXIA 1U2EA 3UTDA 1EDDA 1NOKA 4N5LA 1FQKA 3B8EA 1K4KA 4KITB 2JFGA 4Q19A 5BYBA 3IAS6 2WG1A 3O8QA 4KSBA 1RLMA 1NNHA 3VSCA 3UQYS 1HE5A 2ZSFA 4JC0A 3GH1A 1T0IA 1QH1B 2WK1A 3WL6A 1JVSA 3FI9A 2AH5A 2ZE5A 3GNQA 3VZBA 3LU1A 4YCLA 5IF3A 2FZEA 1W88A 4QX6A 1NR7A 1J7KA 3Q8LA 1VMKA 3ICPA 4GM0A 1WDTA 4HQ6A 4J75A 4YCNA 10MHA 2D5IA 2C8KA 4AZSA 3OICA 4EYQA 1KRXA 4RGBA 2YYYA 2WKWA 3RKRA 3ZI4A 3WNBA 2FN9A 1H8EA 3QXSA 4U5QA 4D9MA 1CX9B 3QNMA 1IUOA 1LQUA 2WF5A 1SUEA 4MV6A 2QUIA 4K6KA 4ZGBA 2PX5A 1D1TA 3C6XA 2FSVC 2JIZA 5J59A 2YFHA 3NDPA 1HEUA 3OQVA 4MVJD 3DPUA 4I55B 4HD8A 1PYDA 3I04A 1SZCA 4AIIA 3SC4A 1C8KA 1A4XA 2OCKA 1X0VA 2ZJ3A 1T3TA 2ZYAA 3LUAA 4I08A 3CZ4A 3LUCA 3W78A 3ZWPA 2ZGVA 4J3NA 4XFJA 3OI7A 1L7AA 4DC0A 4MS4A 3Q0IA 2QHXA 2FFAA 5LA6A 3WNQA 3RU9A 4AO6A 4P54A 3QLVC 2GN4A 5CFNA 1YB7A 3TLMA 4PFQA 1VL6A 1V5IA 3U19A 4KPFC 5FTJA 4NHOA 1BW9A 2I3ZA 1SXGA 2IE8A 1LDBA 2C20A 1PFQA 2QX8A 4YP6A 4J29A 2BH2A 3DCIA 1LH0A 3L8DA 1VE5A 5C0OE 1JFVA 3IKVA 2GH1A 1GZ7A 3IAAA 1PR1A 4XX0B 3L6BA 3U26A 1OHHA 3G0OA 5HZHA 4UEOA 4MKXA 1NV8A 1PTJC 1H0RA 4NAVA 4QFBA 1C2TA 4WI1A 1N25A 2CLLB 1C9NA 3UIEA 5IAGA 5K3SA 1E8MA 2WD9A 1I2MA 3GEMA 1IY2A 2PSHA 3JTEA 4O1IA 5NLLA 4EHIA 3FOEC 1BMFA 2ZJ7A 2YNMC 1VDMA 5BYJA 3C1UA 3JCZA 3LKBA 3ICQB 1MV8A 3ZWCA 1MLDA 2EP7A 3ENVA 3GJZA 3HJTA 3DTVD 4NYJR 1PEDA 5JZOA 3ESQA 1CQPA 1K89A 1CUUA 2VCHA 3KFVA 4O8ZA 2B35A 4GC9A 4QM7A 1W6UA 2GEBA 2XCUA 3PGLA 2D0OB 3BRQA 2WP8J 3F97A 2E5WA 4ZOCA 3RWBA 4K28A 3V4VB 4RFLA 1FDIA 5E6RA 1OYYA 1Q1BA 3NCTA 1WB5A 4LWQA 5KVCA 1B8VA 3B60A 3GLIE 2R6GA 2VAVA 4EX7A 1T24A 1NT4A 1NLUA 1Z22A 2CBZA 2F17A 2QXUA 2PVPA 1EWTA 1JPVA 5D3QA 3SQMA 4K86A 4F2GA 4HNUA 1PNOA 2AMYA 2C9CA 1DAIA 3VNRA 2D2VA 3QUBA 5EHNA 3SXUA 4OP3A 1XJCA 2JH9A 3I73A 4ENVA 1W6RA 3ABSB 3F1KA 4PRZA 1JDTA 5JNTA 2J9FB 1P73A 4K9KA 3JD1A 4PYQA 4UPEA 2GN9A 2HF8A 1ONPA 4O5AA 3ZDEA 3N3AC 3B1ZA 2CNLA 4BU1A 4YYEA 1OC4A 4UTXA 1Y8ZA 4RLFA 1A7UA 3WGVA 1P3JA 1XJQA 1APBA 3PXAA 3B7GA 4GFDA 4ALMA 2RHBA 4F97A 2Z6AA 2WLSA 1SU6A 2JG3A 1U11A 2ZIMA 5LJLA 3WFZA 3FR8A 5K09A 4QD3A 4MK4A 4YRZA 3QE9Y 1CJMA 4YFVA 1Y8RA 4D44A 1A27A 1WE2A 2PGLA 1I8TA 1ULSA 1R1DA 5JFTA 4NOJA 4JBYA 5JSUA 1QRSA 2G9ZA 2O48X 2D7JA 2BMVA 3L6EA 4IFIA 1OBHA 4J07A 1FNDA 2OFFA 2BI4A 2C3PA 2PX4A 2WKSA 2OYSA 1G41A 3ONNA 4TV8A 2WF9A 3WAGA 4YJHB 1AQ6A 4JC4A 4EI2A 4Q7QA 2EDAA 5DCYA 2VQEB 2G1PA 2W8BA 1JQDA 5EZSA 3WQBA 2IHJA 4FGSA 3DWFA 2WKQA 4NMHA 4C4OA 4TXHA 4OI0A 5DHUA 3OIGA 1E94E 2KS6A 1N2CB 3BAZA 4C03A 3O21A 4LXQA 3KZOA 1VCOA 3LK6A 4M8IA 4KYTA 4Y7CA 3THSA 3HXOA 1HE3A 1TQ8A 2YWGA 3UKJA 5I7RA 1FSZA 2O07A 4IJUA 3PX3A 4MKRA 5HF6A 3UK6A 4DRZA 4ESOA 1TF5A 2IP2A 3DFUA 1DLIA 1O6BA 1M6YA 1VGVA 3MLBA 4OXIA 3PQ3A 1T5IA 3OPYI 3MCUA 3M9LA 2YXBA 3OH8A 4AJ9A 3K9LA 4Z2YA 3FHJA 4N65A 4XU2A 2OG2A 4IHQA 5HF8A 2ECKA 3ZHTA 5IP5A 2IK8A 3MTIA 3OZEA 3WV4A 1GFIA 4EABA 1FSSA 4G0YA 4D8WA 3HXZA 1XCMA 4TPKA 3HKCB 4F85A 4DPGA 1TM1E 1P75A 2HDWA 2HJ9A 3IB6A 2XUFA 3CH7A 5KCMA 2MIIA 1SKBA 3NBKA 3M8KA 4BPRA 1HZZC 4Q9IA 3SXJA 2A5YB 1QHFA 1E1QA 4IDHA 4R9UC 3K94A 4UM9D 2LCFA 4N82A 4CEJB 2BZGA 3IXMA 3UBTA 2VEDA 1FYEA 2VBGA 2H4FA 3L0CA 3NT5A 1JNYA 4WADA 1TUBB 2HA2A 1Y5NA 1V96A 3REQA 2JF0A 4V0RA 2P78A 3KYDA 3UXMA 5CB6A 4HVTA 3H4VA 2BY4A 2B2XA 2QQEA 3M5PA 1A8IA 4KHZA 1E61A 1KZGB 4HXEB 4B2LA 4MV8A 5CDSA 1UBMS 4HN2A 4L2IB 1JEQA 4L8YA 3S99A 4XWOA 1IZ0A 5I45A 4UUNA 4CFSA 3VR2D 4Z1OA 2AUMA 2AFVA 3GOQA 1Y9EA 4XIGS 5I8PA 1GQRA 3RROA 3GJXC 4TMVA 1J23A 2I3GA 3LI2A 3QEMB 4JBXA 3TR0A 1Z6TA 4OUDA 4UPAA 4XU3A 2GN1A 3N2GB 5AQ1A 1E1TA 4EPWA 3U7QA 7AT1A 1PV1A 1N2OA 1E79D 4IOJA 4UAVA 2QNRA 5HJEA 5KI6A 5HYVA 2WR8A 3ABIA 4WZBE 1H9AA 5GZ6A 1QFMA 2FZWA 4FFMA 3N7UA 1W1UA 5BV8A 1E89A 3JWHA 3IV7A 1UBEA 4AKSA 3SX2A 4PGFA 1CY2A 5LXTB 1U0EA 4PQRA 3HTZA 4B8ZA 3WRYA 1X15A 2YINC 1UM9B 2YY7A 1ORIA 4CR6A 4GSLA 1BKYA 4I1OA 2OB2A 2GVNA 1TRKA 5HCUA 6GPBA 1UMCA 1CY4A 2PZAA 2ZZKA 4O29A 1Q15A 3O1LA 4TKUA 1ORCA 4XI9A 1I4DD 2X6QA 1W4BA 2BCGY 3G8BA 4M0EA 3HDYA 3RPEA 2AVNA 3KFLA 4KLZA 4J1SA 9LDTA 3MEQA 3TFQA 2JDIA 3GVXA 4U2BA 1DAFA 3I5UA 2RHLA 3H16A 1GP2A 2LP4Y 3PFIA 3PPXA 5IMBA 4P22A 3CF0A 1HTTA 4NR0A 4S2UA 1WDWB 2NU7A 3A06A 3FPAA 4G4SP 4PO8A 4DV6B 4RZHA 1V41E 4Y6RA 2IXBA 4LN1A 2R60A 4YRJA 3EIHA 4Y0VA 1U8TA 4DA6A 4BPBA 4CU2A 1EFKA 2OA0A 4KQWA 2EKLA 1CJKC 4PAGA 3LZDA 1YRHA 3NHMA 1LV8A 1NXSA 4J7AA 3S70A 3TE6A 5I48A 4NFSA 3PUWA 1IBLB 4XR8F 1G18A 2IUEA 2XWSA 3WMRA 3B1VA 1TAHA 4BNNA 2NXCA 4TXLA 3EGEA 3ZBPA 1IONA 3FTCA 2QHTA 1KS2A 3V1YA 2BBSA 1QZZA 3AP2A 3KJNA 3ONDA 1JA0A 3EUWA 3H2BA 2ZPUA 3CUYA 3AJ8A 4A36A 1KPGA 4KFTA 2GZHA 2AOVA 2I71A 5EXTA 3RM3A 1QRTA 4E6EA 3D6MA 2G3YA 4XZ3A 3GLVA 1JWAB 4YREA 1CY7A 2BFPA 3D8NA 3RUAA 1PS8A 2HHJA 3A9UA 3KS9A 5IAKA 4EF5A 4K9OA 1KJZA 4IZIA 2TMDA 3HCAA 4IS2A 5DXJA 2IBSA 2YICA 4BRWA 1TA4A 3K9GA 2F3TA 4HNAB 3M6AA 1GEEA 2I0FA 2IEIA 3ROTA 3H1FA 1LPAB 1O96B 3USES 1PNQA 2PWAA 3ZHUA 1SRQA 4LJ8A 1ACJA 1ZEJA 3HY1A 2VC2B 3C3BA 3EGXA 3OX2A 1XD2B 4GPZA 3BGSA 2WUVA 1RWXA 1Z83A 4PGMA 2RGEA 1SKYB 1HORA 1QS0B 4P36A 4QUKA 3SLGA 4ENPA 4OIFA 3KJXA 4R54A 5JWHA 3WO0A 2GNPA 1GRCA 3A4NA 2J7PD 2CVFA 3ZY3A 1ZYUA 3FDJA 2D3TA 1JF8A 1BC5A 3MSXA 1N7IA 4J2OA 1T5SA 2WZCA 3GUVA 3PIDA 1VHTA 2IIBA 2F00A 4JIGA 4MRVA 4WNAA 1L5KA 4BX0A 1Q0UA 2AEEA 3QVJA 1ODTC 2BBTA 3EN0A 2CXQA 4Q9NA 1Z8NA 1P31A 2DLCX 4YY3B 4JBGA 1TTHA 1XXLA 2JAWA 1K9SA 3JV7A 3SQWA 1R50A 2X4IA 3MUEA 4NDZA 4RK6A 4G0MA 1LGYA 4RTLA 5K01A 2ETVA 3TF5A 1OA1A 2FMUA 3AKZA 4XXHA 1I7PA 1T10A 2WFLA 3N1UA 2IZZA 4UC0A 3W4KA 2AZTA 3DZCA 4FMCF 1WB6A 5TMEA 5DPMA 3V80A 1R8SA 1TVEA 4ZKEA 3CRVA 3NNDA 1INLA 5H59A 3RGLA 3FYDA 4IEFB 2QE6A 2QZ4A 5AICA 5G2OA 3TMAA 3ZHVA 1Y7TA 3QWHA 4K26A 3EHEA 2GR9A 4B46A 3GFOA 2BSXA 2VUSA 1Z29A 2IYQA 1I7LA 3TXYA 2BHRA 3QVOA 1KBZA 2XQKA 3W04A 4WF2A 3F8TA 1MC1A 1HYQA 1ZH6A 3W3AD 2FLWA 4MV3A 3LC0A 5IWCA 5KTSA 4LWZA 1A82A 4QJBA 5JBNA 1E8DA 3L8GA 2HCTA 3JVIA 5JD4A 1KEVA 2C4WA 4F9TA 1EQRA 2WNHA 4JFRA 2CFSA 4TLMB 1V39A 4G23A 3J7TA 4TN5A 1V6CA 1IE3A 2EGUA 1Z2AA 4CS4A 1ZPDA 4LHYA 4KN5A 2QR5A 1LUAA 3M70A 2RGYA 5G41A 4AS2A 4KREA 2JK0A 2Q0QA 3B51X 3MCWA 1E0DA 4A0HA 2W2KB 3UATA 3ZVRA 1ETHA 2UVDA 2O3UA 3LUBA 1E3LA 3PZRA 4R1MA 1NVTA 1Z4MA 2FAXA 3EXFA 3K09C 2CBGA 2QGFA 4HN9A 4KDFA 5EHGA 3S29A 1A7JA 3D2AA 2QHUA 3EXEA 4MB0A 4LV5B 5IAOA 3OZIA 1DX4A 1GG2A 2WZBA 4HADA 4JLPA 1OJLA 5IDXA 5JTUA 4J8PA 3V8NA 1JTEA 1XCPA 1C1DB 1HL3A 1RMTA 1Z6YA 2P9JA 2RH9B 5F2KA 3B9PA 3G6WA 4JUCA 4QYTA 3TQTA 1P4JA 2FWRA 2XYHA 4F5ZA 1IMJA 2R1VA 4JIMA 3HLTA 4L27A 4JR0A 1H6BA 1NR5A 4W7SA 3OOYA 3V4PB 3HJUA 3L7LA 2QP4A 3AXTA 3A0UA 3LYHA 4I9HA 4ZVKA 4EX6A 3THOA 5KWSA 2FPMA 3I01M 1RCTE 1S3IA 5CXSA 5AJUA 4PHGA 4BAGA 4BQQA 4E5YA 3IXLA 4US0R 4LWOA 5FOSA 5KC9A 4IMJB 2HNKA 1P6QA 4AN1A 1A7KA 1QVRA 5DBEX 4EFNA 3OOSA 1ZDMA 4NZ9A 4YS6A 3VMMA 1EU1A 1BS1A 1U65A 4WUTA 1VSVA 4K9RA 2CKMA 5AM2A 5HILA 4O4IA 3BFXA 3O03A 3L7AA 4OJKA 4PPQA 4HWGA 3K8YA 1QR2A 2Q7DA 2BMWA 3VFDA 3WK5A 3QYJA 3L0PA 2ZI7A 2NO0A 5K03A 3HVHA 1SVIA 1M73E 4O4JA 3ZCVA 1PT8A 3ADBA 1S9DA 2A33A 1DAEA 3ENKA 4NK4A 3VNSA 2O8BB 1HT1E 3V3KA 1MB3A 4DLYA 1JSRA 1PYSA 1AV7A 1Q3TA 2CHQA 3QITA 4P1ZA 1F6DA 2ANBA 1KYTA 4KN8A 1N2EA 4YCBA 5AK4A 1KP9A 2H4JA 1YV9A 4IUDS 2JZOA 1L5RA 1OZAA 3TGWA 5AI0A 1MRSA 3Q7EA 3FWNA 2IUUA 3U1BA 1CB0A 1YR7A 3N28A 2C0PA 1HR0B 2UZ3A 2VPPA 3A6ZA 3D6JA 2DQ0A 2CJFA 4G1UC 2B1IA 2J67A 4KO2S 4B7XA 2JLYA 4BXOB 4HYTA 4EYOA 3QTLA 3VBCA 1NF8A 3GLRA 4Q1FA 4WKBA 3F2VA 4CTKA 1T3HA 3GJTA 4H0CA 3U6BA 4N48A 1KYVA 2OHVA 1GPJA 1JWBB 2EEPA 1YDWA 2FPGA 3ABOB 3BWVA 4XA8A 3W1VA 1VIYA 4JYPA 4YCSA 5JXIA 4RVSA 2F62A 2G06A 4ZZ1A 2B83A 1IEQA 3JY6A 3OCJA 3MOIA 5JNLA 3NKFA 3UGJA 2PV0A 1ML3A 1R27A 3JQDA 3BD9A 5AKIA 4ZRDA 2H7YA 3C14C 4KW7A 3E9IA 2JJYA 5KYYA 1NI4A 2EXXA 3KVRA 2CB9A 3L04A 3OQJA 4TUYA 5LZ4A 1UJMA 4QDZA 4URVR 1OFTA 1QIIA 1EESA 3JXEA 4QICA 4CDMA 5C80A 5T8KC 5HS6A 3M5WA 3INRA 2F8TA 2IV7A 4LDPA 2QLJA 1MAAA 2VSOA 4FX5A 4FKZA 4FN4A 4L9WA 4PANA 1XROA 1JW9B 1WDLA 4FZJA 4CM9A 5ALPA 4DCCA 4CS3A 2GZ1A 2XA1A 1ONSA 3FF4A 1XKXA 3B7PA 3A10A 4HTFB 4NOKA 3EIQA 1J9ZA 2BFFB 3MQZA 2FHPA 3F9CA 4TTTS 4A8TA 3FD8A 3VDRA 2ODPA 4FZ3A 4HXYA 4E5PA 2G08A 1YOVB 3UAOA 1R4AA 4ZYTA 1F5SA 3EVTA 3RV4A 1YBAA 3AYZB 2SBTA 2MINA 4IDDA 4MMZB 5TPZA 2P41A 4IMPA 3AG5A 3PUHA 2DHCA 2OPBA 1CPYA 3DWIA 2YIJA 1E2KA 3JQ6A 4LVIA 3ZOKA 5HBGA 4FYHA 1LBSA 1V5WA 1KMHB 2OEPA 3H2KA 1GYRA 3L1KA 3Q10A 4RPKA 5BY2A 3CLSD 4KN9S 2W2VA 4HMOA 1U1DA 3V6LA 5MN4A 1P1KA 2ACKA 2VS1A 3UJ9A 4ZYLA 1T13A 3PHHA 4Z7OB 2B20A 2P77A 2QI9F 3RS3A 2I7TA 1IB6A 1UJ6A 1S96A 2XTJA 1M3SA 4M1EA 5EJ5A 1E96A 1TO1E 1IQ0A 1YU6A 1OXVA 1XEAA 2CUKA 4P0TA 1K97A 1F2TA 1I2CA 1THMA 2JIBA 3A1CA 3BGOS 3TEJA 5I4IA 1RBQA 4X94A 4CODB 2P35A 1W35A 3GT0A 5ICEA 2A63A 4I4TF 4TWJA 4B40A 3N2EA 1NVVR 2G09A 1EWKA 1E7WA 3NZEA 4MR9A 5G0SA 1MAWA 4G1FA 1TZCA 2ZBUA 2B82A 3QW2A 4MICA 4NZOA 2FETA 2DTEA 2QMHA 1Y34E 5CNJA 1Z4OA 3MLAA 4J7XA 5F77A 3OZXA 1NJGA 1M0TA 5C4GB 3VYRB 2O8EA 3C3XA 1VRVA 5GONB 3VTZA 3WWPA 1GZ3A 3DFIA 1GUZA 3G59A 4PINA 4B4WA 4GBMA 5CJPA 2E64A 4TMKA 2A4MA 4MI6A 2JIRA 2ZSJA 2WVJA 2FUKA 5JH7A 3GD5A 1XN1A 2FX3A 2J9ZB 1UXOA 4JX9A 1EP2B 3W1EA 4Q9DA 1SA0A 3MWDB 3ZCTA 1E1DA 3T7CA 3ZHCA 1TVCA 2R6FA 3IXQA 3LBAA 4M9ZA 3UV6A 5A4IS 3COWA 1II8B 1D2NA 5TDHA 4Q4CA 4JI8B 3AHFA 2CMFA 2ZRBA 3D6HA 3SSOA 4UAGA 4BNTA 3GJ4A 1H05A 3AUSA 3GT4A 1P8JA 3RTEA 4WXPA 1NQTA 3ZU5A 4EPXA 1XPRA 3OETA 1IY9A 2VXYA 4L8LA 3MZ0A 2ENWA 5FI0B 3GVIA 5KYXA 2YVLA 4BWVA 3DBRA 3SICE 2ZI6A 4TSFA 3VV2A 6AT1A 4XLTA 5DKFA 1A2QA 5FWXB 4US1R 1FLDA 1H5NA 4HDQB 3FRHA 5B1HA 5U4XA 5G0VA 1QGUA 1M1NB 1N5JA 2XIJA 1XZNA 3FUTA 16PKA 1RBYA 4RKYA 3RFTA 4M0UA 1PK9A 1Z2PX 2E4UA 1B7YB 1GPDG 4U6QA 2VZ8A 1ESNA 3HE3A 1RXVA 1CUIA 2QVBA 1R0KA 2P8SA 1Q50A 3I5MA 1G21E 3OEEA 2H6EA 3QLUC 4GI5A 4WESB 2C7IA 2DTIA 2OC9A 3FDIA 2BHTA 5LZ8A 2J0UB 4D1YA 4DLBA 4DKJA 2XSZD 3NHPA 5D3MB 4BFLA 2H5EA 2B2NA 4GBGA 2Q5EA 4NCHA 4EO7A 3C3CA 2FPRA 3Q3JB 4DLPA 1Q83A 1KY5A 2QTCA 3TGPA 3EPPA 2ZTUA 2PA3A 2ACEA 2G8LA 2X5KO 3K92A 2GT1A 4L4UA 3Q7IA 3RS2A 5DP2A 3BIFA 4DILA 4G0OA 3ZD8A 4AL4A 2G6BA 5DP1A 4Y6SA 2OAP1 4N7MA 1Q16A 4H2XA 3H13A 3QWFA 2BR4A 2Q5JA 3LO5A 5AW8A 4B6RA 2E4AA 2G9RA 3ZS8A 4TKMA 4TV9B 1GL3A 4YRCA 1Q1EA 1TM7E 2INGX 4TMXA 2YFQA 5FUBA 4AMZA 3HXMA 2BHLA 1NVXQ 2A9OA 2YV4A 3AJ9A 4HFNA 1UBCA 4JMPA 1SU8A 4NONA 2APJA 5DVZA 3ZGOA 5ICMA 1WYDA 1E0KA 4OHWA 4UVIA 1C1YA 4RIEA 1L2TA 3R5TA 4K9MA 4QQNA 1Y81A 1ASZA 2ZLBA 4WCFB 4EH1A 1OXUA 2OHIA 4E21A 4NQRA 4XQCA 3RU3A 4GMXA 2ZUCA 5KZMB 1H4VB 1MEEA 1XUOA 4IEEA 1OH6A 3NAMA 4EDFA 4OFBA 3ULKA 1GG9A 1G8PA 1VBMA 3ZGZA 1B0AA 1EBUA 4H2DA 4LZJA 3CVXA 2B1GA 3NYIA 1K3UB 1X2EA 2IBTA 3B5IA 2R6ZA 3CWCA 3LBFA 3QXJA 3BREA 5KKNB 4FZRA 4QHSA 3SFTA 4B43A 4OOEA 5E0KB 1HDRA 4BLSA 2K7FA 5AM5A 1KEEA 1T5TA 2WJJA 2Y0BA 3IR6A 4WDRA 4YMWA 2RH5A 3PQDA 1ZY2A 3KQUA 1B8AA 1MB0A 2ZYUX 1BCRB 1I0IA 3HJRA 4B2IA 1CV2A 2V7TA 4AKTA 1G6Q1 3FVTA 1F12A 4JDPA 3ESBA 1SMKA 3MWYW 4KPUA 4PNEA 3ETGA 3HEMA 1BE8A 2W6JD 3DT6A 2QM3A 3JAMA 5F5NA 3KG2A 1KNQA 2ZATA 1FDSA 4UE2A 3GYBA 1J06A 1US8A 3NU1A 4QDKA 5HR5A 2OLJA 2VHZA 3EXHB 3HUFA 5ANRB 4BNDA 1ISFA 1TTQB 1UDCA 1U8CB 5CBPB 4WJLA 2D1QA 2ZJZA 3GNTA 3OUUA 1I30A 1Z8HA 2HRQA 1MABB 2EJFA 1U0OC 5ETJA 3TCXB 1PSDA 1EP3B 1KJQA 1GDDA 2MHCA 4IV5A 1H2WA 1JKIA 1LK0A 1P5FA 1XNHA 3H9UA 3R5SA 4DIBA 3FOWA 1EHYA 1W4LA 1KI6A 3BL6A 1GQFA 1R88A 4K6FA 1Z4NA 2FJUA 4QAQA 1QO0D 4CH4A 1PZMA 2O0MA 5CROA 3DXZA 2WG0A 3IDZA 1FTSA 4RQEA 2FB9A 2OMKA 2WG2A 3INGA 4G4GA 3ZHBA 2CDNA 2J5QA 3QEOA 1W0JA 2R1TB 1U0RA 3MQ4A 5DH9A 4NENA 3UKDA 3EVDA 4M1TA 3H05A 1K8RA 3O91A 5GMOA 1P2FA 3W5BA 4K3VA 1W34A 4IIFA 2UZ1B 4ZZ3A 3LLSA 1N1GA 4KVAA 3A0RB 2OQVA 3NQ41 3RBAA 2GFQA 2L2QA 4YJ3B 3K9QO 4BN4A 6CHYA 2EC5A 3VVMA 3RKXA 4JDUA 1Y8AA 2HK9A 4MAMA 4Q1BA 4X1IA 3USZA 3CVOA 3TRKA 2GCIA 2QRUA 3I01A 4IDFA 5E4YA 3CZAA 4D0GA 3RARA 5K0SA 4OMCA 1PJSA 4L4SA 4C6TA 3DLBA 1GGFA 3G5LA 2AN9A 1GKLA 4NFYA 2HA5A 4K6HA 5LQCA 1Q57A 2BI8A 3LSYA 3JR3A 5AUNB 4DA4A 5JASA 3QSGA 3ESDA 2CL7X 5LKRA 2E7ZA 3ASYA 5AXCA 3MMZA 3Q8XB 4XUDA 5DGIA 3IL2A 1QIFA 2FK8A 2ZIEA 3HYRA 1BVYF 3PWKA 5HGQA 1Y3HA 2C9ZA 2HFKA 3FLEA 4FCCA 4W63A 1Z2NX 5LBIA 3TL3A 1EUDA 3RYFA 2Q49A 3QIAA 4AAYA 4D02A 3HBFA 1J07A 3ER9A 4RSHA 4V1CI 2F64A 4XARA 5IC6A 1FNBA 4PZEA 4S04A 1P61B 3EA0A 1RXIA 3A3KA 1G291 2ZEJA 5ENDA 3VTKA 5LR6A 4II2A 4P74A 1AA6A 3PT9A 3QXCA 5FA6A 3QNUA 4YRBA 4HDRB 1Y1QA 3DOIA 3GLKA 4HQKA 4MWEA 4DA7A 2VO1A 2BGRA 1FMCA 4MVJP 2EDCA 1NMXA 1Q0PA 2X9NA 2IZ7A 3U61B 3PPYA 4CM6A 1GUAA 3IRVA 4KQHA 3S1LA 1EFCA 4DWVA 5KOHA 5LZ2A 4BECA 3G17A 3KOUA 5JQGB 4AJEA 3JQQA 1JA1A 4EPRA 4LHEA 3U80A 3H0KA 3GP3A 2TMYA 3B12A 1XRJA 4UBOA 4WBNF 5J4LA 3GN2A 3U3XA 3KD2A 3X1YA 2WV7A 3GMTA 3ODGA 4ZV7A 5EUBA 3RTGA 3EVGA 3CJTA 4QJIA 4MDFA 1BQ3A 2NQTA 4LS3A 2Q45A 1KI1A 4IDOA 4MVJA 1KI3A 3QMVA 5SYAA 1ZGBA 1XHEA 5CIYA 5CPBA 1KBQA 4ITVA 3I09A 5AKYA 3AR6A 1BE0A 4JP3A 2H7VA 3HKEA 1H8HD 2FR1A 1FRZA 2G4VA 3A1NA 4L0MA 2WKRA 3V4FA 1U99A 2J32A 3H75A 5AQEA 4HZUB 1IOVA 5T6MA 4D46A 2HMVA 1B14A 1I2AA 2OCIA 3DE1X 4JEIA 2C5FA 1LJUA 4FW9A 3WLQA 2ZSHA 2W2PA 4WSOA 2BEWA 1YQXA 1PR6A 3CEPB 1T9BA 1XCGB 4RK1A 2F9FA 2AT1A 4XGQA 5EPUA 2E5AA 4CEIA 3O9MA 4I5IA 3IA7A 3KBOA 1LRKA 4O08A 3WGTA 5BN3B 5ITSA 3E7FA 2A8YA 4PY2A 3EQ9A 4EVIA 1RJ9A 3A36A 4PFJA 1W2WB 1Z6ZA 3OOHA 4XX1A 2CMGA 2PZEA 3I83A 3MUOA 5IEJA 5JNUA 3DZJA 3FVQA 4HAWA 4R2KA 3T5PA 3KAPA 2YN0A 4BMVA 1Y4SA 1EVYA 2XGMA 4XH9B 4CMJA 4RTKA 1W36D 3QLJA 3IS3A 3Q6NA 3EJ6A 4K7JA 1SFRA 3OAAD 4MUFA 4PTZA 4F9GA 2WUGA 2OV8A 1DHRA 4M88A 3QMMA 1PO7A 3I45A 4K9SA 4MDHA 1DZIA 3IPCA 4MZDA 2ZGWA 2Y1OA 3UAGA 2FMTA 1EHCA 3HKDB 3V1NA 3IT2A 1V95A 2OQ2A 3C5VA 1E2IA 5L45A 2QSZA 4I8IA 3DTVA 1RJDA 1X1SA 4IWNA 2YJ4A 1YZVA 1LLFA 4QRHA 1AMNA 4BAZA 4YFYA 3E0QA 5A6VA 1GZUA 3FFBA 2A35A 4KTVE 1M5UA 4NU8X 5JBQA 1B7GO 1H1LA 4QXOA 3X44A 2A9RA 1YQUA 1WRBA 2QL7A 2VNAA 3L0DA 4RS3A 1GQQA 5G1NA 1QU3A 1ZIPA 4RJKA 1O0BA 3EFEA 3I64A 4F86A 1T0HB 2OD9A 3HNPA 4ND3A 5T3UA 1E7QA 2C00A 4KQ9A 2H0AA 2N46A 2QDXA 2QZJA 4KFSA 5GM2A 1T4MA 3QKRA 5EEGA 1RAHA 1F9EA 4Y0AA 3RJ9A 4AZVA 4C0JA 3P27A 4CTJA 1DCTA 3MCAA 4DSUA 3W3SA 1TEVA 3C7AA 1RKVA 2MU1A 2ABWA 1PGJA 3T3MB 1JR2A 4IICA 2G0AA 2V3VA 3DVRX 1HT3A 1U3UA 2ZE6A 3O3OB 4L0DA 3OF3A 4R3NA 1K0UA 4BJHB 3LX5A 4PS0A 3V8QA 4ENWA 1JSCA 5BR4A 3V8RA 4OQ4A 3OM1A 3TUZC 4RJTA 4ZTZB 4R8VA 1FRFS 3ZJUA 2PS9A 2IXFA 3D0OA 3UCFA 3C24A 3DFMA 2AJ8A 3SKYA 5AHRA 1YMVA 1PNTA 5CLGA 1Y6QA 1QNLA 4KGVA 3VU9A 1JJVA 5ECGC 3ELBA 5KTTA 2C98A 3PE6A 5TPWA 2DFNA 4JLBA 4UTRA 5IS2A 2IH4A 4CKWA 2FZ5A 2IU3A 2HOQA 1CJVC 2BMJA 4ZOLF 3KSBC 5HFAA 1ZR4A 4MO2A 2ZXEA 3BJMA 5G02A 3TQFA 4B6EA 1R8QA 2HBZA 4GI1A 3PQ7A 5GWXA 1KVTA 4EB6A 1MJGM 5D51S 3WMEA 3IQWA 4RTPA 2ZRQA 2ASVA 3O4VA 3I5XA 2GSDA 3ANSA 4ZV4A 1E99A 2HGZA 1Q7TA 4AICA 5J63A 1LFAA 3NUGA 4OO3A 5DOVA 4EG4A 1D7OA 1EQ2A 1HMPA 2I1QA 4J1NA 3ZKWA 3GZNA 4X97A 4UBIA 4DCTA 4IOKA 2ZR3A 1ORHA 3FSJX 3N0TA 4EJSA 4DAEA 2HF9A 4CL0A 3BB3A 2PKRA 4V39A 1YUNA 4ED9A 1KHHA 4TVAB 1VZ3A 3I9V6 5EPOA 3WXBA 4BRUA 1YFJA 3T6KA 4GE0A 5CW1A 4D9KA 4A6PA 3W1WA 3T8YA 4LJKA 2VWPA 3PD1A 4EGCB 1Z0ZA 2O5VA 2OORC 4DADA 1Z5VA 4LZZA 2QK4A 3OCXA 3LCRA 4A10A 3DF9A 4N7RA 3RSZA 2PX0A 3KP1A 1U04A 1RABA 3VR0A 3A6PC 4M37A 2RBGA 3G9ZA 4LX8A 4ER5A 4J9VA 3ABZA 4LRUA 4YLGA 2VF4X 4B4DA 2X13A 2GPSA 4DFDA 4EVSA 1S3FA 4QLBA 1W7AA 2CHGA 3M6IA 2JKZA 2ACWA 4RCVA 4ZRMA 5AVTA 1KSFX 1TIKA 1ZD4A 4UVDA 4FNMA 1HLGA 1P19A 2FR8C 3QYFA 5I5EA 2XY4A 3JQAB 4DM7A 1WXEA 3Q2OA 1N0WA 1MW9X 3OQPA 4OD0A 1K8YB 4JWTA 3HGTA 1QV9A 3N2KB 2QVZX 1U3VA 3B85A 2EL9A 3U6KA 3EASA 2ZQ5A 5JYBA 1FUEA 1GADO 1EZ4A 1SEPA 1UP6A 2Y9MB 4YVFA 5KTKA 1B0PA 2UXCB 1QLWA 1EDOA 1HT2E 2F59A 4G6ZA 1U31A 2AOTA 2GLUA 2RH4A 3I28A 3VR2A 4D4MA 5M3BA 3DZKA 3HVKA 2DE0X 1EJ6A 1V37A 2H8KA 3G0DA 1XMXA 4IDNA 3HA7A 4YV2A 1GNVA 2D4HA 2VKTA 1WXGA 2CLIB 3P7MA 2P3OA 3P2KA 4YJGB 4J0KA 1C3XA 1G16A 4A4DA 1L8QA 2VIIA 4S1TA 1L8LA 1XXHE 3ZGXA 3QO5A 1M34B 3A25A 3KSAC 1ITZA 3BSWA 3V4RA 3A2KA 5CCEA 1FE8A 2AN1A 4WOPA 3D4BA 5IWAB 3G0HA 1Q91A 2D2FA 3BA6A 2ZIZA 3DULA 3WGZA 3JQ9A 1T6XA 1BGWA 2DQ4A 4JBNA 3W2TA 3ZEAA 4A0RA 3UPTA 1DTSA 5J5AA 3E4DA 2IY9A 1SCUA 4C4XA 3G79A 4NVRA 4P31A 2I1WA 4DJDC 4XD7D 3RAGA 1WXQA 2OD7A 1YWGO 1JEYA 1ZS9A 1GPBA 2ZS7A 2IHKA 3UHAA 3ZVLA 2R7NA 5C8DA 4KK4A 1CYEA 3C16C 1CUBA 1L5SA 1K6MA 4W1SA 2IYFA 4FCTA 5AW4A 5EGNA 3TRJA 1W19A 4KR9A 5JVDF 2EWVA 4EGSA 1U2GA 1X1AA 2FPUA 3T1NA 1G59A 2ARSA 4CN9A 1VYUA 4FVTA 4D25A 2XTMA 1CJTC 1YXMA 5LMCA 2QNIA 2NV2B 2WMNB 3V55A 1MA3A 5BSKA 3SMVA 2H7XA 2X22A 5C52B 2AXNA 1KSGA 2QYSA 5I3CA 5H9VA 1OX5A 2BD0A 4M9QA 2M1ZA 5BW5A 1Q84A 3EXIB 1G9SA 2CJPA 4HDSB 2JGNA 3T34A 2J3HA 4OQQA 3JATA 2AB0A 1MMFB 2ZTGA 2KYRA 3AINA 3NIFB 1Y8QA 4LSZA 2WIKA 5GY7A 3AHHA 4UU7A 1YZKA 1G2PA 1IWOA 4MA5A 2REOA 2I67A 3BORA 3OUTA 5D5PA 5GM1A 4EAAA 2WY2D 3GC6A 3FBTA 3M5CA 3ONVA 2A9JA 2WYWA 3QE4A 4BGIA 4DQVA 1JHQA 2ZAOA 2C4VA 4LJLA 5CGQB 1QV7A 1I32A 4M53A 4QTYA 3QFTA 4C7KA 1O5IA 4G63A 1E32A 3EBLA 4J4BA 1ZL2A 2YC2C 5GGYA 5GGXA 2A6PA 5CD1A 1ZM3A 3EMBA 2O8DB 3QP9A 3RTCA 1TKAA 2XW6A 4F92B 1X7GA 2FA9A 3HSYA 3HXPA 4Q4JA 5L6MB 5G3ZA 3NCHA 4WN9A 1IEVA 1DAPA 1N2JA 2D00A 5TT0A 2CXNA 4R3WA 1RYZA 4BEWA 2VDUE 4EUKA 3QFRA 4ESVA 2J7PA 3D81A 3ZE2B 3H1GA 1SUIA 3PE4A 1ULAA 1YI8A 4LC9A 5K3DA 4RD4A 2OXTA 4DW8A 4NC9A 1OFGA 1JE0A 2J4CA 3EFOA 2QY9A 2NVBA 3O9VA 2F1OA 1OWLA 1B8PA 1EKXA 5E6UA 3B1FA 3RRNA 1WW3A 1WOMA 4GLFA 4PZ0A 4XOIA 5JI3E 3QUCA 1GUFA 2VVTA 4GX5A 3KETA 4EKYA 1XEXA 2HV8A 2J7KA 4YR7A 2C5AA 1CQJB 5TQJA 5E7IA 3USCS 4QVKA 1N8SA 2YC4C 3E6AA 3WNVA 1TEHA 4MP6A 3ZK8A 5B4TA 3LX6A 1HNWB 1DKQA 2G63A 2XOEA 3PHJA 5HZGA 2I62A 1TEZA 2B3TA 3Q4GA 2PSEA 1P60A 1TKCA 1P9NA 4LDZA 1U4SA 3UMJA 3KX2A 1CDOA 3QUTA 4H1UA 4KXXA 4Q00A 5AJTA 2NLOA 5CHEA 3TDNA 3IVMA 3FYUA 5LQJA 3DHWC 4X20B 3TRIA 1SOAA 3F4BA 1RYBA 3H7AA 2VG8A 2VTEA 3DC2A 2IHNA 4RHYA 2DC1A 1F14A 2O1XA 2ZUDA 2FW8A 3W3AA 3FCYA 4GX0A 1NQWA 3OTWA 5I7FA 1L5HB 3AB3A 4E7PA 5DHAA 4I1UA 4BMNA 4XEOA 3AFIA 1Y82A 3GUCA 1OXXK 5LYJA 3SC3A 3UWDA 3CLUC 3OE5A 3DOFA 4KPEC 4RTJA 1PR2A 3TLJA 3E03A 4JR1A 2RGBA 4BGDA 1M2VA 4QZVA 1Z13A 5ALXA 1IFXA 2UUAB 4IBOA 5A3VA 4B81A 1Y9DA 5LC1A 4ZEXA 2DULA 3A1SA 1FX0B 1H69A 3L4GA 3FPGA 2IP4A 3KYCB 1R00A 5B2ZA 5TF4A 3RR2A 1NMQA 4M1ZA 4ZAGA 3KAJA 3TJRA 4LVKA 1DRUA 2CFIA 4L78A 2FHSA 3RSOA 1ZHHA 2J0SA 3MTDA 2M9MA 3T4XA 3ZCRA 4EA9A 2ZYGA 4LNUB 5EZYB 4EB0A 1T8WA 2ILTA 2ZCUA 1EWYA 4WQMA 3I3OA 1L5VA 4NV0A 1HETA 1HT0A 1F60A 1T2EA 1E1CB 3NI2A 4CKCA 4EITA 1WHTA 3WGKA 4TYNA 3IHKA 5B58C 2X9QA 4MMYB 4EKGA 3HO8A 4JJGA 4QXAA 4OHBA 4QTXA 4BNVA 1S2DA 1T8RA 2Z1MA 4ILKA 4XVQA 5DTQA 1I4OA 4MJLA 3V8JA 4BZWA 3WYCA 1QQAA 1DELA 2ZI9A 4Q7JB 2UZAA 4EI7A 3KLMX 4KWEA 2AK3A 3KELA 5CX4A 1UEXC 4N40A 4F3NA 4ZYWA 2CUTA 1GZHB 2I7XA 2PUJA 4JLJA 2PUEA 1X1QA 3H84A 4J0HA 1QYVA 1RYEA 1Y4UA 2DPMA 2O2HA 4UE3S 3VPHA 5BPFA 5A3JA 2VJYA 1EOVA 3HY4A 4OFXA 5K3EA 2A2ZA 3T5BA 4W5RA 2X2OA 2NNLD 2B25A 4UOEA 1GOTA 1UZAA 1E5TA 2FG5A 3K6JA 2B5WA 3G1TA 4KDEA 4IS3A 4MUAA 4DANA 2XUGA 1SBNE 4CIVA 4DV7B 1DB3A 4I8XA 1EB8A 1FJ2A 2QORA 3M4XA 3OD5A 2AYZA 4X7RA 4HRXA 4B75A 3FZEA 4B71A 1FMLA 4N18A 2P1DA 5JMPA 3ZE0B 3B1JA 4A91A 1P0IA 2H2DA 2REXB 4XTVA 4B6PA 2AD5A 1Q0ZA 1G6KA 8GPBA 3MT0A 4YTEA 4ZO7A 1AGRA 4Z6KA 2WWHA 1V1JA 4DR6B 6YASA 1E9EA 3PITA 4F38A 1KZ1A 4NZMA 2A5GA 4KCGA 1VKNA 1WL8A 2GPYA 4YWJA 1T36A 4RENA 4G2NA 3QY9A 4QU9A 2CHFA 4M1SA 2GN8A 4E12A 1JBEA 1WXWA 4XSVA 3AI7A 1H2RS 1ZBQA 3EIUA 2VT6A 4TVKA 4PXSA 2HCJB 1N3BA 3EY4A 3FKQA 4ZI2A 4TWZA 4S1OA 3SVTA 1UZUA 4J6EA 1CR4A 1NP3A 4GU5A 1XF9A 1QFJA 1MJGA 1SXJE 2FPSA 5CXQA 5JW6A 4NDNE 3ZX4A 3V9PA 2D2XA 4Y18A 2XXAB 1WZNA 1WUKS 3AJDA 5HHTA 2OXIA 4GUDA 3BH6A 4H7JA 4OYRA 4KFRA 1J2TA 1R0SA 2POQX 5B64A 4DR4B 1QK5A 3FDZB 1OBCA 1F8YA 2H57A 2YASA 3NP9A 1Q12A 2O0LA 4UNNA 4Y7DA 1FVOA 3BE8A 1GTJ1 3FGPA 3PA8A 1SKQA 1XQ9A 1NF9A 3HR4A 3GAMA 2E4ZA 3QENA 3Q7QA 4BC1A 1Q1GA 2K2WA 5M34A 1NWCA 3I8OA 4FD2A 5CA0A 1T9HA 4J1QA 1OVMA 2FP4A 5FAXA 1HOTA 2AOUB 2QLMA 3BA1A 4IDPA 4PG7A 1Z33A 2FE4A 2Q2OA 2QMOA 3F6CA 4P2BA 4W5OA 3NBXX 4L0QA 2V3CC 2J31A 4FHCA 5FF9A 1COPD 4D45A 1G5FA 3ZCUA 5BT9A 4QXQA 5L3VA 1ZK4A 3OKPA 1VJ5A 1ZRSA 4UHKA 1GNPA 5TIIA 3CEHA 4E13A 3GRYA 1JJIA 3PFCA 1YJXA 3M1LA 4BLRA 4PS1A 1C80A 1E69A 1UQTA 2NU6B 4MYRA 5ELXA 3I8SA 5K51A 3CXRA 1E1YA 2C3UA 4PM4A 4YGYA 3WL5A 1XU7A 3K6SB 5IAAA 5KSZA 3L5KA 2FG7C 2XBLA 1E6WA 3I0NA 4M0FA 3SYTA 3BMNA 2DB3A 2JW5A 2C3OA 4BLOA 1P91A 3UK1A 5HFJA 3VR3D 4HK4A 4OHFA 5IKEA 2C4KA 3C1AA 4URWR 2B37A 4TRJA 4HWOA 5KYYB 4Y6OA 4XFDA 1UPTA 3KB6A 4TGLA 2BTOA 2Z2ZA 2HWKA 4DV2B 4R1UA 3W8RA 1VP3A 4DS3A 1N2SA 1A1VA 1H23A 4R1LA 3NBFA 4JS0A 1FFGA 1ZJZA 1HI9A 4RGVA 4WDQA 3NENA 3LSTA 3Q40A 5KOJB 3EWSA 3DDOA 4U7FA 2XYVA 4UTPA 2RARA 2ZM6B 1N9GB 4HGZA 3H9BA 3KUDA 4PWZA 1RAAA 4XQEA 3H2SA 1CUHA 3DSRA 4V03A 5B5SA 1QYXA 2OSVA 5FXMA 1CERA 421PA 4CTNA 3MGCA 3K31A 1JXAA 1PT7A 3KLPX 3KO8A 4EF6A 1A1SA 3KZNA 1ZJ5A 4N0DA 2P9ZA 5ALRA 1QOPB 5HCNA 3VR4H 3GRUA 2J45A 2JLUA 3UMYA 1ZHOA 2QGNA 1BKSB 1ZKMA 1E3MA 3F67A 3BD6A 3B9RA 3ASZA 4TV9F 3RFCA 2PS3A 3PXDA 4U5XA 2WIJA 5T64A 2ZK7A 4R0VA 3IFSA 4LPKA 1RHUA 5DGCA 2FYTA 5G4KA 4FGKA 4ZT4A 1PD1A 3N2ZB 1GGEA 4BKUA 4I0WB 1GCAA 4KO3S 1ZC4A 3QV2A 3IMEA 5CNMA 4JY7A 3C45A 3SR0A 5IU6A 1TO2E 3CYFA 3GEBA 5CM9C 1KEWA 1KH2A 2BFCB 3GGPA 1A50B 2H1LA 1DRVA 5COQA 3HFZB 3BSFA 4UMVA 4CIWA 3THXB 3G5AA 2RI6A 4EW2A 3TINA 3F7TA 5HEKA 5FP0A 4I66A 5THQA 2XSZA 2WD7B 1N5RA 4RWEA 1W29A 4H6XA 1I4EB 4U9HS 4Q9HA 5B12A 2AKWA 1DTWB 1H0KA 1WXHA 2C1XA 5BN4B 2FWPA 1GQ2A 2XF8A 3A11A 3C7CB 4TSRA 1ZIXA 1NBOA 3TOVA 2W6QA 3VTAA 3PTAA 3JWJA 4EECA 2VJPA 3WKDA 2WTMA 3FF1A 3H6HA 3P5BA 3EFHA 4MGKR 5AOCA 2AFIB 1ZH4A 1NOIA 4NBRA 1AQUA 3L0YA 5BQOA 3GRKA 5C7LO 1H85A 1AB5A 4MV4A 2PWYA 1RQXA 4AG3A 4MW6A 1GHTA 2RMKA 5BRNA 3WYFA 2FV8A 4N8DA 1T6BY 1OLSB 3EC7A 3PGJA 3BJZA 3P94A 3HKBA 4ND5A 3OCVA 1V9SA 4QPZA 4F7WA 4GDMA 4TZKA 5L4LA 4YO7A 4E7OA 1U2DA 3F9IA 2IZOA 4I50B 4IVPA 1Z63A 3QQ5A 4X61A 3NATA 5FPQA 4C4TA 4DJTA 2JJ8A 4FDMA 2HREA 2JGDA 3KE9A 3LVBA 4MYCA 2WWGA 3B13B 2H31A 3V7FA 3OKCA 3WGNA 2W11A 2VYCA 4J76A 5ALOA 1U3WA 2VBIA 3KB8A 1YAHA 3MWEA 3NVKI 2R25B 4N8SA 4JEMA 2VYVD 5ENZA 4H1HA 3RFUA 5AUPB 4FOLA 4CMKA 1ENOA 1Q7GA 4CN8A 1EJ2A 5LUBA 4UARA 3V46A 2X1MA 5H82A 2PFGA 2VH1A 4G4IA 1UPXA 1AXGA 3T0FA 1HUQA 2GJAA 2P2GA 4ZZIA 3D0KA 3H5TA 1JQ5A 1MNQA 2P30A 4PGGA 4F72A 4LPSA 1TJ5A 2F1HA 3HJHA 4R6WA 1IMOA 1LPOA 1KDRA 1J5WA 3EEOA 5EP3A 4EVQA 3CTMA 2ISCA 4FQ8A 1ZWLA 1RRMA 5LIPA 2E1HA 4I99A 1JILA 1OTHA 3GK3A 4O2BB 4B79A 2W6JA 4HR7A 4NY1A 4B8WA 1DC7A 1PL7A 3GZJA 4Q6GA 3HCCA 3ND6A 2FGKA 1PFKA 3T7JA 5JY6A 1N3IA 1AKEA 3ROKA 4ETMA 2HT1A 3QBTA 1K88A 3K5PA 3ENNA 1RYYA 4FOTA 1GT6A 4AURA 4BMSA 4ARIA 4RDCA 2ZXUA 2BGIA 1KZ9A 5JAPA 1NVUQ 2NADA 3RC3A 5M29A 4GL4A 2G4LA 3NBMA 3V34A 5E4FA 3F6SA 1EBBA 1SCJA 4QREA 2BKXA 4U7HA 5TRTA 5B6PA 3PDIB 1VCNA 4MITA 4I9UA 2B61A 3V8EA 3U62A 1FJHA 1KAQA 1WZIA 1XNGA 5ELMA 5IPFA 3W34A 4RPLA 2X0FA 4EQ6A 1IZ9A 1O0SA 2VZLA 2VTBB 2Y8EA 2AMVA 4M83A 4MYUA 2R5FA 3PUZA 5AVYA 2QJOA 1GSOA 2EKPA 3FUWA 5LQKA 2PNFA 3EVAA 3G1ZA 1WW8A 3P9IA 4BX2A 4PYRA 2C2OA 4MS3A 4P3OA 1C4WA 2GFHA 2FPIB 2PJUA 2X3FA 2WHPA 4N3GA 3G2MA 2J48A 3F7NA 1DINA 1R4NA 3ZDRA 2Q1YA 2WC1A 4HEA1 5JYEA 3GL9A 3IEXA 3ORYA 3SJUA 3K20A 1JYSA 2QSYA 5FB3A 4C4ZA 4Z99A 3KOZA 5JQGF 1WO8A 2WJ3A 5CB4A 1BBUA 1ZGGA 2RG7A 4JT9A 1Y63A 5AI5A 1PX2A 1JJCA 4IG9A 1KTVA 4DCUA 3A4TA 4UATA 2QT1A 2ZB3A 2PBZA 1MJFA 2LDXA 4XGRA 2WNSA 1OFUX 3IPXA 3FOZA 1PJAA 3TJZA 3PIIA 5J4KA 4WY8A 4B6GA 4AKEA 5BURA 2DWUA 3ABQB 4BCBA 3DG9A 1KFCB 4FB5A 3ZXUB 3N0VA 3N5KA 1RWMA 2FK4A 4WBSA 4DMCA 1I7NA 4PCUA 4UHEA 4FEGA 3W0LB 3RYIB 1XPJA 1WMDA 2LCIA 1CETA 1DEKA 4FMPA 4V0ME 2HGSA 2Q3HA 3PF9A 1ZU4A 2Q6IA 4XTWA 4RJ2A 5T67A 3TS1A 4QBTA 4DA0A 4MRNA 1TECE 4RA9B 4DV4B 1Q95A 4UVGA 4JVLA 1JECA 2IQIA 1XP8A 4KE6A 1NQXA 2CW1A 1XRRA 2O2ZA 2X0KA 3NNNA 1Q7BA 5A0TA 2JFNA 3GFPA 2IOFK 4LVMA 5LCXA 1Y6FA 3NTLA 4REMA 3L05A 2PD6A 1OGYA 2PLAA 2X76A 2XDWA 3DE6X 3L4BA 4E0BA 1E4EB 3O1IC 1QYRA 1FUKA 1RRVA 3NEPX 4IIGA 5E6SA 4NJEA 2EW1A 2V6FA 2VFAA 4NPAA 4W5JA 3W5SA 5K0TA 1HFKA 3BJEA 2XGJA 4MB2A 1KARA 1MHPA 1QXSA 2I7DA 3MCTA 4LXHA 3SKXA 4AF7A 3LTEA 3LKDA 3GEDA 2X40A 1KKMA 2CDRA 3LCVB 1OE0A 2ZT6A 2MTBA 1ZL0A 4LUCA 2YL2A 4IIJB 3SYRA 1A9OA 5HWSA 3OCWA 2GAFA 1GQOA 3BK7A 3R40A 2DSTA 3W2FA 4HB2A 1P72A 2YWXA 5CLFA 3RIYA 1KZ6A 4CLOA 3I9LA 1KY4A 1XYGA 3W5IA 2WAOA 4ALNA 1R4MA 2HMYB 2Q9CA 1YVRA 4NU6A 4FEEA 3L01A 4XM2A 3L7OA 5E9QA 1H8HA 3MWFA 3OX1A 5CEFA 3K9FC 1WQWA 2XNDD 4YCJA 1QLJA 1FP4A 3COSA 3V2UA 4B3TB 2OZPA 1Z47A 4NYMR 4HRAA 4UEKA 4C4RA 4F4DA 3AUAA 4M36A 2GILA 2Z9CA 4ECEA 3ZJ5A 2EGHA 1QP8A 4FQ7A 5F52A 5M5BA 3UEOA 1DLJA 3DFFA 4CV3A 3E8SA 3R07A 1DBQA 1QF7A 3MMSA 3HTXA 4DCGA 3SK0A 3OQOA 3L6RA 3C4VA 3ED5A 2GTPA 3B82A 5ER9A 4LJSA 1HDCA 1BWSA 4GZ5A 821PA 2VRBA 4MW9A 2O8CB 3N07A 4J7CA 4ZZ0A 5IJ0A 3QVXA 5JZ9A 3FMGA 5F7JA 3ZGNA 4XVUA 5JZBA 4R1NA 4OP2A 3LPNA 1HY3A 3PZCA 1GAJA 5CVTA 3PI7A 3IHWA 1J00A 3JALB 2W37A 3U4QA 5JSQA 2J3DA 3DOOA 3WSTA 4WXRA 4ZI7F 2M1XA 3OAAA 3K70B 4TZ6A 3EZ7A 3FMFA 3KQSA 4KIUA 4YJ2F 1UBHS 221PA 3E18A 1YBMA 2VPZA 3GQVA 1N78A 3OF2A 3VPSA 2PCJA 5B3AA 3OOWA 1C81A 2HZBA 2DZDA 2PYZA 3NG1A 1ICIA 2RC6A 4DQ0A 2ZRPA 3LWDA 2VDWB 4LMPA 1JSLA 2GRUA 3DOHA 3W4IA 5G4LA 1K8XB 2OGWA 3M3PA 4XDYA 3E5MA 2GA8A 1LX7A 1JXMA 3ROEA 4BASA 1BSVA 3IGFA 1RWBA 5L7WA 4LRXA 2Z2XA 4M22A 3F98A 4OA5A 5FPKA 1V9CA 3AFGA 3I72A 3OLQA 3WYAA 1GPNA 2FPKA 3WK7A 2ZJ1A 5MF6A 3WLHA 4AO8A 4CH6A 2AR0A 2FQ1A 1J21A 2ZNJA 3KALA 1Y3CE 3RUXA 1XDGA 1YRQA 4KIJA 1Z0IA 4HYEA 4RK5A 4DZRA 4UUQA 1DIOB 1IULA 3BF8A 3D6FA 3QVVA 3T5DA 3O8QB 2H1SA 3VHXA 1PX0A 1KPIA 3WP0A 5FWAA 2HQOA 1F7UA 1NW7A 1NZDA 2DWCA 2QXTA 3FGZA 2Q6TA 4JLAA 2P9QA 3EMKA 4TT3D 5LP6A 5KSWB 2FSGA 2X86A 5HRAA 1W88B 1Z4JA 2ZJ8A 4RK0A 1E3IA 1I5RA 4BVBA 1RPAA 3IQDB 3PVZA 4YQZA 5AYVA 5ALVA 4EHAA 3LT1A 3W7VA 2DVMA 3ABRB 3JWPA 4X8OA 2JASA 3GG2A 1XTVA 2CC2A 4R41A 3AP1A 2ONYA 3PNMA 4K03A 3VYTB 1JHPA 2NGRA 1YS1X 4E14A 1X2HA 4OJQA 3O2SB 1ML4A 1TVKA 1ZI8A 4TTSA 1TZKA 1G19A 3OLCX 3EXAA 5T57A 3TQIA 2GJKA 3SJCA 4D4KA 1WNLA 2X3YA 2QRZA 5ARCA 1WMBA 4L02A 2XUQA 1NVKA 2JATA 2QQ0A 5GV7A 5PNTA 1EH5A 1KC3A 1XEWX 4JP1A 5A3QA 1W87A 4Z4CA 1DO0A 1K2VN 2RB4A 4MR7A 4OYYA 5A1TA 2PJRA 8MHTA 1XAIA 5LB2A 4D57A 3R7SA 4C5CA 3RNLA 4MVCA 2W70A 4MS4B 1NHGA 5LA6B 2V6BA 3S55A 4ABTA 3NPAA 1W5BA 1AT1A 2JFFA 2WSBA 2AE1A 1TADA 1X94A 1M54A 1BW9B 4R0NA 4EYEA 3MF2A 1E1MA 2W58A 2BFAA 4PZLA 4XUCA 3GFGA 2QN6A 5T5QA 4YUXA 1KF0A 1N3LA 1KSJA 2XH8A 4QPCA 1NN0A 2NXNA 4F2WA 2VYND 3A8TA 3DVQX 2H7CA 3B89A 4ATNA 5DGHA 3K7EA 2JKVA 5JHGB 2Y27A 2HK8A 1SEVA 4QEDA 2EARA 1FS4A 1LLCA 5HE8A 3PGXA 2CXPA 4IO0A 2F9LA 4TXJA 4EPVA 2PUTA 3KZ1E 4R5MA 1DC6A 2RH8A 1A4UA 1ILEA 3KUXA 2ZIXA 4DLRA 3ZK7A 1KO1A 4QQKA 5HQJA 1SXJA 3H97A 5C51B 4GSYA 1LPNA 1XVVA 2C2GA 2VLBA 5BXQC 4EJMA 1IVSA 2BSQA 2AR7A 1IUPA 1YBVA 3I5YA 2JVKA 2HHCA 3U0BA 4DABA 3ZPXA 3RF1A 1I9CA 1M6EX 3EWNA 4I9FA 3VH4A 2V59A 2PRZA 1S2NA 2W42A 3HDHA 2A3NA 4KVZA 4ARSA 2BFMA 3KTFA 1O95D 4KKVA 3UJ8A 3FYHA 5JAOA 2WYUA 3UMMA 4PYNA 1JBKA 3KKEA 1U1CA 4IH4A 2IYLD 2JA1A 1MFZA 1O94D 3TQRA 1PV2A 3NW9A 5E6RB 4K5QA 2Z9BA 3NTOA 4JQZA 3PUXA 3BHNA 3IP7A 3QRWA 3ZDCA 4K9PA 4L51A 3SX0A 3QVUA 3CLTD 3UT0A 4A7PA 2WSSA 4AX8A 3ML1A 3ZYCA 3SXUB 2JIMA 3KQPA 5L9AA 2YIDA 1TI7A 3VX4A 2ZUEA 3DHYA 4FBGA 3P8ZA 2YCLA 3PYXA 3WLOA 1EFLA 4XCQA 2QVXX 3UKOA 4P53A 3O94A 3PL5A 3REXA 1CIJA 3RAEC 2VQFB 4QFCA 4A5SA 3TQHA 3QKSA 3CLKA 4QNNA 3Q7RA 4C7OA 1J1UA 4NG4A 5DMXA 3HB9A 2B9VA 2IXTA 5EIOA 5FA8A 4BO0A 2IW3A 4B4UA 3H5RA 4RK4A 3TVTA 3VKUA 3GCGA 2J5KA 2B1JA 3TTXA 3V97A 2ZZGA 4GYYA 1L3CA 2C5SA 5L3SA 3A32A 4MJ3A 1Z8DA 3SU8A 5FORA 1Y8RB 3SOZA 2R96A 4UMFA 3PQFA 1VG1A 2OXFA 4XCXA 2FY8A 3R74A 4EHHA 1G3QA 3QYPA 1YTLA 2FQQA 2I5PO 3DYBA 4PNZA 2Q5FA 3WZ2A 4MWGA 2VNKA 5B1EA 4GZMA 2IOFA 2W8BB 2J3KA 3HA5A 4HNHA 3TXXA 3LUKA 4H3KB 4L50A 3D8UA 2OPHA 1OI2A 3HY3A 5I9TA 2E65A 1NW6A 2PZJA 5DNUA 2EW8A 2IEBA 3VJLA 2OWEA 5KO2A 2G82A 3S3TA 3V7CA 4DG8A 1YQEA 3PF8A 1UC4B 2Y1EA 4GOKA 4OXXA 3LHSA 1ZOLA 5A7GA 1M0SA 1OTYA 2WU8A 3ENQA 5FUXA 1PLJA 2AGVA 4MQLA 1CR0A 1Z17A 5ALMA 3TG8A 2K2QB 2WB4A 1YONA 1E2LA 3IEIA 4DMRA 2GF9A 2V6IA 3CE9A 4X71A 1LSJA 1JJAA 2GJSA 3HGMA 4DBLE 1KC1A 4UTNA 5L3QA 1LK5A 1XD9A 1DSSG 1XZDA 1L6IA 3PR2B 1U3TA 3G23A 3QXXA 4M55A 4U7TB 5EIBC 3UHPA 1GTSA 1ZNYA 2QAIA 3HEAA 4L8WB 3V32A 2O7VA 5H3LA 4ZREA 3BCSA 2IE0A 3E58A 5D6OA 4P4NA 3V5NA 4EHFA 2OO5A 1QZUA 4G26A 4JN6B 2VDOB 4Q4LA 3H3JA 3FNHA 4O2AB 2I2DA 4YDSA 3HI4A 1UJ5A 1HURA 1J20A 3AUXA 1QBGA 2IOHA 3HCEA 2J4FA 3OWXA 1U2QA 2PHZA 1FUUA 4KBYA 2QW1A 5E2IA 3NKLA 5LBUA 5CFMA 2Q7HA 2XCLA 4IIBA 2P6OA 4TTQA 3REQB 3L6DA 5JECA 4RTRA 3KYDB 4JLMA 1C8LA 1SR8A 2NN3C 4ND2A 4Z86A 3RHSA 2WAAA 3KC2A 3E2IA 1FQWA 2QF7A 5EZYF 4E5MA 1JEQB 2WYHA 2IV3A 2BP7B 2QZ9A 4RD1A 4UMEA 2I4RA 3FPLA 3NBYC 3VRHA 4J0QA 1OAOA 4LI0A 3MUNA 4BP1A 2EQAA 2IZ0A 4D92A 4JUAA 4M8KA 4OUDB 3U9LA 2IY5B 1WU8A 2JAUA 4DXDA 1BFDA 4E15A 1BKDR 3NKVA 3U7QB 3DLPX 2L42A 4I9GA 1X9HA 1H4SA 2BJVA 2V0NA 2J87A 4DM3A 3OPQA 4PSVA 3DNPA 4QKQA 3RW9A 1A5TA 2I4MA 2EJVA 2GMWA 2WZQA 1B23P 3T5TA 1IOWA 4KX5A 4WXMA 1NP6A 2P0AA 4WFKA 4GOXA 1TCCA 2RKWA 3JWGA 1P0FA 4OMUA 2CMDA 4XUEA 4QLAA 1P77A 2Y9PB 1I24A 4FJ1A 1UMCB 4P9NA 1X77A 4TKUB 1XFDA 3MD9A 2QOEA 2CXXA 4MLCA 2E89A 5JEDA 1DOHA 4K6MA 1VB5A 2G71A 2VXOA 3C8UA 4KL8S 4NS1A 2JA2A 4X6YA 3HYTA 1SCBA 3U31A 1IY8A 2NU7B 4P4LA 2UYQA 1M2FA 5IVHA 1PSWA 4DV5B 4IOLA 3RCBA 1GILA 3D3JA 4PRYA 1FLVA 1RPNA 5ILQA 2C9YA 4RZ2A 4LY6A 3KKQA 3PNSA 4NJMA 1JDNA 4LF5B 1C3JA 3X3HA 1UBKS 1P1CA 2EFJA 1ZUWA 4CLRA 3MJCA 4L5AA 4OU5A 5TEWA 5IZ4A 4PCAA 1FJXA 3LLCA 4HLUA 5BSFA 5I8ZA 3V1LA 3PA6A 2E55A 3SHFA 3JVUA 3BZBA 4DDHA 3GPDG 5FTKA 4G2TA 1M2WA 1ZLYA 4Q9AA 3AI2A 4ALJA 4DRYA 5JPCA 1FFHA 2HSGA 2CYCA 3BERA 1PJCA 3HNRA 1EFUA 3AY7A 3WGOA 1AS0A 1L8AA 5BSWA 3TSZA 3R3JA 2OHFA 4ZU1X 3V1UA 4D41A 3FKSD 3O38A 4RZXA 1RAIA 4ZGGA 1R16A 4EFDA 3BFJA 1HM5A 1LVGA 3BN3A 4RMIA 1DNPA 1NYTA 3EGXB 4JI0B 1NPYA 1CEEA 4DM4A 1D2HA 2VSQA 4WHMA 1CRQA 5IBRA 5TQ2B 1GTRA 2BELA 2PJDA 5DYNA 1YZUA 4ARAA 2VTDA 1YQGA 4IXTA 3QFSA 5DASA 4MQEA 1NI3A 3LPDA 4OAQA 5D00A 4ZI3A 3LUPA 3EBOA 3EVCA 2B6NA 1MGOA 3C3JA 3JRWA 5KTOA 1SXPA 1ZUIA 3C6ZA 1D2AA 1RXYA 3LBNA 3SZMA 4WNAB 4LWPA 1G9XA 1Y3IA 4PWYA 3GEPA 4C2UA 3PGVA 1D6NA 2Q9BA 1B1AA 5JSZA 3V8BA 4U8HA 3BK1A 5HP4A 5JS2A 4ZEOA 1M74A 3PICA 2Z8ZA 1O08A 3EBPA 3G02A 4Y2VA 5CDFA 2C99A 4N1AA 5BV1A 3EAGA 2ECOA 2QAGC 2WFLB 4JVSB 5CXXA 1PIWA 3ERRA 3CW9A 4QL3A 3SC6A 1RWVA 1IN8A 1TYCA 1KI2A 4RF3A 4MIKA 3HYSA 4OG2A 4Q6WA 2ENUA 4RY9A 2C5GA 2CLFB 3ZU4A 3KQKA 3F90A 3D59A 3M1YA 4OHRA 3QE3A 4IIVA 4PC7A 4OB6A 3VR6D 2CJAA 3MGBA 2VUHB 4NBTA 1KVQA 3L6UA 3DXFA 1RQ7A 1L7MA 2VI5A 3EXG1 3GRPA 1WCIA 4V0MA 1VL8A 5C2JB 3IT1A 4JODA 4WL0A 5B7NA 4LHWA 3PDWA 4LJ9A 5AKGA 4Z7NB 3PQ8A 3PFBA 1Z45A 3JR7A 4I81A 1OLOA 3NOOA 4YXFA 3W5AA 2JLQA 1BJRE 5F23A 3VJMA 1DT5A 3R6TA 2GERA 2OV1A 2ZR7A 1IBMB 2EEZA 4E4YA 3EXFB 5EIAA 3D1LA 5F3RA 3SEZA 1DUVG 2V7GA 3ESYA 4LBZA 4BHTA 1JQLB 3TOXA 3EXEB 4E22A 4EG7A 3ZEIA 5A7FA 4UBLA 5ED0A 4DDVA 5F9HA 1KQFA 3N75A 2RGNC 1RXUA 3I1FA 4B3JA 4M21A 2PGAA 3DOEA 4XUGB 3ROFA 4KIGA 3KUCA 3QLTA 1GM5A 5H81A 2YVQA 3DGFC 5CLQA 5EMKA 5YASA 4R2IA 1E5LA 2EATA 1FQOA 3Q11A 4Y1EA 2A1IA 2LPMA 4YEDA 3IA2A 5JI2E 4RHTA 1QGZA 5DHFA 2D1YA 2R1VB 2A84A 3X2FA 4B1FA 1X1RA 3IE2A 4LVUA 3VR3A 4ZVSA 1NMYA 1M0WA 1OBOA 4B0PA 4D42A 3NTRA 4I7EA 1URPA 1D3AA 2HBRA 2WJ6A 3R0IA 1LS1A 2X0NA 4G56A 1I3OA 4H3VA 2NYUA 2DU8A 2ZVJA 1RYHA 1SAYA 3GJ7A 2CD9A 2B30A 1TCBA 4H0NA 1E24A 3CBGA 3CGWA 3HWWA 1DS6A 3NHFA 2RGCA 4FNOA 5F64A 3I12A 5K1ZA 1VG0B 4RMHA 4F96A 5LOVF 4TVWA 1Q6ZA 2XEXA 2G28A 4G0PA 2V7XA 3UCXA 3VGJA 4MKGA 1FFDA 3OHPA 4EGQA 3F7OA 2X5OA 1G6HA 4BE9A 2Y93A 3BHIA 3BWMA 2R2AA 4RMJA 4O4JB 1G7TA 7REQA 2OL4A 3LIIA 1SGWA 4GC5A 3OZCA 2COUA 2OP1A 3VVLA 1XX6A 6NULA 2VP6A 4F11A 4R51A 3AU9A 3M9WA 2A5FA 3CKMA 5LQRA 1G63A 4IM7A 4YMSA 4HB4A 4R7GA 3T7KA 4TTRA 2Z2JA 4L4RA 2GARA 2DUUA 1DIHA 2VNHA 3CZPA 3WBBA 3JW8A 2XRYA 3GUHA 3PWSA 4YUZA 2F2TA 4U39A 5M2QA 3GG9A 2PUBA 5ADVA 1BRTA 4XJVA 4DIFA 1HKUA 3OZWA 1NUHA 2X3UA 4K05A 4UCXA 2JJ2A 2ACVA 2Z30A 4RGQA 1X01A 2OK8A 2RI0A 1ZN2A