1WU7A

Crystal structure of histidyl-trna synthetase from thermoplasma acidophilum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
424
Chain Sequence
RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Histidyl-tRNA synthetase
publication title Crystal structure of histidyl-tRNA synthetase from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
total genus 117
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.240.30 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 1wu7A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wu7A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1wu7A03
3R07A 4DQ2A 2ZT6A 4OLFA 5K1XA 3A31A 1NJ8A 3E9IA 3CMQA 4YRIA 1L0WA 1E1OA 4YCUA 4UP8A 2Q7EA 2DQ3A 1B7YB 4TQDA 1PYSB 2AMCB 1BBWA 12ASA 3A5YA 4TVAA 4HWOA 2EJ9A 2ALYB 3G1ZA 2ZT5A 3QNEA 3V7CA 4Q6GA 4YRNA 2J3LA 1B76A 3HXVA 4H02A 3RUXA 2PMFA 2E3CA 3A7RA 2ARSA 2CGHA 2E65A 3TEHB 3V7RA 2CIMA 3HFVA 4YRLA 4XEOA 2QHTA 4CH3A 3IKLA 4CS3A 3HY0A 2ODRC 4YRPA 3A74A 3PCOA 2DXUA 1YB3A 4H2VA 1SETA 4YRJA 4P71C 1VQZA 1B70B 3OD1A 2CJAA 1EIYB 4UP9A 4PG3A 1FYFA 3PZCA 1USYA 3PCOB 2RHQA 2QHVA 4XTUA 2EJFA 1V95A 2AKWB 1EVKA 1YFSA 3A32A 3QTCA 1KOGA 4G85A 4J15A 4XTWA 2DU7A 4YPFA 2RHQB 1E22A 1USYC 3L4GB 4AH6A 4TTVA 2DJZA 4XU1A 4HVCA 3DSQA 2ZTGA 2IY5A 1NYRA 3WQZA 1EQRA 2DDZA 3REUA 1WU7A 1E1TA 3REXA 3A5ZA 3TEGA 2QHSA 2ZXFA 1SRYA 2ZINA 2FYKA 2C8MA 4P72A 1YFTA 4H2WA 1G5HA 1B7YA 2ARTA 1PYSA 2CJ9A 3A7AA 1WNLA 2HNIA 2ZGWA 2DTHA 2AMCA 4H2XB 4KR2A 3QO5A 4K87A 5E3IA 4P75A 2ALYA 4P72C 4HWSA 2EAYA 1JJCB 3HXXA 1W66A 3HRIA 2DTIA 4TVWA 4YP0A 3IALA 2E41A 3VQWA 2I4OA 4XU0A 4P75C 1LYLA 3UFGA 3HRKA 4H2TA 3L2ZA 4NCXA 3NETA 3TEHA 3VBBA 1BIBA 1BIAA 1RIQA 2Q7GA 11ASA 4WJ4A 3UGTA 3RGLA 3LSQA 4EO4A 1H4QA 1HXDA 3HTZA 4YDQA 1B8AA 4XTYA 3IKMB 4YYEA 4P71A 1KMNA 4XU2A 4ZIBA 4K86A 4CH5A 1WPYA 2XTIA 2DTOA 2ODRD 4P73C 1WQWA 1B70A 1NJ1A 3EFRA 5KNNA 2ZZEA 3HXYA 1EIYA 4DPGA 1WYDA 2DZCA 4KQEA 4BW9A 2EL9A 2CJBA 4HA8A 2J3MA 4PHCA 2XGTA 2ZIOA 3FJPA 1SERA 1ADJA 2E10A 2AKWA 2RHSB 4P74A 1NJ6A 5C52B 1QF6A 2LW7A 4XTVA 2Q5IA 3L4GA 4TWAA 4WF2A 1EOVA 2ZIMA 4P3PA 2I4MA 5C53B 3V8JA 4YRCA 2PMEA 3KFUA 4CH6A 3VQVA 4P74C 3MF1A 2EJGA 2ZR2A 3QO8A 4YREA 3VQYA 2C7IA 4RMFA 2I4LA 1H4SA 2I4NA 4RDXA 1Z7NA 4H2XA 2ZT8A 4X5OA 4L87A 3QO7A 4BWAA 3MF2A 5K1PA 3LC0A 1H4VB 5F5WA 1X56A 4XTXA 1JJCA 3RKYA 4CH4A 5ELNA 2ZCEA 1NYQA 1WLEA 4XEMA 4YRSA 3NEMA 3RIRA 3L1AA 1Z7MA 4H2SA 2DZ9A 4H2UA 3I7FA 4H2YA 1NJ5A 5C51B 2P5IA 1X2GA 1SESA 4P3NA 1X54A 3UH0A 4YRFA 4E51A 1ATIA 3E9HA 4WJ3M 5HGQA 3HXWA 1BBUA 1HC7A 4OP0A 3IG2A 4CS4A 4G84A 3HFZB 4YRMA 1NJ2A 4EX5A 4K88A 4YRTA 4P73A 1E24A 3LSSA 4UP7A 4TVYA 3RACA 2ZNJA 1YGBA 1ASZA 2DEQA 2QHUA 3V8KA 1WQ7A 3HY1A 2E1HA 1KMMA 1N9WA 4WI1A 4XU3A 4P3OA 4UPAA 2ARUA 4CS2A 2P0LA 4TVAB 2DKGA 2Q5HA 2RHSA 3A7UA 4Q15A 3M4QA 2ZZFA 1HTTA 1J5WA 4YRGA 4RQEA 1H4TA 3P8VA 1X55A 3RKWA 1YFRA 3RKXA 4KR3A 2DXTA 1X2HA 4ZTUB 4TQFA 3BJUA 3P8YA 4HWPA 5ELOA 3P8TA 4RQFA 3NELA 3BFMA 4YRQA 3HXZA 2DU5A 3RF1A 3W3SA 4YCWA 3V8LA 1EVLA 4HWRA 4LNSA 2ZT7A 3V7SA 2G4CA 1ASYA 2Q7HA 2ZR3A 3UGQA 2ZNIA 4HWTA 1X01A 2ZZGA 3EFSA 3NENA 4YRRA 1ADYA 3ICAA 3RL6A 4YROA 1QE0A 2E5AA 1C0AA 1EFWA 1GGMA 2E64A 3VQXA 3MEYA 2DQ0A 3TUPA 1G5IA 4O2DA 1IL2A 3M4PA 4YCVA 4XTZA 3HXUA 4YRKA 1G51A 3ERRA 2EWNA 2DVEA 4ZTZB 3HFZA 2IY5B 1NNHA
chains in the Genus database with same CATH superfamily
2ZI6A 3LL7A 5DN9A 5K8IA 1EEXB 4UBLA 4UEKA 1RPNA 2WJVA 4LY3A 3LBFA 3ONVA 4MW9A 3CMQA 4I14A 1RQ2A 1MAHA 3ABRB 4QGHA 2INGX 1C1DA 2D59A 1JQKA 1ZD4A 4RHFA 1J8DA 1G6Q1 1SC3A 4LE1A 2FZCA 2VP2A 3BQMB 3GCGA 4HRYA 3P4XA 1TCVA 2NTYC 4LHYA 4WZAA 5TC4A 1R0YA 3DL2A 5CM9C 4JB0A 4PBSA 2FDXA 1L6RA 3LWZA 4X1KB 2NYVA 4RK4A 5IN5A 4EZIA 3JRWA 2DUNA 4B3JA 5EOVA 1R10A 4Q24A 3E4DA 3KZXA 4JLJA 1ZGZA 1S3IA 3ZX4A 5LYYA 2AFIA 3D6NB 1G8SA 2SCUB 4S3MA 5ERYA 1EXDA 3NMUF 4MJLA 3QENA 5I7WA 3MJSA 1DC4A 4HMQA 3O2NA 4TZ0A 3SSNA 2V8BA 3DTVA 1IWOA 3B9QA 3HH8A 3AL3A 2D00A 3I9OA 3G0HA 1PFQA 4Q6GA 4JITA 3GLQA 1RXCA 4YRNA 1YHNA 1YS6A 2VSOA 3AX6A 3RSLA 1TTQB 3IA7A 4B8YA 3ODPA 1RWBA 2D3WA 5I8WA 1Q0LA 1B14A 1F5SA 4F6RA 3T15A 3HTXA 1RJEA 2GN0A 3RUEA 4CHGA 2FRDA 2IYZA 3DPIA 1BX3A 1HE1C 1HEIA 2OO5C 3DNMA 3EEBA 3IEIA 1ITZA 3PNVA 3QVJA 3C97A 4BNKA 1U5BB 2J33A 2ZJ0A 3X1WA 4BE9A 2RGXA 4N3GA 2GHIA 4PV7A 3ETEA 4GPTA 3DFFA 4O2AA 3TIXB 3NO4A 3CJRA 3VNUA 4XCVA 4EF5A 3QXHA 4G2TA 1KEEB 4BPRA 3I3OA 4TS4A 4MCHA 3AU9A 3J80A 3MCVA 1LU9A 4DE5A 1IWBB 3F78A 2QLTA 3KJQA 3HU2A 3A6KA 5K05A 4I3FA 4K0RA 5ALYA 1TQ8A 3U81A 4H9GA 2PJRA 1FF9A 2CK3A 3VKFA 3GUUA 1GKIA 3WNDA 3MM4A 1SVOA 1K3FA 1FX1A 4DGQA 3DJFA 1WMDA 3ZY6A 1LTHR 5SYMA 5IFKA 4UBNA 1S9DA 3PX7A 3RAJA 2BMWA 1YB3A 3R7SA 3T5AA 1PTJC 5KWVA 3IVXA 1D0VA 4F3TA 4FGZA 5FD8A 4JQSA 4EY5A 3ZE7A 1PSWA 2X0FA 4YHHB 4EUHA 3I6YA 4RTMA 5IUJC 4B4OA 4JBLA 4EJFA 2IHZA 3LFHA 4OGKA 2EWMA 2ECPA 4ZA2A 4B3BA 4UFNA 1WZCA 1JZTA 4GI1A 3SKYA 2O8BB 3D4NA 3TRJA 1BWRA 2JK0A 3JQDA 2BGJA 3DMRA 3PUHA 2WUFA 5IM4F 1QX3A 2NYUA 3FUTA 4RO0A 3TB4A 4AC9A 2IYVA 2G67A 2R5FA 3PYXA 3E7DA 4YMHA 3G2PA 2AMFA 5JMPA 1JJIA 2A1TR 2TMKA 1TU3A 1UFQA 3GW8A 2VDKB 4DDKA 5AVQA 3AQIA 5GONB 3LHDA 3EPJA 1DBPA 3K0BA 4GM1A 5A5DA 2ZRAA 3M6LA 3L1UA 4QFCA 3A32A 1ODSA 2HWWA 3E3AA 4Z54A 1RQRA 4TLMB 4GI7A 4G85A 3EUAA 4JT8A 3ZXUB 5C8XA 2WNHA 5J2TB 5IVKA 1N7GA 2V4MA 1CVIA 4TVSA 4DSOA 3VPGA 3DMHA 3R7BA 4HVCA 2R8EA 1PL8A 5K99A 3NOQA 1H1LB 4LGVA 3BE8A 3SF8B 3Q88A 3NIGB 4EABA 4AB1A 4HZUA 1NLMA 1QJ4A 4POAA 1UEIA 4P81A 2A9PA 2HREA 3PHLA 4UTOA 5KHAA 3OT1B 2RE8A 4KNVA 4INOA 3DV0A 4M38A 4RYDA 4EHKA 3T5CA 1WU7A 1F6BA 1E1TA 3HNPA 5G4LA 3UN1A 5LL6P 2SKEA 2Y0EA 1E79D 3GZTB 2FPIA 4ND2A 4R0VA 5G0UA 2IUUA 3A7DA 4ZI7B 2O23A 2J5BA 5CVUA 1MZVA 4HQ6A 4ACAA 1YQEA 4I1OA 2HADA 4MP6A 5DYTA 3UPTA 1T2UA 2Y9PB 3G02A 3LPMA 4XLLA 5E6UB 4OJYA 1ZJWA 3WK7A 1BWSA 2W48A 4EFKA 1FLNA 3E27A 2Z6UA 4FWIB 2ZI5A 1CF4A 4HVTA 2C3PA 2O1XA 4OHPA 4CL0A 4QJBA 1TT7A 2QTNA 3E9EA 2CKMA 4KVGA 5A05A 3SSMA 5AHWA 1EQUA 3KZKA 1K63A 1E0JA 1LQ2A 2A78A 2ALYA 2Z2XA 2IEBA 1MABB 1PR4A 2ZKLA 4WDRA 5MF6A 1D2HA 1JH8A 1I51A 2ZVPX 3HPQA 3GCXA 4D9JA 1PVVA 3USZA 4WERA 3EG9A 1BKDR 1BXGA 1W581 3UT5A 1W85A 4HEA1 4F71A 2FSGA 2HIGA 1NAHA 5K3EA 3ZEAA 4YTEA 1A9SA 5FIUA 1E2IA 5FTNA 3UG7A 4BO2A 4CUZA 3GLIA 1KR5A 2QZZA 1Y8AA 4IDQA 1AE1A 1JVSA 2A2ZA 2VUIB 3EAFA 4C05A 1WA5A 1G3RA 2IIPA 2Y1FA 3FDFA 1LYLA 2IF0A 4QSHA 4MRRA 3MHTA 3L84A 5BWNA 2KLBA 5IASA 1XZAA 4HK4A 2ZAOA 2G9RA 5FI5A 4BFTA 4EUSA 2RCYA 1UWLA 3ZGVA 2DCMA 2ECQA 4FCVA 3B78A 3IOYA 2X8JB 3LVBA 4I9HA 2BBOA 4Q7MB 1P1IA 1YB5A 2AJBA 3DAYA 3L8DA 5F76A 1FS6A 1JQLB 1AM4D 2QPOA 1KDVA 3BDVA 3NTVA 3NZEA 4PYIA 2ORVA 3IT3A 3QUSA 3NEYA 3N07A 3FMVA 4X92A 1VG0B 1ULHA 3K8YA 3TI7A 3W04A 3ERCA 3CBGA 4DA6A 5DDIP 2ZVDA 1DAEA 1HE8B 4DJFC 2ZDHA 3NV9A 1F14A 3NONA 4EENA 5SY6A 1HFEL 1D6MA 1I24A 3MT0A 4JQOA 5A4IS 2WPDA 3WJ7A 1VLVA 2XDYA 2H18A 2QGNA 4G0YA 5C8YF 5FOXA 4P71A 2PUTA 2QG4A 2J9FB 2XPCA 3NJRA 3WK6A 2ZM5A 4K9QA 2DFDA 1PG5A 1FQWA 4R4JA 4W5WA 5EHGA 3SGLA 1KTIA 2XHEA 4YJKA 3VZPA 1OXSC 2XA2A 4Q4CA 4NYMR 3A04A 3H1EA 3IQEA 2YDXA 3LP8A 3NYWA 4KQMA 3VR5H 4HLUA 4AX8A 2Y77A 5A4AA 5BVHB 3MUFA 3RS9A 1T8TA 2Q1UA 1RVDA 2WC1A 7GPBA 2HRRA 2OXEA 2OD9A 1DJPA 1FUKA 2A5LA 3OIYA 4FD2A 4J91A 4Q3KA 5J59A 4IF6A 2GM4A 1U90A 2JLCA 3IUSA 4J16C 3VR4H 3U26A 4N01A 5GZ6A 3ZGYA 1IBKB 2GD1O 4HLQB 5ECYA 4AUMA 4CKWB 4IQ0A 3G82C 5KSZA 2AKWA 4B3CA 2Q49A 5J4VA 1Y0BA 1YB7A 1J97A 4I5GA 4PQYA 1JL3A 1GZ5A 2GHQA 2VDUE 4KN5A 4I55B 3KSUA 4GLBA 1CUZA 1N2CB 3P5SA 1YS2X 1XLWA 1KO8A 4KK3A 1E2UA 4D3FA 3O93A 3ZGNA 2M3LA 2VA9A 1DXYA 2HRZA 3KT0A 1K6IA 1S2OA 1P17A 2XGOA 4J4BA 3UHPA 3LNTA 4JBHA 4KAFA 1W4ZA 4LCJA 3UMVA 1NFFA 1E5QA 2I4MA 4B82A 5CITA 1Z4IA 1CQZA 4LJ4A 3H75A 3L1VA 4JEUA 3BG5A 1Q0UA 1I4WA 4WOJA 3O0TA 3NVDA 4FS3A 4XB6B 4XB1A 2XDWA 5FPHA 4E46A 4EKIA 4A1FA 3ZBTA 2W4IA 3AZQA 1YI8A 4W5NA 5DRTA 3SP1A 2EYQA 3M4NA 1Y7PA 2X1VA 1GUBA 2YV3A 4HF7A 3DXXA 3H5RA 3H5OA 1ZH6A 1BDBA 5JVDF 2PCLA 1QHEA 4C3UA 1XRPA 3BOSA 1JHXA 4RHYA 1YTUA 3FNRA 1WSAA 1OFIA 2EZUA 2OSBA 1A9OA 3N8IA 1C1YA 3NWBA 3L7BA 1ZOLA 2JRCA 1FYEA 3P2YA 4O2LA 1XLTA 1GJRA 2G88A 4O4LB 1P81A 3OTGA 4WESA 3TZLA 2ZE6A 4DLVA 4JLDA 2V6BA 2EW8A 4JUAA 2O3SA 3HDVA 1ZUNA 2W2VA 3BE5A 4XDHA 1LZLA 5JDCC 5CDUA 3SZGA 3ZUPA 3Q8LA 4MVJA 1XZBA 1D6SA 1BH6A 1IHOA 1K8YB 1ORWA 1EFPB 1TIKA 1XXHB 3FIUA 3GGJA 3HFSA 5FQOA 1RHMA 3P7MA 3ZCVA 4F9GA 2GA8A 4RLHA 1U2EA 1AF7A 1OGJA 2WP8J 3GFVA 1Y6RA 3ADPA 3BORA 5KTPA 2EZ9A 5BPFA 3VHQA 1MEEA 3FDIA 2NXJA 1Y3FE 4QYMA 2H4WA 1OR8A 4DA4A 1JJCA 1HXHA 1M3SA 2FOIA 5F52A 2FLKA 2BONA 2QZPA 2VUSA 4GWLA 4PAQA 4P8RA 1Q3HA 2OWDA 1A3CA 4KITB 3CSSA 4CXMA 1T4GA 3EDMA 2Q3FA 3F8TA 4M8LA 5T8KA 3T3GA 4DQXA 5COQA 2EJVA 4XYGA 3AETA 3FTNA 3MGGA 4TTAA 1W87A 4W8GA 4XIJA 1YZVA 1Q1GA 3NXSA 2E82A 2I2AA 5DCUA 3V8NA 3SQNA 1E2KA 1D2NA 2WKWA 4ZQGA 3EZ7A 3L1AA 4XIIA 4HNGA 4E5YA 4LDNA 5ESWA 1GPUA 1VG9B 4BUCA 3GLGA 2CFCA 1CUYA 4H2SA 2R8PA 2JGDA 2UZIR 1NTRA 3FRJA 4CLRA 2E37A 4MEJA 3H87A 4IGAA 4CU2A 4HGQA 3AFHA 5BMVA 3FVTA 4MWBA 1UC9A 4J7UA 4J9VA 1O95A 2OOSA 3ES9A 2H2DA 2EAUA 3MINA 1NM5C 5H3HA 3WGMA 3WSWA 2M6SA 2EZ8A 5K0ZA 3LGAA 2Z2JA 4FFSA 1N36B 1QLWA 1D4FA 1Z73A 2GCOA 3S7TA 2FK8A 4KPFC 2QRVB 3SYRA 3F74A 4D4MA 3GXBA 4QTXA 5KDDA 2ZZMA 2M2IA 3GUHA 3Q3IA 4G84A 1TPYA 1MB0A 2IEAA 1FQOA 1URPA 2X42A 4MYCA 4YCSA 3FAKA 4M9RA 1TZKA 3C7KA 5AHXA 5HFJA 2XZDA 5IKOA 2OQ2A 3V46A 2WJWA 4NBVA 3OT5A 1ZO8A 3GL9A 1W5AA 3U3OA 3RV3A 1B0PA 1CR6A 4EPRA 2GZSA 2P9BA 4B74A 1CJUC 2X1LA 4NFYA 2WQZA 3NGLA 4HMOA 5CH5A 1R8SA 5J9FA 3W05A 4D74A 4R16A 1D4AA 1JI3A 3M6WA 1DLIA 4RA6A 4BNZA 4EI2A 3W5DA 2PAAA 3HJCA 2BH2A 4QATA 3ENQA 3ZIAD 4WI1A 1H05A 1TYCA 1ZJ4A 2LV8A 2VO1A 3U4HA 2BFCA 1YCGA 2ARUA 2LDXA 4MB6A 4XVRA 1NVUQ 4O6VA 1VMEA 1A77A 1MNQA 5MN6A 4R0NA 4MXDA 3MG9A 4TLCA 1NXTA 2QJOA 3GRAA 4MRNA 4RQUA 2VHVA 5BUZA 1T4BA 3U3DA 3WWPA 1TUBB 1WZIA 1XA0A 4BASA 2Z6AA 3FCEA 3GY0A 3KLMX 3OZIA 5I47A 1NVMB 1ULSA 3T9DA 3EZNA 4YAWA 1TM5E 1O96A 4MS4B 4KXFB 2R8RA 5DBHX 6REQA 4JROA 3FCAA 1O0BA 1RWPA 1V5WA 1OX6A 2Z2ZA 5CH3A 4RACA 1LDYA 4FX5A 3KJEA 5AH0A 3UICA 3ESDA 4AQDA 1KTVA 4EQ6A 1A9XA 2IOYA 2PX8A 4U2BA 1DAKA 2VHYA 5KCZA 4C0SA 1Z2OX 2XNHA 3CGWA 1TMOA 1LC3A 1T15A 5BN3A 5FPKA 2FZEA 5BUSA 1XDGA 1CFZA 1ISMA 1NQTA 3JR3A 2D3TA 1CWUA 3A1SA 3A4YA 3DT8A 4KXWA 4XJXA 1A4UA 1V8PA 2HFJA 2HLDD 1RTKA 2HZBA 2W5UA 2CXUA 2ZIXA 3JASA 2V45A 3AHIA 3QJGA 4FHZA 4UNRA 3I8XA 2D74A 4LY9A 4Q93A 4ZVQA 2IOFA 5WRFA 1QKKA 2HPAA 3LCVB 4QTZA 4EW3A 2IEIA 3KJFA 3AEXA 4AECA 3AOEC 5EUBA 4O4HF 5G3ZA 1T0PA 4X64B 4PYJA 2FE4A 2PH3A 2VDPB 2OILA 5AKXA 1QRDA 4CPDA 3T9AA 2R9VA 3RLIA 1R16A 1M6NA 3N0RA 2WLSA 1NBEA 2WD7B 5CJPA 2XD4A 2G5GX 3O31A 1OWNA 1M2GA 1GY8A 3WZMA 4R71A 5L40A 4G24A 3LZDA 1FUIA 1R7RA 3ENVA 5GMOA 3EARA 4K6FA 4X1YA 2R85A 4NPHA 3ABOB 4GOKA 2XH8A 4IZ6A 4BFLA 1NPTO 1TCCA 1RT9A 2G9NA 3NH6A 1OIWA 3OCJA 3OPQA 3JQQA 3UTCA 2VNKA 5GGYA 4LMRA 3ZJTA 2CV1A 1Q1EA 2W2TA 3F5FA 5DOVA 1KARA 3EEIA 4DLZA 3ICAA 1P7ZA 2OHGA 4BLUA 5A2GA 5EKTA 3PG5A 2OCDA 2H4XA 4JEMA 1O5OA 1VI6A 2W2KB 3NT2A 1M5RA 5E1MA 3DW3X 1Y6GA 2VXYA 1SBIA 4Z2YA 4TXMA 1EVIA 2E64A 3X2SA 4OB7A 1WS6A 3Q3VA 4M9XA 4TV9B 5CVDA 1S7GA 3B7GA 5ICGA 2Q4OA 2F1RA 3EEYA 4FLFA 4BEBA 1E79A 1VKNA 2PFKA 4NZNA 4CI0B 5U9CA 5D1NA 3RSQA 1MAWA 2FW8A 2C9BA 2YJ6A 4DNPA 4F93B 1Y48E 3PSHA 4HDKB 5AKIA 4RKRA 4BKMA 3GLFA 1VPDA 3EWNA 4G0VA 3D4BA 1X9HA 3FVQA 4OI4A 1TGVA 4CG1A 2OD7A 5BQOA 3TNYA 2J6BA 3DEZA 4TS3A 4BZZA 4GPD1 1KMHB 2LKDA 3B1YA 4C9BA 2O54A 2BELA 3U7QB 1G7RA 1GZHB 1Q57A 1K7CA 2GTHA 1T6BY 2YXPX 3DTNA 3FYUB 3JQFA 3R7AA 3SBDA 4QJIA 3WG9A 1SB8A 1LPNA 2OYRA 5KVQA 5EUMA 5JANA 5KQGA 1IQRA 4MTCA 3MYRA 3I61A 3IAXA 3FMGA 4ZIRB 3GLFB 1HDYA 2X2PA 4FKMA 1JG3A 1EESA 3JTMA 2JJYA 1JRLA 2IHKA 3C0KA 1R6TA 3M6UA 1P0FA 5LM3A 2GZ1A 5JSKA 3V8BA 3OESA 4L8YA 2Q7EA 3M6AA 1W9MA 4D8YA 2W93A 2WM9B 3PICA 2ODWA 1VJ0A 2OZVA 3VMFA 2X40A 4UM5A 1V1RA 4OJTA 3QBJA 5I45A 4MVJG 3IUBA 2QG6A 1IC6A 1KU6A 2JH3A 2AMCB 1XA4A 4XA8A 5G0SA 2BCEA 4ZC8A 3V8QA 4B75A 1A1VA 2E4ZA 3OQHA 3S40A 3U3MA 2XMQA 5BY2A 1HLPA 1OXXK 3ZVRA 4KIFA 3TUIC 1QS0B 3D3QA 1XCMA 1V6AA 2OGWA 2VHCA 1ODJA 3JAWB 3LQRA 4CDGA 2YHIA 5L51A 3DLTA 5JBNA 2HF7A 1XAHA 3RS2A 1IE3A 3B53X 4GT1A 4DG9A 5LZ5A 2ZXEA 3VPHA 3O75A 2AFHE 2DY1A 2ZT5A 1VE7A 1RFLA 1ZN7A 2POCA 4QDXA 1MC1A 1UDBA 3L0BA 5KWIA 1V6SA 2IIBA 3N2ZB 4HXYA 4Q9AA 1RXYA 4QLOA 1B6GA 1FP7A 2P9JA 3FYDA 4N7MA 5ERGB 1FNBA 3FPSA 2O0LA 4Z7JA 4IFTA 2QTAA 3SHQA 2ZQYA 4WX2B 1RRPA 3AESB 1MOQA 1OXVA 2QD2A 4J2OA 1DL5A 4KO1S 2WIFA 3CURA 3PUKA 1DXHA 1K3UB 5I7HA 4QYWA 1ZH8A 1ZXBA 2I03A 5CFRA 4OJKA 4XOIA 4PPNA 2ARSA 4O25A 2R8BA 4O8ZA 3ACBA 3DMFA 2BFPA 3O8LA 1PTJA 4PYKA 4DLKA 4URZR 2CCKA 4HAYA 3GFTA 3K05A 1R00A 5IDYA 1GRRA 3R6LA 5M34A 1I32A 5H8WA 3TW6A 3QW4B 4RPKA 3W1EA 2JGRA 3LQKA 1YRWA 3E5HA 5EESA 3F4KA 1DV2A 5FBHA 3Q3HA 5FB3A 3HVUA 3KJXA 1TVKB 1W73A 3GJ5A 4CIAA 3HY0A 1NRXA 1KI9A 2G3YA 1A9YA 5IKEA 4YRPA 2PX4A 1N7IA 1D0IA 4ZO7A 1Z7WA 1V8DA 3RVPA 3G0CA 5F98A 1VHQA 3PUXA 3RVSA 1WUKS 2RBGA 1EI9A 4YJ3A 2WDPA 2ZBDA 3NBXX 5HILA 3IAHA 4P34A 5BSVA 5B4TA 1CYEA 3GQVA 3HCOA 4PX5A 3ITKA 3QIAA 4KN6A 1R4NA 5EZYA 5JIBA 3EBPA 4P2GA 5D2CA 3SSOA 4ZOLA 3V6MA 3PC6A 4DPMA 4QOJA 4D6XA 1W2GA 4AO7A 3K5WA 4GVPA 2NVUB 3ND8A 4QTYA 5E2BA 4ID3A 1C3VA 3KFLA 3PNBA 5BYKA 2IK8A 4NU5A 4XTUA 1PZHA 2HUNA 4HTFB 4YMWA 4EZEA 1PFVA 4FDLA 1XPUA 4JB2A 1KYWA 4G8BA 4HAOA 5AQ1A 5DM70 2C82A 1XNGA 3WGGA 1TC1A 2MR5A 2PS0A 1RXVA 1EVKA 1YFSA 4NESA 3T9BA 3D6JA 2QZ9A 1AN9A 4N47A 1YVPA 4HFNA 3WLJA 4BIIA 1P1BA 2OOKA 2VH5R 3AW8A 1P75A 4AH6A 1N6IA 4NENA 1JNYA 2DJZA 4AJIA 4B6FA 4QAQA 2R1TA 1U63A 4GG1A 3RUFA 4DJTA 1GEEA 4TMKA 3K70B 4M87A 4I4TB 2NUTB 2HSEA 1EBFA 3KQVA 3UK6A 3M70A 4BNWA 5BV8A 1HOXA 2O6LA 2V5AA 1YDHA 5EIOA 1Z5VA 2ZK7A 3L4SO 2P4EA 3RTGA 3UMMA 3UEOA 3U6KA 2O8FB 3D5TA 1JJBA 3RI3A 1KDTA 1QP7A 5IJAA 5HMMA 2P9EA 5DHQA 1CQPA 5KQSA 3KVYA 3HXOA 1PL0A 4OQPA 1JEEA 4Q1AA 1DWPA 1QOZA 1T0IA 3RC1A 2JGEA 3OZTA 3I9JA 2OHVA 3QVGA 4FS8A 2GXSA 2B9EA 4HQRA 3R7WA 1Z6GA 1MORA 2G6BA 2EGGA 1RC1A 1UANA 2EX4A 3I53A 4DEXA 4TWIA 3W2EA 1G17A 1Q12A 1P31A 2OB1A 3EGEA 1HTBA 3K9LA 4KBYA 5JSYA 2OV6A 1ZKDA 5EP2A 1K89A 4YXWD 1P77A 1E4EB 1NDHA 3QPDA 4WN9A 3RRMA 1ZL2A 1Y4ZA 4BAZA 3MHPA 5AJTA 1JR3E 4KXLA 3UAOA 2C8JA 4EJ0A 3FPAA 1E96A 2J8ZA 1ZIOA 5KJ6A 4P53A 1P7PA 2NG1A 3QJ5A 3FF1A 1G21B 4NE2A 1KH3A 3H7AA 5A0VA 4UEJA 5IC5A 5LXTF 4C3OB 3OEHA 2PRSA 4P9NA 4IOJA 4UBJA 3W06A 3W5UA 3KE8A 5HTKA 4DS3A 1NMZA 1V8FA 4TMVA 4ENVA 5CAEB 3CRVA 1VCMA 1MGOA 2QT0A 3WMGA 4LMPA 1CRWG 1T3TA 3WX0A 2WF6A 3IVRA 3P45A 1JPUA 2JGNA 1R27A 1XJWA 4NHOA 2DFNA 4XB2A 2GETA 3HXPA 1I6LA 4URYR 3PHIA 3UFXB 3WYAA 5JAPA 2FZ4A 5K4AA 1UPAA 4HYEA 3DE0X 4P83A 4NNJA 2F2TA 1TL7C 2D2VA 3LG2A 2YZGA 2JHGA 4C7KA 1U80A 2EYUA 4PCUA 4RKEA 1XCJA 5B2FA 1GR1A 3ZIAA 4YUVA 3GUYA 2ISCA 3PYLA 2JA2A 1SKMA 1WZ2A 1PLJA 1Z0ZA 3E9NA 1U2DA 3A1UA 4LHXA 1U0NA 4L9RA 2Q7GA 4HS9A 11ASA 4MKIA 4RQAA 5D5HA 3B9RA 5D87A 4DLLA 1HYEA 4QDJA 3RGLA 4ZVTA 1XKTA 3DLAA 2BHTA 1H4QA 2IXTA 1TO2E 2YWRA 3QELB 3GOHA 1E9CA 2QIPA 5DULA 3VHLB 1GNVA 1ESZA 4ZHSA 4J16A 3ZQUA 5JAMA 1PW5A 2O57A 4J4HA 3P2OA 3QQPA 3DKPA 1D4OA 1EWVA 1OBHA 2IUYA 2MMCA 3ND5A 4Y2RA 4EFLA 4EYSA 4F6CA 4FM9A 2DTOA 4IVQA 1SCJA 4UEWA 4J0DA 3VU8A 3EFRA 2JGMA 4MI9A 3MC1A 4YI5A 3RB8A 1I3OA 3ZKAA 2V7TA 4U6QA 2RK3A 5IABA 4RJ2A 4GVXA 4XWOA 4UUPA 2E5WA 2AHOA 1CU1A 3LQFA 4NG5A 4IPTA 1NKSA 2WJPA 5LZ2A 3L7KA 1T91A 1R9GA 4KEAA 1N2EA 2E87A 4LZAA 2CNWD 3HDTA 4EY6A 2BRUA 3V7FA 1WV0A 4O2BF 3ZLUA 1LH0A 2YZKA 4C0WA 2NZWA 4MQMA 1XXLA 3S1AB 2C42A 2PYIA 1AD2A 4HUQB 4JN6B 1BQEA 1IY8A 4A8JA 3R3XA 3EF3A 5KSYA 3E1KA 4J75A 3E3NA 3HS3A 3IDAA 4X6LA 1CSEE 3WY9A 1QDEA 3Q6IA 1TXGA 4J7CA 3HLTA 3IOBA 1K6XA 4ALKA 4BLTA 1TZMA 2P62A 1G19A 2WABA 3DA8A 1E6CA 1E58A 1IUPA 1KRHA 2CXTA 3L4GA 4K6MA 4M86A 5K1ZA 4DJEC 4DDVA 2VSYA 1AZSC 1ZM2A 2R6R1 2W83A 4IUCS 2B98A 2JGJA 4MDYA 2B1RA 1X7WB 3N2KB 4P5DA 2LGJA 2BGNA 2C2HA 2HJVA 5IXSA 2QV7A 3ZCQA 1NU6A 1PD1A 4OJMX 4B3FX 3OIDA 3W77A 1P2UA 3RFXA 5GVSA 1ZKMA 3KOMA 2VNAA 1U8FO 3GMIA 4FNAA 1MBZA 4PIVA 1KSFX 2G0TA 3MCWA 4OMFG 5FUBA 5I7FA 3GARA 2VG8A 1JSCA 4R69A 1JW9B 1IPFA 1OQAA 4MS1B 1LV7A 1JLKA 4ZI2A 3R0QA 1O0SA 2OK7A 3DO6A 3PC2A 1PSZA 2PGDA 1XN4A 1HYGA 2VTKA 4L0DA 5CVEA 2FMKA 4KJZA 5E6RA 5DGDA 1OFUX 3QVTA 2X9GA 5D3MA 9ABPA 4G8DA 2HUPA 3BGIA 2PUCA 3K1TA 4LNHA 2O5EA 1OFVA 1GARA 3ZV7A 1C3OA 3RGWS 5JI2E 1IJFA 2DYKA 4MDEA 1L1RA 2OUIA 1H4VB 5KOHA 4PVDA 2YRFA 2IC5A 5JMOA 5EZSA 3LY8A 4Y67A 3A27A 1Z38A 1Z33A 1QP8A 3OPYA 2RHWA 4JP1A 2OPBA 3C6BA 4DBZA 2UVDA 1JKJB 5AJHA 4Y6QA 1LDBA 2Q4RA 3KK0A 1IXZA 3LPAA 3HM9A 2CVHA 1W1WA 2Z58A 1NM5A 3ROKA 1DX6A 1EP2B 1KYTA 1NP6A 3B5EA 3BA1A 5DHUA 1L7PA 4GAEA 4NECA 3WGKA 4GP7A 5REQB 4F11A 3KTAA 4HTAA 4HNUA 4KQJA 5EG5A 3IT1A 4QBFA 2X15A 4HZGA 1XP8A 2NQTA 1SIBE 1PZMA 1TAQA 1VIDA 1ZNWA 2BC9A 3H2SA 3KFVA 5CHYA 3V2UA 4ENTA 1XDDA 4HAIA 1RRGA 1RXIA 2PV0A 4ENSA 2YZMA 1S2DA 2H48A 3KJGA 5FHRA 2X8LA 1P2VA 1TLLA 1UM8A 4HGNA 3T1NA 5JS6A 3L7IA 4D26A 3GOQA 5GADl 1SESA 4UE2A 3ZDXB 2QL7A 4C0LA 2F3QA 2V54A 4YO8A 2AOVA 3AF3A 3PYMA 2R48A 1ATIA 3EDYA 3FUWA 5J1SB 2QE6A 3LBHA 1O3YA 1JEJA 4Q7JB 4H1WA 3HXWA 2XYHA 3NHZA 4MHOA 1WDKA 1YJCA 3ETNA 4CS4A 1QWSA 1J49A 4DVGA 3ADKA 1PR6A 2IYTA 2X4DA 2WKRA 4BRUA 4D25A 3FR7A 3LRXA 2RARA 2F3SA 3NGMA 4RTOA 10MHA 4EVSA 1YKGA 4PZAA 4GQAA 4RV4A 2Q1WA 3KHSA 1WLSA 4FYHA 3JW8A 5J5AA 3D2CA 2ATCA 5KNBA 4HNTA 2D1RA 1WUIS 3QV1A 1C1DB 4HKTA 2O07A 5HDBB 3MQ4A 2ZJFA 4CQMD 2GFHA 3H0KA 5AOVA 1UKAA 4E1AA 1NHWA 4WZAB 2QHUA 4ZAYA 1XRRA 3SXPA 5BRJA 3UATA 3D0KA 3TVYA 2HLPA 1SUWA 3CWZA 3H19A 1FNCA 1EPUA 2GJ4A 4UTPA 1TUIA 6NULA 1Y6ZA 3IQZA 2HA4A 2YNMC 2I78A 2VXBA 2ZRLA 4UQPA 1XFDA 4B0PA 1OYWA 2AFIB 2HWKA 2R1VA 5G3YA 3TRFA 3WQHA 5FNZA 2O2YA 2PGAA 4BNLA 2PY6A 3K0HA 3L7AA 1VHTA 4PC6A 2ATVA 1PV4A 5K7SA 5KUTA 1C0IA 4AKSA 1VIVA 3AF2A 2EIHA 3DTVB 3PNMA 2W37A 2D06A 4MA0A 3HLKA 4DCJA 4LJ5A 2PUFA 3RKWA 3N2LA 1FP1D 3VISA 2BBWA 1CDDA 2XUZA 4ECEA 3AOEA 7MHTA 4GS5A 2HPZA 4RX1A 4JT2A 4ARSA 4DAEA 4Z4FA 4F6RB 3LT0A 3RHFA 3JWGA 1YC5A 4L15A 4RGBA 3UXEA 1J9ZA 1PK9A 1OIVA 3FVWA 2W2PA 4TV8F 4Y2XA 5KVCA 1IN4A 3V4FA 3U4MA 3B2EA 4UU1A 1GP2A 3AM4A 5I6DA 2QTBA 4CR6A 4O2AB 3D9QX 4AROA 1QP4A 5I3CA 3MERA 1KERA 1UBMS 1CJVC 2OV2A 1X70A 1KC3A 1M34E 2ID7A 2AN1A 2O7VA 2YKGA 4LHVA 4MGKR 4QRIA 5DIFA 2ZB2A 4R1TA 5D6NA 2PKCA 1KO7A 1P5HA 2RHTA 3CH6A 2NSJA 2WBLC 4LV6A 1KNXA 4Q1FA 4S1WA 2QL5A 1NLZA 3AQ4A 2PXHA 3JVDA 2JB9A 2XY4A 1B8VA 4J0CA 1N5RA 3T0GA 5AW8A 1KI7A 2IYFA 1M6VA 3WFZA 4RTRA 2VJLA 1G60A 3JD1A 4YIKA 3ORFA 3TI9A 3FW1A 1OWOA 4KIWA 1Y7IA 4ZO4A 1ORRA 2WK1A 4BQRA 1J7JA 2RGCA 1LVGA 4TLLB 3RFTA 2PKWA 1K2WA 4BJ1A 1TIPA 1C0PA 2VQFB 5EA2A 2ZYHA 4GDMA 4N6GA 5IUNC 3LSTA 1VRVA 1KA9H 1OZFA 3HP4A 5B7GA 2RGWA 4RV5A 3H9UA 4PICA 1YZGA 1QHGA 3E1GA 2FWJA 1EFWA 2G82A 3IPRA 1ZI6A 5IMSA 3E7PA 1W93A 3F67A 4TKMA 2FW7A 5EWMB 4W6ZA 3E35A 2JI9A 5FUVA 3OD5A 1RBYA 1U99A 2SBTA 4EPYA 3N8GA 3P71T 3OM1A 4M7RA 3CVWA 4UPVA 3M7IA 3A1CA 4L8FA 4A3SA 5CD9A 2ZIFA 5TXGA 3LCRA 1S02A 2AR9A 1P18A 3M4PA 2H8GA 2I29A 4TQUS 5TF4A 5JASA 3ZLJA 4RNDB 3W5IA 3NVKI 4O4JA 4YAFA 4TRNA 3TOXA 4BNDA 3IAS6 4GMFA 4UBOA 1ZAYA 3A6PC 5T4BA 2ZTUA 3IRVA 2ZUDA 4EAAA 1IZ7A 3L0ZA 3A05A 4YXWA 1BJKA 2QWXA 5AESA 5JDIC 5MFZA 3X43A 4QFDA 3OJEA 1PZEA 3P26A 4IHQA 3SC4A 3W5SA 2JLRA 3HADA 4HZUB 3ESRA 1VBMA 2W6CX 3MNFA 3EYWA 2YHUA 3SHFA 4AZ0A 2E2WA 1QIDA 3I83A 1E2EA 1WNTA 3DV0B 3Q8WA 2QRZA 3U16A 2ONZA 3ILVA 4WZZA 5HF6A 2FPIB 2AOUA 1LQUA 2B37A 5JXWA 2HSDA 3GRPA 4BYMA 2QMYA 5J5VA 1P80A 4C0XA 1KDPA 1L5LA 2FLWA 4GC5A 4LOHA 4GE3A 3K0AA 4E13A 5HE9A 2Y0DA 2JHCA 5T7BA 3DOUA 4GLFA 4L8GA 2Y0BA 3OY2A 3T5GA 1EXVA 4CEHA 5IAKA 4RDIA 1JAHA 4YONB 3WIVA 4ARVA 2J32A 2A5FA 3NDPA 1I7PA 5KYUB 3WGHA 3SK0A 3I1FA 3R5XA 2X5NA 5EQTA 4A4DA 1G98A 2VJAA 1P1RA 2BJVA 1IH8A 2PJUA 4QUBA 3C3CA 5A71A 4PAOA 3TLCA 3ADBA 2OHFA 1ZGBA 4LOLA 3M4YA 5CHEA 3ROPA 3HGQA 2ALYB 4ZV4A 2GX6A 3T35A 3T4UA 3I92A 3K8OE 1S96A 2QRHA 3N75A 1IM8A 1SOAA 4PLTA 2YNMD 4G1MB 3EG9B 1Z0UA 1BXGB 1YD7A 4OHVA 4COKA 2M98A 1W85B 1LVHA 1PK8A 3L6UA 1E6EA 3AEZA 4RSRA 4G6ZA 1L8AA 3UJCA 1J5EB 1GN8A 3ML1A 3V8MA 4EKEA 2AA3A 1ZHOA 2D62A 2E4XA 5B58C 3GLIB 2BFFA 4R05A 4QPZA 1E6MA 2B2NA 2JI7A 4HLNA 1GKLA 4X97A 3P96A 3S5UA 3THYA 1EGHA 5JD5A 4Y1RA 3RUCA 4CGZA 1O4VA 3IP9A 1RABA 5C1BA 3A7RA 3L0IB 5TS3A 4JI0B 1F12A 2B20A 2E65A 3I73A 4HATA 4R9SA 2CNDA 4E2FA 2VT6A 5LQUA 4UHCA 3B70A 5IDVA 1OREA 3KVOA 4ED9A 5FPTA 3WI7A 3EGIA 2VZ0A 3EC1A 4L7VA 3HFVA 3VQTA 1KQ3A 3M33A 3RIGA 1MO4A 3O1JC 1OUMA 2CNWA 2HCBA 3HY3A 4BLWA 1J7KA 3RVQA 3WBKA 5I9MA 1F3OA 1DQNA 1Z75A 2J09A 4H15A 2J3JA 3W3AD 4OGLA 2JKZA 2PG3A 1HG1A 4QWWA 4DY4A 3DNFA 1KMCA 1PGNA 4ZJZA 3IOEA 3A1DA 5DEIA 2XUQA 1WEHA 3SQOA 2FGJA 1RQ7A 2XKAA 3KD2A 3M6VA 2JJ1D 1NBWB 1V8OA 4NDAA 1FTWA 1YIAA 2WIJA 4BYGA 4GZ5A 4GKVA 1SXGA 2IZOA 3N39C 5EHZA 2A84A 3TSCA 1UBOS 2WWTA 3ELWA 5T67A 2IBTA 4N9WA 3R24A 3IH5A 1BTOA 4UD2A 2QW0X 1I4TD 4YCCA 4UUQA 5ICSA 3OBBA 1ZUHA 1JLLA 2P7HA 4UP9A 4J43A 3WRXC 1G4AE 1NULA 1Z83A 4EA7A 2JIRA 2Q45A 5CIWA 3UT0A 2DBZA 1U1FA 3PDCA 4Q19A 3PCOB 5JJLA 3JAKA 1E0AA 1UBUS 2Y27A 2IHJA 3OZ7A 3IPLA 3O91A 3CB2A 3TDMA 4CHTA 1T5HX 1T29A 3HCWA 3LWNA 1T9KA 3CNBA 3C41J 1K9VF 1T9AA 5BMOA 3TTYA 1V43A 2AKWB 3G5TA 2X58A 1ZGAA 2Q9UA 1MJ5A 3GVXA 1PRYA 4IEEA 1YRAA 1DRJA 3I0MA 5CLLA 5LDDC 4X20A 4WFKA 1QQBA 3CR7A 1LSJA 1KOGA 2N3ZA 4PPFA 2CT8A 5JRDS 4EHAA 4X45A 2ZPUA 1GQYA 4C4ZA 1H85A 1XQXA 2XCOA 4FNMA 2EP5A 4K46A 3FNGA 4H08A 5K8JB 2O52A 3DSQA 2GJAA 3BZBA 3QOFA 3L79A 3M1AA 1XZNA 3E9MA 4DMRA 4ZEVA 1HQCA 2IHUA 2IPAB 3OZGA 4L5YA 1KI1A 5K4HA 3RJMA 2WB2A 1X1DA 3R3UA 2IYLD 2PT6A 5G1PA 5B37A 1RKBA 4IILA 1U1IA 4BV3A 4D82A 1VFPA 3NGXA 4G5FA 4KTTE 2IH4A 1JHDA 3HG7A 1VHDA 4LJ6A 5CT5A 3IP8A 1FDVA 1YL5A 2R7LA 4ZEXA 4OFWA 2FSFA 3QUBA 1WXQA 2Y1WA 3I9V6 1RKQA 2C8MA 1YWGO 4GEKA 3LYLA 2B69A 3QPAA 4K3VA 2RGYA 5KTOA 3AWIA 4L3OA 1T2FA 4WESB 1RI5A 1P6UA 3BH6A 4RVHA 5K6RA 3C5HA 3LXUX 4MJ3A 5FHQA 2PUEA 2HNIA 2DQZA 1L5WA 2LCFA 1ZUNB 3N6XA 1LB1B 2O3UA 4JK3A 5K6TA 3TDNA 3C8UA 1NSFA 2F3RA 1KZ9A 2RH5A 4JMLA 4EGSA 1YZHA 1ECLA 1E1YA 1VHJA 5CLFA 2IOFK 3QP9A 3UENA 3USES 3WGNA 2PKRA 3CJTA 3KM0A 4L5BA 4NWIA 3U4AA 5DH9A 1Z9BA 1I7QB 1ISPA 4ZT3A 1CPYA 4P72C 2O9JA 3BULA 4AF7A 2B94A 3I04A 1JJCB 1SR8A 4WNAA 2N75A 4P82A 4KP7A 1RACA 3HXXA 2CMFA 3OH8A 2GFIA 4C03A 2H54A 1JAYA 2E1RA 3T54A 1HQKA 1ZC4A 4BKRA 1XKXA 2F3PA 1T0BA 1SVKA 2GILA 2ZJ1A 3AETB 2DFKB 3CYFA 3OX2A 4ZMSA 1KZGB 1PP4A 3OA2A 4WFQA 4AIIA 2H07A 3PD1A 4WZ6A 4DV5B 2J45A 3MWFA 3LKVA 2WFZA 4TX1A 1E9SA 5HZHA 3GLGB 3KJNA 4GX5A 1RXSA 3GQBA 4OQXA 2JGDB 4CQMA 2XMCA 1ZOSA 1GO2A 5PGMA 4CLRB 2BLNA 3EA4A 4H2TA 2FUCA 2RGDA 4KW7A 1UK6A 3UVEA 1QIFA 3G2NA 3OCZA 5BP7A 4I66A 4OBEA 3I0NA 5BMVB 4OXQA 4WADA 5G53C 3X1KA 1W5EA 1AB5A 2CLLB 3MINB 3KIPA 2XGSA 1N2SA 2RGAA 3GRUA 3NHLA 2O2EA 1A5ZA 5JAUA 2GCOB 1OYYA 2B8NA 3MMSA 4MMYB 4P3XA 5IYZF 3RH0A 2WUGA 3QFHA 3LGSA 5F9MA 1Z4MA 1GADO 1OAAA 3DHYA 4JT9A 3VOAA 4F84A 2BUAA 2V58A 4MQ5A 1PGJA 3B1XA 2HJGA 1YZYA 2Q07A 1DTEA 1GL6A 1QHFA 3AT1A 5A9TA 4TZTA 1H6DA 1SK8A 2QGZA 2XBUA 2BLLA 4M9CA 3VYVA 1QIMA 2GJ9A 4E08A 1L4KA 5KYUA 5A7HA 5HZGA 1A2QA 4B17A 3V4ZA 4QEZA 1VZ2A 3V1NA 4I1YA 4L3VA 1NA5A 3QE2A 5CXUA 2DJIA 3KXIA 1AHPA 2C5SA 4NU8X 2ST1A 3D0OA 4CCYA 3DAOA 1N1DA 3RADC 2ZSAA 4RA6B 5EAIA 4AU1A 1NVEA 4C43A 4BQFA 1DADA 3OCXA 2O2ZA 1E63A 2FHSA 3RBZA 2C8KA 2BFCB 3RNOA 2R2AA 3KZCA 4XIYA 4YALA 1LDGA 2ES4A 3IMEA 3KWJA 4NULA 5DTEA 3FJPA 3ZN2A 5B30A 5CG1A 3P2JA 1EP1B 3GJZA 3TBFA 2LJXA 1XQYA 2GEBA 4ZCPA 1WMFA 3D7RA 1MX1A 1QLHA 2PLNA 4CWAA 2OCGA 2V1UA 3AG6A 1GM5A 1F2UA 1I0IA 1DUVG 3AU8A 1EWQA 2QMOA 5D7BA 1O96B 3CSDA 4J3JA 6REQB 2H59A 2JATA 3TTXA 1A9XB 1CRQA 1JXOA 4EQ6B 1PHRA 1VQ1A 1CZRA 1HI9A 1A88A 3C6KA 4X6YA 1LF0A 3TOZA 4HYQA 1ZNXA 4DYVA 4X6UA 3H8WA 1G5RA 5EXXA 5J43A 1JV2B 3ZE9A 1DLJA 1JDBC 1VL5A 5BN3B 3DJYA 5CROA 4IH1A 2QLBA 1S4QA 1DMRA 1QIGA 3BEOA 4GOMD 4P74C 4JNKA 3WYBA 1FTSA 1DC3A 1DOAA 3LC2O 3Q9SA 4FZ5A 3ANYB 5CVTA 2OECA 2WJIA 2ZIXB 3GVIA 3LLSA 4HQKA 5L3QB 2EBUA 2H0QA 3JASB 4JJ6A 2HJSA 4RD3A 3RHTA 2WSIA 1IZZA 4IIJF 1T8WA 2HA6A 5DU2A 3TQQA 2Y1OA 5L4SA 2ACKA 2UUCB 2I4IA 4D3ZA 5TX7A 2CXXA 2QMHA 2VF8A 4TMYA 4UATA 3AM3A 2G5PA 3QA3E 2WYOA 3B3QA 3T3NA 2Y71A 3PSAA 1PKEA 4RIGA 2FWBA 1JS1X 4HDAA 1DU4A 3LPNA 2BMDA 2XIJA 2FZVA 2GN1A 1FLVA 2CZCA 4UTNA 2O7RA 3T5PA 1VSBA 4WLVA 2OBYA 3IXQA 4X1YB 4D8WA 3SR4A 4IDOA 3SYTA 5D84A 4JJKA 2FCRA 1SC9A 5EKXA 1TCBA 4UHDA 1I14A 2DKOA 2Q4EA 1JG2A 4WEQA 5JRZA 5LNK6 1RHJA 1TIBA 2GM3A 4FYVA 4LZNA 4P32A 3RVLA 1X15A 5F78A 5DO9A 1R6UA 2PDAA 4XR4A 3GIDA 1P7WA 1H2EA 1QSGA 5FWDA 2X22A 4RZIA 3QEAZ 1PG0A 5L6MB 4KLNA 3FTDA 1I3KA 1UKBA 3P0FA 4QTTB 1GNQA 3R9KA 4DADA 1UKVY 2C97A 1YT5A 3L77A 4F97A 4TKLA 2VAWA 1PR5A 3EIXA 4UKDA 4FYKA 5BNFA 4BZXA 1P45A 1ZK0A 3KQPA 4K03A 3S2SA 2FEWB 4KE7A 2YY7A 2HDNB 2AX3A 2QMUA 3OT4A 2V0GA 3DG9A 3OJFA 3MRSA 1WKCA 2JBWA 1RE0A 4B5KA 1DRVA 3PEWA 4PZLA 1UZLA 1R4MA 3PC8A 2ZI7A 3FZEA 1Z7BA 4YCAA 5C51B 3I2GA 2BMJA 5TQVA 221PA 1ISFA 1KP9A 1RPAA 3RAGA 3RRZA 3SDBA 4FGUA 2ORWA 3EHEA 5EJ6A 1BG6A 3KHKA 2J3HA 4MIOA 4MVXA 3VPXA 2AZXA 3C5EA 3UH0A 2BZSA 4F8EA 3IEVA 1PUXA 5DF1A 2LBPA 4LF5B 5CX1A 1EAYA 2BE9A 3QE3A 3OTHA 1CNMA 4XFDA 4RJTA 5ES4B 5LMUB 3ZY4A 5F9HA 2P4QA 1T1IA 1YQWA 3DZHA 1P2DA 2AJDA 1P9NA 2D2FA 2HSGA 2YBDA 2ZRPA 3U37A 4U2EA 1UC5B 2VF5X 2XB9A 4NE7A 4PC3A 1N78A 1M8PA 2PTGA 2YFYA 1UXGA 3ED5A 3GNLA 1C8VB 3O8DA 4H16A 5GQSA 5BQ3A 4NFSA 2XYQA 1Z7GA 2Z09A 3VH1A 2FX3A 1GPNA 3I6BA 3PC7A 4RW0A 3REQA 2DFPA 4JQYA 3TZCA 4TVYA 2FPSA 4JJ8A 4FKBA 3E18A 1FU8A 4D56A 3L3BA 3D64A 4TZKA 4ZVOA 2QEQA 5HRCA 1NQVA 1N6KA 3OHPA 2DEQA 2A3RA 4RH1A 4LZPA 1V1RB 3GFSA 1YR7A 4LRWA 5KTMA 1T6YA 2CZQA 2AHRA 2MYTA 3HSYA 2RI0A 2Q29A 4EARA 1YRLA 3ENZA 5IBCA 3MOIA 3PT9A 1SQSA 3E9CA 1WUJS 3LA6A 3IBCA 1M6HA 4O1HA 2ATEA 5HGJA 1IIBA 4ZT4A 2BZGA 1UC4B 3SD7A 2ZZFA 2L19A 1HTTA 3KB8A 2FAXA 3TXXA 3ZE1B 3KNZA 3P4UA 4YRGA 4Q4AA 1YDFA 4AJKA 2HBYA 4HP8A 4D4JA 3UK1A 1G55A 4HVAA 5T41A 5L7TA 4Z9YA 5BOSA 1H0RA 1ZLXA 3GLUA 3KZ1E 1Z8HA 3FGPA 1XF9A 3G1WA 4LC0A 4PLZA 5AK5A 4EO7A 1NAIA 1ISJA 4XYEA 4ZD6A 4KQIA 3ZWDA 2JJ1A 2QN9A 1PWEA 1K7YA 2GPTA 1VPWA 1TA9A 2OCPA 1G2QA 1SN7A 2DQKA 2ONJA 3ZNQA 5AW7A 1UKEA 2AQ8A 4AMVA 1Z0SA 3ANMA 3E9DA 1CNEA 4BP1A 1XEXB 4BO5A 1CJTC 4B7AA 2LIPA 2VRBA 2ZRDA 1H2YA 2VQSA 3GEEA 3R8XA 5LOVF 1AT1A 3T3OA 2PRKA 3IO5A 1VCIA 4Y2YA 4H7EA 3EXHB 2X4IA 4RETA 3ZZ1A 1R5JA 1H8HD 1R0CA 4R68A 1UP4A 1AS2A 1BKYA 3H9QA 1J9EA 3SLGA 4ES6A 2JLYA 4N6OA 3T7CA 4V0MA 5J1TB 2GO7A 3AIKA 2Y92A 2PD4A 2R47A 3OAAD 4YP7A 4ACBA 5HS6A 1J2UA 1NKTA 2O8VA 1P72A 4W1SA 2ZR3A 1PV2A 3URMA 3OTOB 3O8BA 1DJQA 2GOYA 3GJYA 1LW7A 4XWKA 1PT7A 3GLHA 3VZSA 1X01A 4Y2SA 1AA9A 4LAFA 4YJ3B 2B8WA 3I6IA 2XCUA 3NR2A 4TTSA 4YRBA 4YRRA 2EQAA 4YDSA 4F4HA 3RL6A 5LCXA 3M49A 5D01A 1YFJA 2CZGA 5EZYB 5E0OA 1R4NB 1X80A 3A3PA 1KQOA 4ZOLB 5AO9A 4X3PA 4LTMA 2E5LB 4DV3B 1CG6A 1KAQA 3WK5A 5JDIA 1BWQA 2XDQA 2WJ4A 2B36A 3E70C 4LYFA 3AI1A 1QAOA 2FTKE 3NC1C 3V9AA 4A8TA 3CW8X 1X1EA 3NTXA 1G3QA 1V11A 3WKAA 4B40A 1Q0PA 4KPEC 1E4YA 4O2DA 1ESEA 1P9OA 1RHUA 3TVDA 3V6LA 4ICIA 1GUYA 1MB9A 3NHMA 3VOBA 2VJPA 4NYJR 2I3BA 2Q8NA 3ZWVA 5JSHA 5AW0A 1Q0SA 3MILA 5MGNA 5EKDA 4TT3D 5EQJB 3U4DA 3UB3A 1UMDA 3I3SR 4ZCLA 5DYGA 5ICEA 1QV9A 4DBLC 2VTBB 1PT5A 3AC0A 3A4MA 2Y68A 4NENB 2PZLA 4X8HA 3WGIA 2XHZA 2W70A 1RXWA 4E3ZA 2EWNA 2R1TB 4JYMA 4WZBA 1GQFA 1Z2CA 2G77B 1RYHA 1EFHA 2ZTHA 4F4FA 3HFZA 4Q9DA 5CG2A 2VI5A 5DM2A 5FPPA 2BEWA 3HJAA 3I2YX 4HQNA 3LBNA 3SC6A 3H6KA 3ZQ4A 4EVQA 1A2OA 4BE7B 4R8VA 4R2IA 1MXFA 3KQMA 3PC4A 1NJ8A 3I30X 1QO7A 1RAIA 4BQOA 3SE0A 3CNEA 3CCBA 1K27A 2GYVA 4KN8A 1XL1A 2C2MA 5HJ7A 2VF4X 3TIIA 2RKBA 3G88A 4LJ8A 1PFGA 1SA0A 3VYUB 5A0TA 3E9YA 1XB2A 4K1XA 1P33A 2YUIA 4PQGA 4BZQA 3PXAA 1UWCA 3QVGB 4WW0A 3S8EA 3R7WB 2MSLA 4KPUA 5IT5A 3CX3A 3K2BA 1PEDA 3SBXA 3VSEA 5CK5A 5JSQA 1JYSA 3GCDA 4Y2GA 12ASA 1GUDA 3R5SA 4CG2A 4MDFA 4IGKA 3WGTA 4NATA 1KYYA 3DC2A 4UEOA 4CQJA 4YT8A 1W4LA 2ID8A 5EXSA 5HP4A 3P9XA 3BM5A 4WN9B 2AW3A 4R6WA 4XFKA 4DC9A 2BJWA 4AMZA 3E61A 5CFOA 4ODIA 4L5CA 4AJJA 4ZXPA 4RHEA 5H7XA 2QM7A 2X13A 3IODA 1A50B 6CROA 2YXBA 1XZPA 5K8TA 3NI2A 4A6EA 4X41A 5GOZA 4NQRA 4QBKA 2IOHA 3UK7A 1XLVA 1BS2A 2XUAA 3HLYA 5CTJA 2J3LA 3V32A 1U3GA 5C5DA 1ZD8A 3MFYA 3TH5A 1E9FA 1KKMA 1O7JA 1W0KA 4XUEA 1YUMA 4K6KA 2PMFA 4LNAA 3Q4GA 3C48A 1XAJA 1JU3A 3IR5A 4H3VA 3EFBA 2EF0A 2AE1A 2GLTA 1B2RA 1VIAA 2QZ4A 3OE1A 3EBLA 5L3RA 2DP4E 1U11A 4TSFA 5E4TA 4RMHA 3EFOA 5H1YA 1NX9A 1ONSA 1SCBA 3O3CA 3CC8A 1KIMA 1U6JA 5C31A 3UY4A 5CB4A 2HCFA 2VYND 2B35A 2H92A 3T3HA 3WQRA 4V1CA 3I5XA 3IKVA 2CIMA 1HNWB 5TJ9A 2CJFA 5BVGA 5A3RA 1QHNA 3HGTA 4MIEA 3AKEA 3MS2A 3WLQA 3WRXA 1VL6A 3A2LA 3FMFA 4B6QA 2IHBA 2J3DA 2HHAA 1E7WA 4A73A 5IF3A 3ZVNA 1ILWA 3GUVA 2DPMA 4FN4A 1DAGA 1EJ6A 2VWGA 1KC1A 1N2BA 3WV5A 1KJ9A 2BISA 5CRIA 3LX5A 2ALJA 4OPMA 2AV6A 1Y89A 4DF3A 4F72A 1CQWA 1ADCA 2JARA 3K8QA 1XTSA 4L76A 4EYEA 1XJCA 1U5CA 3H5VA 1NR7A 2BMVA 3LX8A 1B23P 4BV2A 1WZNA 4EH1A 2OFPA 2OXCA 3M0EA 4HZIA 2GXQA 4LF6B 3ICQB 2EHJA 2Q6IA 1S7CA 3A8TA 2QN3A 4MROA 4PR0A 4ONEA 1NW3A 3FFBA 3AGPA 2Q3DA 4JR0A 3EDOA 2IYEA 2AI3A 2GEJA 2HA3A 3D7LA 2GARA 3H8JA 5H02A 3RS5A 3BERA 1ZBDA 2AG1A 1EINA 1SCDA 2KI5A 3A6JA 2UUAB 2R1ZA 2C3MA 2PEZA 4D4KA 4GMDA 5D7NA 4A8JB 4LF8B 2ZRIA 3VSBA 3L41A 2IXEA 3T4EA 3LHKA 4MKHA 5F4BA 4LISA 1W35A 2ZR9A 3H2HA 5EJAA 4A8HA 1GV1A 3NDJA 4JIMA 4PINA 4DKJA 1ZH2A 5AICA 4JKYA 3L4GB 2H17A 1HT0A 3U1VA 3RANA 4MUGA 1MAAA 4OD0A 3KQQA 1OAOC 1TB4A 3U09A 1DJOA 3G0OA 5J3JA 4E4YA 1ZSNA 1L7MA 2HMAA 5GP1A 3IHLA 1AK1A 1ZI9A 3V4OA 1RWNA 1XQ1A 1IEQA 1PJ8A 1XN1A 4Y1FA 2I3GA 4Z86A 3KKMA 3HB0A 5D8DA 1I7SB 2C1ZA 4QFMA 4I8XA 4FFRA 4IW3B 3SIXA 4F4JA 2ZROA 2IZ6A 3PDHA 4DWJA 1GA4A 4P72A 1TJNA 4YO7A 1DO2A 2JH8A 2LZ0A 2O2GA 3AF0A 2EBFX 1QG4A 4FFOA 1NOKA 1PYSA 3LP6A 4GBGA 4H35A 5E6RB 7AT1A 1NOJA 4BNJA 4H59A 2COEA 3IS3A 3RC7A 3TAXA 4DAOA 3O82A 1YU9A 2P65A 5D3MB 2QSUA 4ZOCA 5A62A 2GDJA 4OHXA 2VRNA 1DX4A 2P8SA 2Q0SA 4R81A 5KINB 1NASA 2HA0A 1LF5A 1QIJA 1YZTA 5KOHB 5AFSA 2EARA 3VDQA 3AXSA 4HWSA 2PM8A 2QW1A 4FPXA 4NK5A 3MWJA 1VJ1A 4G0PA 4Y0AA 4D0NA 1OIXA 3DCIA 3OPYB 1ONBA 2GN2A 2RFLA 4W6QA 3ABIA 4NBKA 1XTZA 4DV2B 4JP3A 1FXSA 4GXNA 4TVWA 1SD2A 2PVPA 3F8SA 3SFZA 4FSDA 4FOLA 2JLSA 5HZKA 3U1BA 4ZCTA 4MITA 3VA7A 2N46A 5HKKA 3KTAB 2V96A 3T4PA 2Z83A 4CL3A 4B3DA 2YIVX 4BVKA 1EE9A 1SIOA 4R1SA 1XTPA 1L7RA 1DIBA 2GWRA 3PQ6A 2P9TA 3C6MA 5JFTA 3CZCA 1G3MA 3HJGA 1M2HA 3NETA 4NCIA 5DXAA 4DR7B 3OCVA 1B8UA 4IYJA 4QHSA 3MJRA 3T0IA 4Y18A 1GHTA 4L72A 3QFTA 3DL0A 3H9BA 1CZLA 2B6NA 2P2SA 2W9XA 1QHYA 5JNSA 4J3NA 1BZYA 3AI2A 2XDAA 2CVOA 1BVYF 2WU4A 3L40A 2F90A 3QI7A 3HCRA 4RE6A 4ND6A 1N3IA 1V4NA 4D42A 2R4UA 2RK6A 4LKRA 3HTZA 4NH0A 1YDGA 4JL5A 3LS2A 4D0RA 3O7WA 1E7YA 1FIUA 4CM3A 4CV3A 4CH5A 4II2A 1C4WA 1D1LA 2FNAA 2JLXA 5EZ5A 5BYBA 3A2MA 3AUFA 3ZNNA 3JVUA 4FDMA 4CTMA 2FETA 5JOQA 3K96A 4GUAA 4MKGA 5DNAA 4IG4A 1N0IA 2BR5A 4R9UC 3WGZA 4JZKA 3JY6A 3VU1A 1EFRD 1LPPA 3HA5A 4AJHA 4ER5A 2XVXA 5FWYA 4MV5A 1OLSA 1U7OA 1QFXA 3KZVA 4CDMA 2J3MA 2BM8A 4WXMA 2JFYA 2XGTA 2ZIOA 1DQSA 1N5DA 2GAAA 5G0WA 3A26A 2PPVA 1P1CA 3AI3A 4BPBA 3ULKA 1EA5A 1UINA 1RR6A 2LVBA 4TS1A 4P74A 2Z2YA 3D6TB 2R1VB 4DQLA 4QGSA 2D54A 2Z5GA 5JNWA 1RPTA 1HFJA 4LDQA 5IKPA 1PJ4A 2XRZA 4D97A 1ZCZA 2LW7A 1DAFA 4RSHA 4XTVA 5CDSA 5LD2C 1WSWA 4KI7A 1UOEA 2BGMA 4RF2A 2F1JA 2JLVA 2YVAA 3MWLA 1RPJA 3NYQA 4UVIA 5BSHA 4A82A 3OG9A 1GTVA 1GGFA 1IHUA 1W34A 3I58A 1I5RA 3NNDA 5EPEA 1C9KA 2ZIMA 4LYGA 1OW3B 4CU5A 2PMEA 1JGTA 2DBYA 1K08A 1BGVA 2XYPA 4GI3A 3EDRA 3EIOA 2A63A 1CUHA 2J87A 3CMMA 4QG7A 3BFKA 4FBGA 3EYAA 2ZVQX 1J0DA 5F35A 4Q3LA 4L5IA 1LSOA 3LQ4A 3TZBA 2QY6A 1FQJA 2IYNA 3VQYA 2PU7A 3CPEA 3FY4A 1CR2A 5MGBA 2GEKA 3H1TA 3I6QA 4GYYA 3PNKA 3BXEA 1R6XA 1DEKA 4UNQA 3UKDA 3GDGA 3WGYA 3REFA 2DETA 2IHTA 2NZVG 3EF0A 2WINI 4F9FA 1ZN2A 3TE7A 4DLYA 1HG0A 4HNVA 2UYHA 5BSMA 1ACJA 3CH7A 3OQBA 4C4AA 3GGDA 1N8KA 1WCWA 2AWOA 3ZBQA 3UJ6A 2GLXA 3NEPX 3W8EA 1J21A 1DO8A 4DUYB 4LY6A 3BH7A 1M6VB 3RT7A 1J07A 1BD3A 2Y2UA 3AB3A 4JBNA 5CBKA 1QG0A 1SU6A 4JSRA 4TWZA 3E2PA 3QWHA 4J0GA 4Q3AA 5EMHA 2AKAB 3OCUA 4H7DA 4S1NA 2ZI9A 4UM9D 3ZE0B 1RC8A 3M5PA 4ZVRA 1S6YA 3LQQA 4PSAA 3Q9NA 2B7BA 1KOFA 2VDWA 5T5QA 2BP7A 4Q1CA 1LLCA 5JR3A 1L5FA 3HDJA 4P6VF 1EZ4A 3DBHA 3X44A 4IDDA 3RIRA 2XCSB 1ZMBA 3G49A 1P2TA 2R5WA 2JIZA 1I0LA 3ETCA 3IMFA 4OXXA 2BKLA 4QYIA 4RJIA 2DAPA 3KKQA 4IRMA 4R7ZA 1N8SA 4EMUA 5EJMA 4Q48A 5LB4A 5AKYA 1UWVA 1OH7A 4EZBA 5GJCA 1DIOB 2OV4A 1JLHA 3DKIA 9MHTA 2B78A 2C94A 1YI0A 2D8MA 3CNLA 3P27A 3Q9UA 5K5EA 4G0XA 3ZDFA 3EZ9A 4H2YA 3REOA 2EBWA 2OORA 4EPXA 2G80A 3WLRA 3H3XA 2VP9A 4R31A 3DTTA 2FXIA 4JVNA 4O4JB 3RJ9A 4BNDB 1XJ0A 1RZUA 4ZALA 3RJZA 1TAHA 4YRFA 4FVTA 1CV2A 2Z98A 3CF0A 1HK7A 4BX8A 3RVJA 1J1UA 3DW1X 3ORYA 4RVGA 1DELA 1XGKA 3MUOA 1GNTA 1LZKA 1R0KA 1ZHHA 3OZEA 3H8SA 2Z43A 5EIAA 4MQ6A 4GQIA 3ONWA 3BRQA 3QLJA 3U44A 1R1DA 1UOPA 3IEUA 2FSUA 1P7YA 3GVCA 4PTZA 3JR7A 2VUUA 4AZ0B 1D4ZA 1PJ3A 3ORHA 3LSSA 3CS3A 2UZ1A 4XGRA 1CQJA 1DC6A 1ECBA 2AOUB 1LV8A 1HE4A 4JEIA 4X66B 5JHGB 1I4OA 4CZ2A 4GX2A 1MR3F 3CLUC 3UGKA 1YGBA 1Z0FA 2IPOA 2QSZA 4G5XA 4GW3A 1U3WA 4HFRA 4PO8A 1Z6XA 2BGRA 1EKXA 1T9GR 9LDTA 2NZXA 3K0AB 1AMNA 3GEMA 3D02A 2NO0A 2P0EA 1H2RS 4CEHB 1P7VA 5JZMA 1GILA 1TJYA 3TWOA 1EAMA 1DG3A 1AKVA 1F1BA 1Q95A 1Q84A 3GT7A 4URVR 1FDUA 4BBAA 3GA0A 4K1LA 5HFNA 2CHUA 1WB4A 1P9WA 3M4QA 1DIAA 3TMKA 4KMMA 3BTUA 1YZ3A 4J1TC 3EEQA 5KVVA 4YUZA 5JALA 4A7PA 3N2IA 4NAVA 1AMOA 2YYAA 2YVQA 2P6NA 7REQB 1XNJA 3N6VA 2X9NA 1HSOA 3D0RA 1X55A 4QBGB 1G3UA 4FQ5A 3IR7A 1ODLA 4U02A 1KORA 3QU2A 4IY1A 4ZOEA 3WICA 5DN6D 2BFFB 3NHSA 1ZM7A 3QOXA 1L4UA 2DXTA 4HH1A 4U5XA 3ROTA 4ALNA 3ZHUA 3CJQA 4KGVA 4BLRA 3DEKA 3CNHA 1BJRE 3R3WA 4QHTA 3RS0A 1VSUA 5EP3A 4DY6A 4N39A 4Y1RB 4KDCA 1DOHA 4KVZA 1QR2A 4BBZA 1KMIY 3KKKA 4YJDA 3FLMA 3OLCX 4C6TA 4DHEA 1PNOA 3INGA 3VAZA 2MOKA 4WA7A 1D7OA 1HOTA 4I08A 1SCUA 2RHOA 3QEKA 4PG6A 4I0WB 3U9SA 1W36B 2Y4NA 3GO4A 3V55A 1D9XA 1H5NA 4Z1OA 2G5TA 4V0QA 3HYTA 1DZIA 2X0NA 3ANLA 4IQGA 3A1NA 3QJYA 4E7OA 4WACA 5JH7A 2OCXA 4I1RA 1HYQA 2FEPA 3CF4A 3B5IA 1YB4A 4CIDA 4DW8A 2FZ5A 3M5DA 1Q0TA 2ZUVA 4JBWA 2XYGA 3G0IA 1SHJA 2IZ5A 3RRFA 5EI5A 1M10A 3I5UA 1GPWB 3H9EO 4AJLA 4KQHA 2BEKA 5BR7A 1C8KA 2AMVA 3JU3A 4IUDS 1R0BA 3WIUA 2YY5A 3K1AA 4CMEC 3AUKA 3B2QA 1JLLB 2OVFA 2ZSEA 5BQ5A 1WVGA 3COPA 3GLSA 2RHMA 4HAVA 4IGEA 1F4LA 3SFTA 1ZOOA 1N5MA 4RDCA 5HPYB 3OQOA 3JAKB 2VCYA 3UBTA 4LWQA 1RHRA 3K2IA 3A9VA 1AKWA 4BX3A 5JXJA 1JX6A 1LNSA 1RP1A 3FBGA 3MMPA 2DH6A 3E8SA 3Q3CA 3RC9A 3B8EA 3D6MA 1QO9A 4AYWA 4JVSB 4RVNA 4B7CA 5KQRA 1L7AA 2V4ZA 4G1BA 2PUHA 1GCIA 4NABA 2JG3A 2CBZA 2DTXA 1T4CA 3CVJA 5DVZA 3GF4A 1B74A 3O7MA 2QXTA 3RK4A 1J22A 4X20B 2BHLA 4ARIA 2WF7A 2OT3B 4KC0A 5DK4A 1T3LA 3AY6A 3LBIA 3NATA 4I9GA 3STHA 2Z56A 4QYSA 2WT4A 3HXUA 3ASVA 2GGSA 4YRKA 1QUFA 4LGMA 1W49A 2PANA 5E1BA 3S2YA 1JG7A 3TGLA 1ESNA 1NG9A 1E5TA 2ZQZA 3GRZA 3QFFA 1D6NA 4WRRA 1AHNA 5E4FA 4JI4B 3KSZO 3TEMA 2KPOA 1SXHA 2ZJOA 5ADHA 5ALXA 1G4UR 4I7EA 5GVRA 2QMQA 2LKCA 1NPDA 4OLFA 2AL7A 3UM9A 4Q39A 1VG1A 1N2XA 1CB0A 4X54A 4ZCIA 3N5CA 1I3CA 3WGOA 4GECA 1W5SA 1ELOA 2X3FA 3PXGA 1J0BA 2G9UA 2QN2A 2B92A 2BTQA 3UCFA 5CD1A 1A8QA 3I2IA 1IZ0A 1OOEA 1SBQA 4H1UA 1RM4A 5JXIA 4OBXA 3AP2A 1GUFA 1V5GA 1KBQA 1V9CA 4LZOA 2YWJA 4JVOA 1JYFA 1Q50A 2FK4A 3CLUD 5GAJA 3UV6A 2OWEA 1F48A 2D7CA 1L8OA 2VZEA 3THRA 1KOLA 4WFIA 2RHJA 2XRYA 3GVHA 4GSYA 4TVAA 3GRKA 2Y3IA 1N6NA 4MYTA 4QUGA 3PRYA 3JQCA 1RLUA 2EJ9A 4NBWA 3HN6A 1XQWA 4MV6A 4MPJA 4N1AA 4OP3A 2YVLA 4IDCA 5JCJA 5A2QA 4NCBA 2J5QA 3PX2A 4B4DA 5AK6A 5KKAA 1PV1A 2PL1A 4WNAB 3QKWA 3ZTTA 5BW4A 4ETNA 3HL0A 5K0NA 3QNEA 3J81A 4WY5A 4YASA 1JSRA 2HT6A 2P2DA 5KKNB 2IITA 5KNBD 1L5MA 4I5FA 2Y76A 1LRLA 3RUDA 2CUNA 3UAGA 2YASA 2VCEA 3ICEA 3LLMA 4Y2VA 2AK3A 4EHBA 5JD4A 3G5LA 2O14A 3AERA 2QIOA 4EG4A 3LVFO 3QSGA 3CFYA 1J70A 3GQBB 2JJQA 1RKUA 4U6SA 4CQMB 1WW3A 1KNQA 2ZRKA 3GNSA 4DRYA 2IWHA 1E6LA 3CUVA 2Z1MA 5FKJA 3I4LA 3HB9A 1Y7LA 1U0RA 2YV4A 4UTXA 3SLKA 2YV2A 3K15A 4AVYA 3A9CA 4YDRA 4U63A 5DM1A 3WLOA 3AVXA 1U2QA 1SWWA 4PFJA 5KYXA 3AVYA 2R66A 3TSZA 4NU0A 5CPBA 1MNAA 1GVHA 3AL2A 1IJEA 1BOFA 1JMKC 1A8HA 2O0HA 4MLPA 2PBFA 3GXOA 4OGFA 2GTPA 3N2YA 4Q00A 1KAGA 3NPMA 2Y6UA 3UWSA 3BXOA 5ALUA 1L6IA 1SBYA 1FRZA 1DS6A 2X2FA 3AEKA 4INJA 4UVHA 4W1RA 4GGMX 5CU7A 5DGHA 8ATCA 3OD1A 4M99A 1V1MA 1NV9A 4WOPA 2RHBA 4EBBA 2VPZA 1I30A 3MTIA 4AMYA 4QUKA 5AUQA 2H4YA 4CCYB 3A1VA 1B43A 3IRUA 2W71A 2E4VA 1VTKA 2O2SA 2Z3ZA 4FNOA 1XPJA 4L4XA 2J7KA 1ND5A 3ZBPA 5SZIA 3HYLA 1OAOA 4FE7A 1KWGA 1C9NA 1JVNA 2PX0A 3K9GA 3OM9A 3LUGA 4DKXA 3BICA 3WR5A 4UNPA 3LGXA 4HH3C 4IMJB 1SUAA 4QBIA 5L6LB 2ZGVA 1AQUA 4GE0A 4QWMA 4JBIA 4BCBA 2EHDA 4TXNA 4F4CA 3NM4A 3AR9A 4BMZA 4Z5XA 2Q3HA 1E9RA 3CH5A 3ILYA 5ITSA 4Z9XA 1F2UB 1FRFS 4ZYYA 4XTWA 2GTIA 2HJWA 4NOLA 4OL9A 3ETJA 3R6GA 4IHKA 1PR1A 2JGFA 4MMZB 3K6JA 4RGYA 5EHIA 5FO1A 4INZA 4ITUA 2AVDA 2FH5B 3FOZA 4ZCRA 3GFOA 2YH2A 4CM5A 2WM3A 4OUDA 1DG1G 3B6EA 3F6YA 1G16A 3DEFA 1NUAA 1KAHA 3NV7A 2NO1A 3FWKA 3HEAA 4F9TA 3HXLA 3LO5A 5FFNA 1BMTA 2YMQA 2ZPTX 4TVKA 4UMFA 3B6IA 3RT9A 1RLMA 3GLVA 1P39A 1J56A 1C0EA 1W1IA 1B6SA 1K8QA 1EH5A 1UFRA 2NADA 3I01M 5AI6A 3UMCA 3UOGA 4MH0R 3PI7A 4PM4A 3K6RA 1WVMA 8ADHA 1L9XA 4NOMA 4HI0E 4N65A 4EG1A 5FBKA 1DG9A 4EP1A 4NBLA 4L02A 2OM2A 1V2HE 1GUZA 5DYIA 2HYDA 4OXNA 1PFYA 1M0TA 1ZXLA 1AVTA 1YE8A 5DBOA 2D5IA 2ZGWA 1T6XA 4BFZA 3OECA 3BEDA 3CF4G 4WKOA 3FKSD 1N33B 1PUIA 3M4JA 1NVAA 3EPLA 1XHLA 4NCKA 2W42A 3T94A 1JA9A 2FKNA 3QTTA 3ZHBA 2OZPA 3P9IA 2RD2A 3RC8A 1HMYA 1PJQA 1I2AA 1E94E 5HCUA 4Y1GA 4WK0B 2K6GA 3HK2A 2Q1TA 3C16C 4CLXA 1Z39A 2XUJA 1JPJA 3QE9Y 5CDFE 5C5CA 1KY2A 4NMWA 5IXJA 1L7NA 3HWWA 3I76A 4BC1A 5CT9A 4JD5A 3A1EA 4KQ9A 4MS3A 4Q21A 3TQIA 1U7UA 5LBIA 2O0KA 3LYHA 4YT2A 3RFCA 3B82A 1B00A 1ZVMA 4S2EA 1WVIA 1WTAA 3IP6A 4XPIA 4CMGA 1PQUA 3HO6A 4YLEA 3WBJA 5CLQA 3F98A 2APJA 1Z7EA 1RBMA 5DWDA 5T57A 4ZT5A 4YK7A 4XM1A 2ZSFA 3B2NA 5I9BA 1GA6A 4DL9A 5SZKB 1TZCA 4FW9A 1DTWA 1Z2AA 3FNFA 3HKBA 1SO8A 2ZIEA 1H6BA 3GRRA 4B2YA 1R4MB 1NBAA 5BRAA 1ICIA 3S1SA 4A1OA 3VOSA 3ZDAA 2UAGA 5JO9A 1PKXA 1TFRA 1T5TA 2P6OA 2FHPA 2O5RA 2W98A 2G70A 5CX1B 2FN8A 4GC9A 1LI5A 2GK3A 3LSQA 1HYBA 1XWIA 3BGSA 2C4UA 3K5PA 1Q22A 1TK9A 2B5VA 2GT1A 3Q41A 4M4SA 5AK3A 4K9KA 5KYTA 4GKBA 2KYRA 3EY9A 1Q19A 4ASUD 4RXTA 3P2EA 5HX7A 4K86A 4OQDA 2ATXA 1COPD 4K5QA 1Y8QB 4U9HS 1J5PA 3REQB 1EWTA 1IXSB 2ERYA 1PEAA 3OY7A 4G07A 3BGVA 4OYHA 4ZHQA 4KV9A 2IXGA 2VSXA 3HXYA 2LCIA 3UMRA 2HSWA 5DLPA 1RNLA 3QUTA 1IJKA 2DZCA 1TEHA 4KQEA 4BGIA 2ZRQA 1O94C 2FEOA 1Z35A 1Q7EA 2CJBA 2XNDD 1SUEA 2P9ZA 3CF6R 4ZP1A 3IAEA 1QYCA 1EVJA 2AXPA 1D2RA 1UZAA 2I8CA 3H9JA 1JB1A 2X9LA 1WD7A 3KV1A 5J2UF 1ADJA 2F55A 4KPYA 1Z13A 1NMSA 2OB2A 4PBRA 3LY7A 4D9NA 4LS3A 4Q4AB 5CGQB 3UJNA 4MYHA 4F1WA 5C5EA 4FC7A 3BXFA 3G85A 2FEXA 4FI3C 4QBHA 3B1WA 2F9MA 3VNRA 3IIEA 4BATA 5KNCD 2BGGA 4DA9A 1P4RA 3N6RA 4KOEC 2Y1LA 5BOSB 4TTPA 3L0YA 3RUPA 1PHPA 3SPXA 5SV2A 1N6HA 3R1IA 3WO1A 2V97A 4LECA 1R74A 2YN4A 5FLEX 3GNQA 1U3TA 1FP4A 2EFGA 3KEMA 3PEYA 3W3AH 1RAAA 1VDZA 3EX7C 2HWUA 4TXLA 4Y30A 2YTZA 2H1RA 5IXYA 2OK8A 2PH1A 3K6KA 2YBEA 2BFOA 1FP2A 3PQFA 2R65A 3UJ3X 2PRYA 4AJPA 1CULC 1I2MA 3WL6A 1SKYE 4EATA 1Q17A 1A0OA 2AOTA 4RDXA 3ZU6A 2OBLA 2D1TA 1DBRA 3G5AA 1X77A 5ALLA 5AW2A 1PYOA 3N74A 4P7FA 2ACVA 3AHGA 3X1ZA 3NS7A 1OX4A 1N57A 4MGYR 3GAZA 2EF1A 2Q21A 2WIDA 3VUEA 5EJEA 1PEYA 1EE1A 1USIA 2Q5CA 4ZOBA 4UHJA 1B15A 3DEAA 2LE0A 4EMTA 4EVIA 1CK4A 3DLHA 5KYWB 3E0XA 2UKDA 3GLHB 2PKEA 4EB0A 3V2IA 4DMFA 1WUYA 3INRA 3QU7A 4YJ2A 4IYRA 3AFGA 4S1OA 1Q3TA 1J2TA 1SFRA 2NXEA 3BF8A 1V5FA 1JFLA 4ZAZA 1QH0A 3ANNA 5LQMA 2EFHB 2XUOA 2EWVA 1X80B 4AZSA 4NDZA 1DV1A 2Q4TA 1AKQA 3C3WA 3W8FA 3NCHA 3OQ1A 2GCIA 4PFKA 5IC6A 3I05A 1RW4A 1P0QA 2HIHA 1C4XA 2II6A 2XDQB 3OIVA 4FGWA 4PGHA 3I37X 3TS1A 3USCS 4A9AA 1FRVA 4BNTA 1W7AA 1K92A 1YVUA 1ZONA 2PXCA 1KVSA 1V11B 4G0NA 1O6FA 3F71A 3TIGA 4I99A 3S70A 3BB1A 2I3DA 3JYLA 1M1XB 3GZJA 3Q5EA 1C7FA 4H2UA 2IDJA 3CW9A 4KN9S 4XARA 3L4BC 2HD4A 3T7RA 3UF0A 2NP7A 2B2CA 3V2GA 5JT1A 3WK4A 1QZUA 1I3LA 4QHYA 1V16A 1YJ5A 3ESCA 4F56A 5BNIA 2R97A 1U2PA 1UMDB 3HA2A 4QGGA 5EYPA 3ICOA 2B7LA 1ANKA 2FP4A 1VKJA 3O47A 1CR0A 3OOWA 4QU0A 3BK1A 1USVA 1GTJ1 1OPRA 2FQWA 4WJ3M 1NWCA 2RG1A 2XUKA 3A6EA 4MULA 4XYMA 5KOIA 5KSOA 1RRVA 3Q6NA 5AMXA 4WZBB 5JNVA 1KDOA 3Q87B 3WIEA 2AC7A 5JZ9A 2UYCA 1XTUA 3HFZB 1MG0A 2NM0A 3QVUA 3RS3A 2BEWB 3K9QO 1WQ4A 4TYPA 4Z8YA 5EMMA 1XHEA 3GBPA 3RREA 3RBAA 3IP3A 4M88A 4X8LA 2Z3VA 1CCWA 5F1PA 1O6CA 1TF5A 1H93A 2GEVA 1EFTA 1DKUA 5J4KA 4FUTA 2CWDA 3O8CA 1DQZA 2I1WA 1L4GA 3PKJA 4KVAA 2IBSA 1SA0B 4YNBA 4YMVA 4WGFA 1QIHA 4Z4CA 3HR7A 5H3LA 3NKVA 1OGIA 1XZMA 4LVKA 3LZ6A 5DLEA 5LZ9A 2I7CA 3U7IA 2P8JA 4QODA 4Q82A 4UPAA 3IBFA 1ECCA 2WWGA 3C7CB 4QG3A 2VJYA 2PX6A 2RHDA 4F3NA 1D07A 1TRKA 2WHXA 1O94D 521PA 3RTEA 2PH5A 2AUNA 3C39A 3EFEA 3L7LA 4C4YA 3BE4A 3QPWA 4MWCA 4I8DA 2VP6A 4RD4A 1T26A 1H4TA 2X5OA 3F6CA 1QZXA 2PLAA 2GM5A 2P1DA 1EFCA 3ID6C 2PUAA 1LPMA 4RENA 1RU3A 4XR8F 2YJ5A 1H8EA 3AVUA 2B61A