The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
137
|
structure length |
137
|
Chain Sequence |
PNIVIRKGELQYKVMKKNKIDINQLQSMLRQAGSFSIQEVEYAIMETNGMVSVLPKSDFDKPTNKDMQIPSKSVSLPITLIIDGEIVRDNLKEAGVDEQWLKQEMKKKNIDKTEDVLFAEWHKNKPLYTVTYEQSRS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
YetF protein
|
publication title |
Crystal structure of protein Bsu07140 from Bacillus subtilis.
rcsb |
source organism |
Bacillus subtilis
|
total genus |
29
|
structure length |
137
|
sequence length |
137
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2008-02-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04239 | DUF421 | Protein of unknown function (DUF421) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | CRO Repressor | bsu07140 like domains | ||
Alpha Beta | 2-Layer Sandwich | CRO Repressor | bsu07140 like domains |
#chains in the Genus database with same CATH superfamily 3C6F A; #chains in the Genus database with same CATH topology 2A63 A; 2CW1 A; 2M3L A; 1WU7 A; 4GIZ C; 6CRO A; 2OVG A; 3C6F A; 2LJX A; 2FK4 A; 4XR8 F; 2LJZ A; 1D1L A; 2LJY A; 5CRO A; 1COP D; 1D1M A; 1ORC A; 2ECS A; 2ORC A; 3ORC A; #chains in the Genus database with same CATH homology 3C6F A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...