The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Structure Analysis of the HPV16 E6 Oncoprotein Reveals a Self-Association Mechanism Required for E6-Mediated Degradation of p53.
pubmed doi rcsb |
| molecule tags |
Metal binding protein
|
| source organism |
Human papillomavirus
|
| molecule keywords |
Protein E6
|
| total genus |
15
|
| structure length |
70
|
| sequence length |
70
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2011-09-30 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | CRO Repressor | CRO Repressor |
#chains in the Genus database with same CATH superfamily 2FK4 A; 2LJY A; 2LJZ A; 2LJX A; 2M3L A; 4XR8 F; 4GIZ C; #chains in the Genus database with same CATH topology 2LJY A; 2CW1 A; 3ORC A; 2LJZ A; 2LJX A; 1ORC A; 6CRO A; 1D1M A; 1D1L A; 2M3L A; 2OVG A; 4GIZ C; 2A63 A; 2FK4 A; 1WU7 A; 3C6F A; 2ECS A; 1COP D; 5CRO A; 4XR8 F; 2ORC A; #chains in the Genus database with same CATH homology 2LJY A; 2CW1 A; 3ORC A; 2LJZ A; 2LJX A; 1ORC A; 6CRO A; 1D1M A; 1D1L A; 2M3L A; 2OVG A; 4GIZ C; 2A63 A; 2FK4 A; 1WU7 A; 2ECS A; 1COP D; 5CRO A; 4XR8 F; 2ORC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
