The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
QRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the cysteine-rich domain of scavenger receptor MARCO reveals the presence of a basic and an acidic cluster that both contribute to ligand recognition.
pubmed doi rcsb |
| molecule tags |
Ligand binding protein
|
| source organism |
Mus musculus
|
| molecule keywords |
Macrophage receptor MARCO
|
| total genus |
27
|
| structure length |
98
|
| sequence length |
98
|
| ec nomenclature | |
| pdb deposition date | 2007-02-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00530 | SRCR | Scavenger receptor cysteine-rich domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Mac-2 Binding Protein | SRCR-like domain |
#chains in the Genus database with same CATH superfamily 1Z8G A; 1BY2 A; 5CE1 A; 5JFB A; 2XRC A; 1O5E L; 2JP0 A; 2OTT X; 2OY3 A; 1O5F L; 2JA4 A; 2JOP A; 2OYA A; 3T2N A; 1P57 A; #chains in the Genus database with same CATH topology 1Z8G A; 1BY2 A; 5CE1 A; 5JFB A; 2XRC A; 1O5E L; 2JP0 A; 2OTT X; 2OY3 A; 1O5F L; 2JA4 A; 2JOP A; 2OYA A; 3T2N A; 1P57 A; #chains in the Genus database with same CATH homology 1Z8G A; 1BY2 A; 5CE1 A; 5JFB A; 2XRC A; 1O5E L; 2JP0 A; 2OTT X; 2OY3 A; 1O5F L; 2JA4 A; 2JOP A; 2OYA A; 3T2N A; 1P57 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
