3T2NA

Human hepsin protease in complex with the fab fragment of an inhibitory antibody
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
339
Chain Sequence
QEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPGDSGGPFVCEDSISRTPRWRLCGIVSLAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease hepsin
publication title Allosteric antibody inhibition of human hepsin protease.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 339
sequence length 370
chains with identical sequence B
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t2nA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3t2nA03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 3t2nA01
4OS7A 3U9AH 3F68H 2ANWA 1G3CA 1IQJA 2UUKB 1DLEA 4I8HA 1DX5M 1MU6B 1Z1IA 3ZYEA 1HAYB 2ZIQH 2C93B 4NIXA 3C27B 2O8TA 1TNKA 2BD5A 5AVDA 4F4OC 1AD8H 1GVKB 4KTUA 4JMYA 1MKWH 4AFUA 1O2MA 2FS8A 1O5FL 4ZROA 1GMCF 2VJ1A 2AFQB 2HGTH 1TRNA 2QAAA 4O3TA 1KXBA 1O3IA 2ZGBH 2ZO3H 3QUMP 3O8CA 1SVPA 1TIOA 1D6RA 3BTFE 2FLBH 2FIRH 4IW4E 2BLQA 1F92A 2AERH 3RC5A 3F9FA 1O2PA 2AH4X 3PO1B 1O3LA 1QL7A 1HJAB 1XVMA 5FX5A 1QRWA 1K1IA 4K1SA 4MPXA 2PUQH 2WV4A 1GDNA 5K7RA 1P2KA 1VITH 1S82A 1M9UA 1OWIA 5ESBA 4DURA 5EW2H 1SI5H 1OWEA 1BRCE 5GDSH 2GDEH 2EI8A 2QXHA 2VIVA 4KTCA 5G4BA 5FPTA 4WWYA 1C5RA 1TX8A 1GL0E 1RTLA 1O2XA 1ZHMA 3V12A 1FY5A 1GHVH 1IQFA 2VINA 1GI0A 3UWIA 1AFQB 3GCTF 1FY1A 1SQOA 4CH2B 1YCPM 4CR9A 3Q77A 4IBLH 3AVZA 3BEFB 1GJ5H 2J34A 2GVFA 4H4FA 3RXCA 1YPJH 3QO6A 4B74A 4X8TH 1SOZA 1HAVA 2P3FH 1SSXA 3ATLA 1TABE 4OGYA 4JZDH 1T32A 2TGTA 3ZZ6A 3MNBA 4B73A 2BD9A 2FI3E 4XDEA 1ZPCA 2ZECA 1TOMH 4B1TA 4NWKA 2BZ6H 2UUJB 1O30A 2ZWLH 4B71A 1P57A 1P2QA 4IC5A 5I46H 1GI6A 1YPMH 3MH6A 5BPEA 3SGQE 2FP7B 1CA8B 2WPHS 4K2YA 1QGFA 1QA7A 2Z3EA 1BJVA 1BJUA 3MNXA 3QN7A 4OS6A 4X1NU 1HAIH 1G30B 1GI3A 2BVRH 4TWYA 2NU4E 4VGCC 4YOGA 3MO3A 3DFJA 1FDPA 2GTBA 4UE7H 3LOXA 2G52A 3BF6H 4O3UA 2R9PA 1EB2A 1YPEH 1YLCA 2GZ8A 3H5CB 1E36B 2QXGA 1A1RA 3U98H 1O3FA 2FTMA 3LGIA 1CQQA 3T62A 4X1PU 1BHXB 1YCPK 2QF0A 3VXFH 4MQAA 1VCPA 1ABIH 1ELVA 1GDUA 1P0SH 1P3EA 2D2DA 1C1VH 1GBDA 2WPKS 1XUFA 1Q31A 1ZGIA 1IQMA 1S6FA 1TBQH 2PSYA 1GBLA 1O35A 3ODDA 1UK3A 1V2MT 3MNCA 4WMDA 3IITA 1TOCB 1TGSZ 2BDHA 2FOMB 3TVJB 3PTBA 2F9OA 2CXVA 4ABFA 5A8ZA 3HPTB 1GI9B 1W11U 1HAVB 4AYVB 2TBSA 1G36A 4NFFA 1SGTA 3RC4A 2FEQH 1UMAH 3TK5A 1CGIE 3QZRA 2WYJA 2AS9A 2YOLA 4E06H 3FFGA 3ATKA 1P57B 3TGJE 1TA2A 3ZZBA 4JK5A 4TY6A 2R3UA 1W13U 2VIWA 2DE8A 1TX7A 3LGWA 2FODA 2XXLA 4ISLA 3JZ2B 1C5OH 4BTTB 5JYIA 3UWJH 4ZXYH 5CHAB 3RXSA 1HUTH 3SQHE 1K1LA 4AORA 3SUFA 2BD8A 2OBQA 2Y81A 1LHEH 2GKVE 2XC0A 4FU7A 5HMAA 1BIOA 1T4UH 1BMMH 1NRRH 4I8GA 1C1TA 4A1VA 3RXRA 1PPHE 2CF9H 1ZMNA 2H5CA 1EAIA 2JETC 6GCHG 1QB9A 4NA7A 1BZXE 3NWUA 1EJNA 1YBWA 5C5NA 5T6DA 4MG3A 3A87A 3UNSA 1U6QA 4YT7H 1BTHH 1P01A 3KQEA 2V6NA 1TAWA 5JBCS 1E34B 4CRCA 1P9UA 1RS0A 1DUAA 3VXEH 2GV7A 1PQAA 2ZGXH 2W7SA 1A0HB 2Z3CA 3UFAA 1WTGH 1ANCA 1RIWB 1MZAA 1J16A 1NS3A 1GVZA 2HRVA 3GY7A 1TGBA 2F9BH 3F1SB 1GJ7B 1K1JA 1W7GH 2QY0B 4CRDA 5LPFA 1O2GH 1XX9A 1MBQA 4YLUA 3MU8A 3W94A 2WPJS 1Q2WA 3ODFA 3GCHC 1NRSH 4O03A 3RLYH 1C9PA 1PYTC 3PLKA 4GPGA 1PPCE 4YZUA 4UONA 1JMOH 4A6LA 2CMYA 2FX4A 2VH0A 3MMGA 3E1XB 1HRTH 3PMJA 5GCHF 2BY5X 3D23A 1OOKB 1C2MA 1EOJA 3MWIU 1VJAU 2VVVA 2ZGJA 5ESTE 1KYNA 2BXUH 1ELGA 4Y0ZE 1BMLA 1A3EH 1JIMA 3C1KA 2A5KA 2A5AA 4MNYA 1GBAA 2A45B 1VR1H 1C2JA 3M35A 1C5YB 4K1EA 5EXLA 2BDYA 3K2UA 3Q3XA 1WOFA 3ZVGA 3MU5A 1NFUA 1H8IH 3ESTA 3U8TH 4JZFH 5BRRE 1GHBG 4WVPE 3B8JA 5C1UA 5C2ZA 3AAVA 1Z1JA 3BTQE 2QGRA 1BBRE 2Z94A 4ABIA 1TNLA 3ZYDA 5IDKA 4OS5A 1HAPH 2AMPA 2Y7XA 1TNHA 3V3MA 1RXPA 3UPEA 4K60A 3EA7A 2O8MA 3MHWU 1GHWH 1E38B 1KSNA 5A0BA 2BVXH 1C2FA 3P8GA 4X1RU 2VB0A 3RUOA 1SC8U 4BTUB 1TMUH 4FXGH 2B8OH 3UTUH 2SNVA 2ZF0H 4AGJA 2UWOA 3M37A 4UFEH 1CT2E 3RXJA 1GHXH 1LVMA 2SFAA 1TNJA 2SGPE 4YM9A 1TGNA 1YKTA 2SGDE 2OTVA 2IN2A 1NU9A 1VJ9U 1UTLM 1O2KA 1ZR0A 2VVCA 1LMWB 3SI4H 1TPSA 1K1OA 2BM2A 2ZA5A 3O8BA 2ZFTA 3U8RH 4ZHLU 1FZZA 1ZLRA 4K3JA 4FUHA 1QHRB 3HK6B 4AX9H 1THRH 2FM2A 1TMBH 2G00A 4WXVA 3UUZA 3A7ZA 3TGKE 3FP8E 1V2VT 3F9GA 1MQ5A 3O8RA 4JZ1A 1G32B 1QURH 1W2KH 5PTPA 1AQ7A 3L6PA 4FU8A 2A31A 3SV7A 1A5HA 1P11E 2ZEBA 4NSYA 3T5FH 3VGCC 5HM2A 3ZVFA 1JIRA 3PROA 5K0HA 1MD8A 1D3QB 1C1MA 2C8YB 5FX6A 5DKMA 1FY4A 2F9PA 6CHAB 1CE5A 1SR5C 1MZDA 2XBVA 1EATA 1GMDF 3GCNA 3CENA 1Y3XA 1O2ZA 3MFJA 2YNBA 1PPEE 2STAE 1C1UH 4X1SU 1SQTA 4GCHG 1GI4A 3STIA 2C4FH 1YM0A 2Z7FE 1UCYH 3UNQA 2ZTYA 4OS1A 5FPYA 2W7UA 4FUEA 3UR9A 3PTNA 4A5TS 1BOQA 1KLJH 2I6QA 1HAXB 2GT7A 2K1QA 2CN0H 3PMBB 1LHGH 3MOCA 2FESH 1GGDC 1ZTKA 1GGDB 2BZAA 1K1PA 1CHOG 5T3HA 3M3TA 1D9IA 4U2WA 3E6PH 4A7IB 1IQLA 1KIGH 2ULLA 3L33A 1OWHA 2F9UA 1B0FA 1CA0B 1LO6A 3CP7A 3E8LA 1Y3VA 1YPGH 3I77A 1HAHH 5A8YA 1WTHD 3QTVH 3QLPH 1L2EA 2PKSB 1TE0A 3H7OA 3D49H 5EOKA 5DJ7A 3MU1A 2G4TA 1CHGA 3M36A 4NIYA 2XC4A 1NTPA 2XBXA 2BOKA 3N7OA 1TYNA 1H9LB 4U30A 5E2PA 5LH8A 2F9VA 4FVDA 1AE5A 1NFWA 1WSSH 3GDUA 2KAIA 3MH4A 1YGCH 5EG4A 1OP2A 2TGPZ 4X2VA 1DWEH 1UTOA 1TWXB 1ZYOA 1SMFE 1ARCA 1ZRKA 1F5RA 3AASA 2ZFFH 1LVOA 5FBEA 3KGPA 1N8OB 4NZQA 1ZSLA 2BD2A 1HB0B 1O31A 4CRAA 1IAUA 1EAWA 3CS0A 1SGYE 2SGFE 1DXPA 1EP5A 1GMCG 2D1JA 2OC8A 4CBOA 1V2OT 3ATMA 1BITA 5EU8A 1V6DA 1DFPA 1BA8B 3SHAH 2R2WU 1OSSA 2PTNA 1SLWB 5HXFA 1KLTA 2BQ7B 5C1XA 1EJMA 4ZKNU 1C5PA 1GG6B 2ZFQH 2VIDA 1C2EA 1KXCA 4INLA 1C1SA 1A61H 2XNIA 4NCYA 1DY9A 3S9BA 2BY8X 1PJPA 1Y59T 1QBNA 4BAOB 1OX1A 2W26A 2ZFSA 4AB9A 1PQ8A 3ZV8A 2ZI2H 3GCTG 3A8CA 4ISNA 4NWLA 3BG4B 1UHBA 3Q3YA 4CHAC 2OLGA 4CHAB 1WYKA 1FPHH 2GCTC 2RA0A 3P6ZB 2ZHEH 1XUKA 3SNBA 2XCNA 5GIBA 2FTLE 7GCHF 3A82A 1GJCB 1BUIA 1Z8RA 2VWLA 3VB3A 4NIVA 4D8NA 1GBJA 1O0DH 3ZVCA 2OC7A 4AOQA 2GZ7A 1AB9C 4AN7A 1AB9B 3BTME 1AO5A 1GJBB 2BDAA 3HATH 4JYVH 3MH5A 1FY3A 2A4RA 3MO9A 4K69A 3BEIB 4BNRA 1BY2A 2VIOA 1MTNC 2QCYA 1DUEA 4FUJA 1LTOA 3QGJA 2ZDAH 5CE1A 1O2WA 3RXMA 8ESTE 3MI4A 1BBRH 2FX6A 3S9CA 1DDJA 2FWWA 1EUFA 1S0RA 1VCWA 4A92A 3T2NA 2XW9A 4Y8YA 1QNJA 1QQUA 2Q6DA 3V7TA 3SORA 5DK1A 5EXNA 1OP8A 1ETRH 4I8KA 2V3OH 4SGAE 4JZIA 4H6SB 1BRUP 1V2ST 1DOJA 1SGEE 3BN9A 1SB1H 3IG6B 2HNTF 1UVPA 1FNIA 3AW0A 1HAGE 4THNH 4NSVA 1P8VC 2A7CA 3I78A 1H1BA 1FY8E 3SGBE 1UHBB 5IYTA 2FLRH 1F7ZA 1P03A 4X8VH 1O3OA 3A85A 1G37A 1XM1A 9ESTA 1AUJA 4NG9H 2ZDNA 2O8WA 4X6PA 4I8LA 4WJG2 3M7QA 3P95A 3EA8A 5C20A 2XTTB 4ZAEA 3RXPA 4IN2A 4MLFB 4ZKRU 1AWFH 3MYWA 1S81A 2YNAA 1NN6A 2P59A 4K8BA 5A0CA 1C9TA 1DS2E 1EZQA 1AZZA 2Q6GA 2ANMH 1MMJN 1O5GH 2G81E 1SGFA 3PWBA 1O2RA 3BTKE 3SNCA 2Z3DA 3M5NA 5L2ZH 1B5GH 4KELA 2GMTC 4RSPA 2G8TA 3LC5A 4FU9A 1UTJA 4DG4A 1GHAF 2C8WB 4X1QU 2V3HH 3SN8A 3RXUA 3EQ0H 2A2QH 3T29A 2OC0A 1SGCA 3PMAB 2PR3A 3RXKA 2EI7A 1OS8A 3SQEE 1SBWA 2HPPH 3U69H 1MCVA 1P06A 1O3AA 2CV3A 1EB1H 1C5WB 4J2YB 4DT7B 1GJ8B 1FJSA 2OUAA 1CSOE 1GBBA 1QTFA 1BQYA 1NFYA 5AHGH 2WPMS 5HYOA 5LPRA 5C67A 2W5EA 1BTUA 3PLBA 4TWWA 1SPJA 4HZHA 1DPOA 4ZHMU 5C1YA 1OWJA 1PPZA 2H2ZA 2NU1E 4Q7ZA 4VGCB 1C2HA 8GCHG 2GCHF 2VVUA 2H9TH 1YLDA 3BTGE 1NPMA 2HNTC 1BMNH 1CT4E 1O3HA 4MPUA 4LZ4B 3E0PB 3TIUA 5FBIA 2P3TB 4BXSA 3GISB 4D76A 2ANYA 3HK3B 1A5IA 2Q6FA 4NFEA 3A80A 1ESTA 4X2YA 2ZHDA 1UCYE 4XBBA 1ID5H 2G5NA 2P8OC 4Y76A 2FYQA 5C3NA 5JDUB 4FUGA 4Y10E 2O8LA 4CRFA 4BAQB 5I25A 3GY3A 1IQIA 3VB6A 1TBZH 2UWLA 3LGYA 1C4U2 3SHCH 1E0FD 4SGBE 2AMDA 1NU7B 4E7NA 1FMGA 3I29A 1C5UA 1C5ZB 3LC3A 1T4VH 1XVOA 1TX6A 2UUYA 1BT7A 4ABAA 1KXDA 3H7TA 1JBUH 1AIXH 3LGUA 1KXFA 2A1DB 3ZZ8A 2Y6TA 1T8MA 4ZXXH 1NY22 1TPOA 4Y11E 4AGKA 2P95A 2ZTXA 1C1OA 2PHBA 5B6OA 1CBWC 1BCUH 4BTIB 1CBWB 1D4PB 1F0TA 1NT1A 2A32A 1Z6EA 3HKIB 4KKDA 3NUMA 2VH6A 4FUBA 1UTNA 1FAKH 2AMQA 1B0EA 1D3PB 4WMFA 1O3KA 1O5AB 3ZVBA 1VZQH 4YT6H 1CGJE 1Z8IB 3DA9B 2A7HA 2NWNA 1JRSA 1P04A 2ZGCA 1OYQA 3A83A 3GY8A 3RMLH 1LKAA 3EAJA 4U01A 1O38A 3M5OA 4Q2KA 5ABWA 1SOTA 2XWAA 4NZLA 1GHYH 3KQBA 3LGVA 1Y3UA 1W12U 1RD3B 1C5LH 1OYTH 2JETB 3UR6A 3M61U 5DP5A 3SJOA 2C8ZB 2FO9A 1HV7A 1L4DA 1NO9H 1O2JA 1O3DA 1O3JA 1DT2A 3QDZB 3RXVA 3AAUA 4X6OA 1QJ1B 1MTVA 2FMJA 2Z9IA 2ZNKH 3S9AA 1AVWA 3RU4E 3M5MA 2Z9LA 2HLCA 2H9EH 2V0BA 1K1NA 1TMTH 3HGNA 3NPSA 3VFEA 3UIRA 3KQCA 1MKXK 3ZZ9A 1GHZA 3PV4A 2BXTH 3RXOA 2HWLB 1V2UT 4ABBA 4K5ZA 4ZUHA 1ZGVA 1O5EH 3GDVA 4GUXA 1T8OA 3GYLB 1DWBH 1PQ5A 1EZSC 2TRMA 3ZZAA 4WF8A 4JYUH 1WQVH 3A86A 4YLQH 1G2MA 1AMHA 1K28D 2PGQB 1W0ZU 3GCHB 2BLWA 2ODPA 3FP6E 4I31A 3RU4D 2ZHFH 2BVSH 2BD3A 5L2YH 1PPGE 2BY7X 3TJVA 3KNXA 1V2TT 5E2OA 1S85A 3KF2A 4JYTA 1YPLH 1SGQE 3RXBA 4RKOB 2PKAA 3ZVAA 1K1MA 1EZXC 4AG1A 4XBCA 4D9RA 3PMHB 2FPZA 4E7RG 5SGAE 3GYMA 1O37A 4X6MA 3SJ9A 1XKBC 1O5FH 4UEHH 5GPIB 2ZU3A 1MAYA 1ACBE 1ARBA 4NA9H 1QCPA 4INKA 3MO6A 2OCVB 1EQ9A 5DP8A 1MTWA 1HFDA 1HGTH 3MH7A 3KQDA 1DANH 3A7VA 3FZZA 2NU0E 1IHTH 1DSUA 2ZPSA 1ZTJA 1INCA 1O3PB 2G4UA 4QT8C 3DT0H 1SGNE 3FZDA 2ZU4A 1L1GA 3EGKH 1XUJA 1KXAA 4HI3A 2WPLS 1DE7H 4YOIA 3BTDE 1C5SA 1XKAC 4X8UH 6ESTA 2ZU2A 3A7WA 3LU9B 3M7UA 2B7DH 3VPKA 3VB5A 3A7YA 1NROH 1GMHG 2W3IA 1P09A 1N1LA 1TBRH 1O2OA 1O2NA 1GBIA 2PSXA 1GBKA 3S69A 4DOQA 2F91A 2PGBB 2ZP0H 1J9CH 1RTKA 2ODYB 4PROA 1LVYA 2XBYA 5FHTA 1A2CH 5EQSA 3K9XB 2ZHQH 2ZU1A 4ISHH 2WV5A 1C1WH 2HVXA 2GD4B 3HGPA 1CVWH 1MUEB 4IS5A 1JWTA 1LQEA 2GZ9A 3A8AA 1ANBA 1AKSA 4TPYA 5EW1H 6GCHF 1J15A 4I33A 3F6UH 1CU1A 1MTSA 8KME2 4D7GA 1BBRK 4X6NA 2RCEA 1Z8GA 1HAZB 2PKAB 5TCCA 1WBGB 5LPEA 5DP4A 2FZZA 3SNAA 4J1YA 1ZSKA 1PPFE 1C4Y2 3SOSA 4IMQA 1UTMA 1LCYA 4K8YA 4IMZA 5EQQA 1VCQA 2ZG0H 3OY5U 5ETXA 5FCRA 1MKWK 3RMMH 3V0XA 1EPTC 3RDZA 2AIQA 3PWCA 2C8XB 1XXDA 4M7GA 2BOHB 2QN5T 2FOBA 4IC6A 4DGJA 3VGCB 1EAUA 5T6FA 1S6HA 3P8OA 3SV9A 1MAXA 4MNXA 1MBMA 1GPZA 1QFKH 2Y82A 2A7JA 2ZKSA 4AYYB 1J8AA 1TNGA 5JBTA 1C2LA 1O3NA 1UTPA 1LDTT 4JZEH 1UVTH 2ZC9H 1IQEA 3A8DA 3R3GB 2J2UA 3A7TA 3TK9A 3GICB 1F0RA 4OS4A 1DLKB 5A09A 4UDWH 4XSKU 1TNIA 5GJ4B 1K2I1 1BRAA 2JH6D 2GT8A 1WU1A 1HBTH 1FIZA 2JP0A 2J94A 4XFQA 1C2IA 1AVXA 3DUXH 5EQRA 3WY8A 1ZPBA 3F9EA 5E8EH 1ANEA 1BTYA 2ALPA 3URDA 1FQ3A 4ABEA 3T28A 4DW2U 5E0JA 2ZQ1A 1XMNB 1AKSB 1O2HA 3RM0H 2OTTX 1GHBF 1YYY1 3SW2B 1ESBA 3CS7A 2THFB 3SZNA 1IQNA 2ZPRA 1NZQH 1X7AC 3ATWA 4D7FA 2FOHA 1ABJH 1HCGA 5J4SA 1LQDB 1AUTC 1ETTH 1LHFH 3BIVH 1F5LA 1D3DB 1KXEA 2VGCC 4KGAA 4UFFH 1F5KU 3SNEA 3ITIA 2FOGA 4WXIA 1GCTC 4X0WU 2JH0D 3AW1A 3Q00A 4Y71A 3LGTA 1A0LA 1SL3A 2SGQE 3STJA 4GSOA 1TPAE 2J4IA 4DIIH 1KTTB 1SFIA 2CGAA 1BDAA 1LKBA 4YTAA 3QX5H 3ZZ7A 1EX3A 3E90B 4TPIZ 3SNDA 3LT3A 5DP7A 3ZV9A 2BTCE 1EKBB 1B7XB 4Y7AA 1Y5UT 1WV7H 2A0QB 2XYAA 3KIDU 5DO4H 1FPCH 2FYRA 1Z6JH 4WY3A 2GP9B 5HM9A 3KHVA 1SHYA 2P3UB 1OWDA 1O34A 2FXRA 2VNTA 2OQ5A 3PM3A 1TFXA 3EDXB 2W3KA 2JKHA 4ISIH 2OQUA 1GBCA 3K6ZA 1DICA 1G3BA 3OYPA 2LPRA 1O2VA 1NM6A 3VB7A 2AGEX 3S7KB 4GHQA 1SGFG 1QRXA 1RTFB 1N6XA 2EI6A 1IQHA 1GJ4H 3TPIZ 2C3SA 2CF8H 5DP6A 7KMEH 3PYHA 1A5GH 2Y5GA 2QXJA 3SGAE 3ZVEA 1VGCC 1ZMJA 1THSH 2ANKH 5GWZA 1CO7E 1TONA 5EGMA 1W14U 3P17H 2GCTB 2TIOA 4GCHF 1L1NA 1UK4A 2P16A 3U8OH 4F49A 1BTXA 2JA4A 1QL8A 2PLXA 3RXGA 3RXLA 1ZMLA 1UJ1A 2Q1JA 2ZCKP 3Q76A 1NC6A 4Y0YE 1IHSH 1SGDE 2BDIA 1P2JA 2VWOA 1Q3XA 1VITF 4ABJA 1GBHA 1ELCA 1S84A 4CREA 2VWMA 1MH0A 2BX4A 1CHOF 2ZDMA 1ZJDA 3A81A 2Y5FA 1GI5A 2J92A 3PLPA 1O2LA 4I8JA 1EJAA 1UTKA 4HGCA 2BLVA 3TH3H 4GLYA 3UOUA 2XBWA 1MTNB 1ELEE 5FAHA 3F9HA 1BTZA 1QJ6B 1P02A 5EODA 3VEQB 4B76A 1C2DA 3SUEA 1AHTH 1OP0A 2QF3A 5CMXH 1O2TA 1HNEE 1K21H 1GBTA 2I6SA 5F03A 1P2MA 2GCHG 1FLEE 2VIQA 1PFXC 2TGAA 4B2AA 1D6WA 3TH4H 4Q7XA 1HLTH 3BTWE 4A1TA 3TJUA 2BDGA 2A5IA 5JBBS 1QBVH 2ZFPH 1FN8A 1PYTD 1SHHB 3P8FA 2BLOA 3SI3H 1ZHRA 2AGGX 1P9SA 5EXMA 1YPKH 1C1NA 2FOAA 5JBAS 1BTWA 5DPAA 4LZ1H 1IOEA 1SFQB 1P3CA 2R3YA 3TH2H 2ZPQA 2PV9B 5HGGA 1ZSJA 4CRGA 4CBNA 1AY6H 4ABDA 2GV6A 1GI1A 3LH3A 1KTSB 4O9VA 1MU8B 1H8DH 2Y5HA 1AVGH 1NESE 4OS2A 1ELFA 1PQ7A 2R0KA 3VB4A 4U32A 3SV6A 4JK6A 7ESTE 4INHA 2J95A 5DP9A 1HJ9A 2XC5A 5E0GA 9LPRA 1S0QA 2G55A 1G3DA 2A4QA 2BX3A 1QY6A 1V2WT 3PO1C 1HJAC 2Y7ZA 2PW8H 1AFEH 3T27A 1BHXF 4KP0A 2SGAA 2QV1A 4RKJB 1O2QA 1GJ6A 1H9HE 2BB4A 3PB1E 5TJXA 4B2BA 3G01A 1O33A 1AGJA 3EE0B 2GGVB 3M7TA 3A7XA 5DP3A 2OYAA 4ISOA 3SU5A 4HFPB 1WAYB 1O5DH 2GMTB 4BAHB 4CH8B 1AFQC 1J17T 5DG6A 2RDLA 1YP9A 1S5SA 4Z6AH 5FXLA 5A8XA 3E91A 1V2QT 3A8BA 2NU2E 3GY2A 4YOJA 3ZZ5A 4AB8A 1C1RA 3KN2A 1O3CA 4NIWA 3RMOH 4AZ2B 4E05H 2Z9JA 1ELAA 3S7HB 2NU3E 1FUJA 2ZZUH 1LPZB 1PPBH 1Z7KA 3BIUH 4D9QA 5FCKA 1C5MD 2OY3A 2BDBA 4X2WA 1J14A 3SU1A 3TJOA 1O2YA 3NZIA 3LPRA 3QTOH 4AFSA 3ATIA 1WCZA 1H4WA 2BQWB 2BMGB 4DY7B 3ZZ4A 1QL9A 3MU4A 3SU2A 3DD2H 4ZKOU 2H5DA 4ASHA 1KY9A 1RRKA 4I7YH 2F83A 3LKWA 1HJ8A 1XUHA 1Y5AT 3LONA 3OY6U 1HYLA 2M5TA 1ELBA 4K1TA 2Y80A 3DFLA 3NKKA 4BAMB 4HTCH 1JOUB 4XOJA 1NRPH 1XUIA 3GY5A 1MTUA 2P8OB 1O3MA 3FANA 3T25A 4YO9A 4Q7YA 2V35A 3B23B 2O9QA 1V2JT 2BD7A 1GDQA 1WQSA 1C5XB 3TU7H 1UK2A 4DIHH 1E35B 1OXGA 3NXPA 5JB9S 4MTBA 5AFYH 4AFQA 2ZHWH 3U1IB 4MPWA 1RGQA 1O3EA 5GCHG 3RXTA 1UO6A 3GDSA 1WUNH 1FI8A 1OKXA 1TA6A 1ZPZA 4H6TA 4Y6DA 4I32A 2PUXB 1P10A 4A1XA 3UQVA 3A88A 1MQ6A 1EXFA 1A7SA 5EPYA 3SU0A 3JZ1B 2WUBA 1Z71A 1UCYK 2ALVA 2WUCA 3TK6A 2AYWA 4CR5A 1C5QA 1F0SA 2HOBA 1L1JA 1YC0A 1A0JA 5L30H 2EA3A 1BTPA 2IJOB 5JB8S 2WPIS 1DY8A 3E3TA 2ZCLP 1HAOH 1GI8B 3ZVDA 1FN6A 1NRQH 4ZMAH 1GJ9B 4ZHAA 1GL1A 1T7CA 1GBFA 2BY6X 4NGAH 1P05A 5CHAC 1AU8A 1K9OE 1TQ7B 4FUFA 1D3TB 1LVBA 4AG2A 2A4OA 1O5CB 2F9NA 1LPGB 2OINA 4B75A 1QJ7B 1ZOMA 1SGRE 1A46H 2HALA 2QA9E 4R0IA 4GVUA 1YF4A 1K22H 1EASA 3SU3A 2ZFRH 3KL6A 3S0NA 2FI4E 1AE8H 4WH8A 2QXIA 3L3TA 1UTQA 4XE4A 3OU0A 1BRBE 3D65E 2OP9A 2PTCE 2ZU5A 3P92A 1GBEA 3BTHE 2XRCA 5F8ZA 1QB1A 3M3VA 1O3BA 8GCHF 1RIWC 1KLIH 4MNVA 1RFNA 4Y8ZA 5F8TA 2BD4A 3SJIA 2CJIA 1DXWA 1W0YH 3LDXH 3U1JB 2STBE 1TGCA 3UY9A 1JRTA 4ZKSU 4O97A 1C2KA 3MNSA 5GXPA 1Y5BT 3M5LA 2ZCHP 1V3XA 2QYIA 2ILNA 1GMDG 1FAXA 2ASUB 2Z9KA 5F8XA 2BY9X 4TY7A 1YPHC 4DJZB 3RU4T 4MVNA 3TITA 2G5VA 3RXIA 4LK4A 1P2OA 1G3EA 2FOFA 1BMAA 2H6MA 1EPTA 2OC1A 3UOPA 3QWCH 1W3CA 4FUDA 5A2MH 1DM4B 5LGOA 1CGHA 3DHKH 1ELDE 2VWNA 2OXSA 2BHGA 8LPRA 1Z8JB 2QIQA 3RLWH 3FAOA 5J4QA 4YESB 1THPB 1Y3YA 5EPNA 1ZZZA 1TPPA 4ABHA 3SUGA 3KEEA 1HXEH 3MU0A 4MDSA 2WYGA 4UD9H 3BG8A 3QGNB 1SLUB 1F2SE 1O3GA 1FV9A 1N6YA 1C2GA 2OBOA 2FI5E 2AEIH 1GI7B 3KCGH 1AZ8A 3GCOA 5L6NH 1AWHB 2FOCA 2D8WA 2A2XH 4IN1A 1MD7A 1OPHB 2WINI 1GJAB 1IQKA 3IWMA 1TQ0B 2RG3A 3TGIE 1KDQA 1QA0A 2R0LA 3RXAA 3V13A 3RMNH 3BTEE 5FPSA 3B9FH 2UWPA 3M3SA 1QB6A 2UUFB 1QRZA 3URCA 4Z0KA 2XCFA 3LJJA 1UVUH 5E0HA 2ZTZA 3LH1A 3RXFA 1EAXA 1MCTA 2SGEE 2ZGHA 1TRYA 2ZDVH 2VU8E 2EEKA 4Y8XA 4Q80A 7LPRA 3TNSA 3BV9B 1EPTB 3P8NA 1SGIB 1YCPH 2Z6BD 3ENSB 1O2IA 5AFZH 2Z9GA 4BOHA 2B5TB 1Y8TA 3NK8A 1DITH 2ZDKA 3BEUA 2BYAX 2B0FA 3K65B 4H42U 1GWAA 5T6GA 4B2CA 1DSTA 2ZDLA 2H9HA 3GY4A 5A0AE 1GVLA 2D26C 3P70B 4WH6A 1P12E 2FOEA 1S83A 1SLXB 1DVAH 3EYDA 4ZH8A 1HDTH 1LHDH 3MTYA 1TALA 2EC9H 5F6MA 4UFDH 3OX7U 1EP6A 3SO3A 1T8NA 4XBDA 6CHAC 3K6YA 1ESAA 3FVFB 2JH5D 3T26A 4MNWA 1TLDA 2A4GA 4CRBA 1C1PA 4ESTE 1LPKB 1G9IE 3A84A 2DUCA 2BDCA 2P93A 4X2XA 1GJDB 2CHAC 2CHAB 1A3BH 3ZZCA 4FUIA 1O32A 3EA9A 2ZQ2A 1RJXB 7GCHG 2IOTA 2HNTE 1FXYA 3E0NB 2FS9A 1NRNH 1O39A 1FONA 1KDQB 1NFXA 4BAKB 1VITG 2F3CE 1G2LA 3Q3KA 3RXEA 4IGDA 1OWKA 1QBOA 3E16B 5H4IB 1HIAA 1O36A 1SGPE 1W10U 3GOVB 6LPRA 1CA0C 3OTJE 3W95A 2JOPA 1GMHF 2J38A 3SJ8A 1SQAA 1ZHPA 4RN6A 3SU4A 2VGCB 1FIWA 4MPVA 2O8UA 4GAWA 4BXWA 4JCNA 3D62A 1ZJKA 1GCTB 3TJNA 4KTSA 1QIXB 1XXFA 2PKSC 3OSYA 2C90B 5AF9H 1L4ZA 1CT0E 1DWDH 1F0UA 1MKXH 2B9LA 2FDAA 4AFZA 2DE9A 2AGIX 2G51A 5JPMH 1GBMA 1Y3WA 1P2IA 3BTTE 5C5OA 3ZZ3A 1SLVB 3LIWA 2H1UA 3RXHA 1GI2A 1W8BH 5DGJA 1QR3E 3RXQA 3ZZDA 1W7XH 4FVBA 1LHCH 3SU6A 1ZRBA 1V2RT 1V2KT 1N8OC 4X8SH 4ABGA 4WMEA 3R0FA 3A89A 3RP2A 2HPQH 1ZTLA 2XWBI 1ORFA 1HXFH 1UVOA 3NCLA 2TGDA 4Y79A 1TB6H 5TCAA 3UQOA 3TNTA 1E37B 1BB0B 1O2SA 3O8DA 1UVSH 3RXDA 1C5TA 2ESTE 2J9NA 1V2PT 1ETSH 3FP7E 4DVAU 1GG6C 1VGCB 2TPIZ 1GCDA 1T8LA 2R2MB 1P2NA 2AIPA 1ANDA 1HIAB 4GHTA 3SV2H 1SG8B 4LXBH 1IQGA 2LNCA 3SV8A 2OD3B 4LOYH 1C5VA 1V2NT 2P94A 4FUCA 1TGTA 1GHAG 3BSQA 4R8TB 5JFBA 3BG4C 4TYDA 1EOLA 1O2UA 1HPGA 1AI8H 4BANB 3QK1A 2GDDA 1XUGA 2RA3A 3SUDA 4OGXA 1C5NH 1A4WH 3HKJB 4NA8A 3SJKA 2BQ6B 3SBKA 1TRMA 1O5BB 1JXPA 1L0ZA 1C4V2 2QC2A 1T31A 3LJOA 4UFGH 4DCDA 1V2LT 1H9IE 1QQ4A 3QZQA 3RM2H 3GY6A 4Y7BA 1AN1E 2IPHA 1EZUC 2PWXA 2KAIB 2SNWA 2PFEA 1ELTA 2ODQA 3UREA 2GX4A 3UNRA 1DWCH 2VIPA 1O5EL 3TLOA 3RC6A 1YPHE 3ELAH 1C1QA
chains in the Genus database with same CATH superfamily
4OS7A 3U9AH 3F68H 2ANWA 1G3CA 1IQJA 2UUKB 1DLEA 4I8HA 1DX5M 1MU6B 1Z1IA 3ZYEA 1HAYB 2ZIQH 2C93B 4NIXA 3C27B 2O8TA 1TNKA 5T1VA 2BD5A 5AVDA 4F4OC 1AD8H 1GVKB 4KTUA 4JMYA 1MKWH 4AFUA 1O2MA 2FS8A 1O5FL 4ZROA 5KECA 1GMCF 2VJ1A 2AFQB 2HGTH 1TRNA 2QAAA 4O3TA 1KXBA 1O3IA 2ZGBH 2ZO3H 3QUMP 3O8CA 1SVPA 1TIOA 1D6RA 3BTFE 2FLBH 2FIRH 4IW4E 2BLQA 1F92A 2AERH 3RC5A 3F9FA 1O2PA 2AH4X 3PO1B 1O3LA 1QL7A 1HJAB 1XVMA 5FX5A 1QRWA 1K1IA 4K1SA 4MPXA 2PUQH 2WV4A 1GDNA 5K7RA 1P2KA 1VITH 1S82A 1M9UA 1OWIA 5ESBA 4DURA 5EW2H 1SI5H 1OWEA 1BRCE 5GDSH 2GDEH 2EI8A 2QXHA 2VIVA 4KTCA 5G4BA 3WWFA 5FPTA 4WWYA 1C5RA 1TX8A 1GL0E 1RTLA 1O2XA 1ZHMA 3V12A 1FY5A 1GHVH 1IQFA 2VINA 1GI0A 3UWIA 1AFQB 3GCTF 1FY1A 1SQOA 4CH2B 1YCPM 4CR9A 3Q77A 2JJ2D 4IBLH 3AVZA 3BEFB 1GJ5H 2J34A 2GVFA 4H4FA 3RXCA 1YPJH 3QO6A 4XRNA 4X8TH 4B74A 1SOZA 1HAVA 5IK2D 2P3FH 1SSXA 3ATLA 1TABE 4OGYA 4JZDH 1T32A 2TGTA 3ZZ6A 3MNBA 4B73A 2BD9A 2FI3E 4XDEA 1ZPCA 2ZECA 1TOMH 4B1TA 4NWKA 2BZ6H 2UUJB 1O30A 2ZWLH 4B71A 1P57A 1P2QA 4IC5A 5I46H 1GI6A 1YPMH 3MH6A 5BPEA 3SGQE 3KQ5A 2FP7B 1CA8B 2WPHS 4K2YA 1QGFA 1QA7A 2Z3EA 1BJVA 1BJUA 3MNXA 3QN7A 4OS6A 4X1NU 1HAIH 1G30B 1GI3A 2BVRH 4TWYA 2NU4E 4VGCC 4YOGA 3MO3A 3DFJA 1FDPA 2KX4A 2GTBA 4UE7H 3LOXA 2G52A 3BF6H 4O3UA 2R9PA 1EB2A 1YPEH 1YLCA 2GZ8A 3H5CB 1E36B 2QXGA 1A1RA 3U98H 2XNDD 1O3FA 2FTMA 3LGIA 1CQQA 3T62A 4X1PU 1BHXB 1YCPK 2QF0A 3VXFH 4MQAA 1VCPA 1ABIH 1ELVA 1GDUA 1P0SH 1P3EA 2D2DA 1C1VH 1GBDA 2WPKS 1XUFA 1Q31A 1ZGIA 1IQMA 1S6FA 1TBQH 2PSYA 1GBLA 1O35A 3ODDA 1UK3A 1V2MT 3MNCA 4WMDA 3IITA 1TOCB 1TGSZ 2BDHA 2FOMB 3TVJB 3PTBA 2F9OA 2CXVA 4ABFA 5A8ZA 3HPTB 5KGOA 1GI9B 1W11U 1HAVB 4AYVB 2TBSA 1G36A 4NFFA 1SGTA 3RC4A 2FEQH 3DCLA 1UMAH 3TK5A 1CGIE 3QZRA 2WYJA 2AS9A 2YOLA 4E06H 3FFGA 3ATKA 1P57B 3TGJE 1TA2A 2V7QD 3ZZBA 4JK5A 4TY6A 2R3UA 1W13U 2VIWA 5DSFA 2DE8A 1TX7A 3LGWA 2JIZD 2FODA 2XXLA 4ISLA 3JZ2B 1C5OH 3N7DA 4BTTB 5JYIA 3UWJH 4ACAA 4ZXYH 5CHAB 3RXSA 1HUTH 3SQHE 1K1LA 4AORA 3SUFA 2BD8A 2OBQA 2Y81A 1LHEH 2GKVE 2XC0A 4FU7A 5HMAA 1BIOA 1T4UH 1BMMH 1NRRH 4I8GA 1C1TA 4A1VA 3RXRA 1PPHE 2CF9H 1ZMNA 2H5CA 1EAIA 2JETC 6GCHG 1QB9A 4NA7A 1BZXE 3NWUA 5C0UA 1EJNA 1YBWA 5C5NA 3OFND 5T6DA 4MG3A 3A87A 3UNSA 1U6QA 4YT7H 1BTHH 1P01A 3KQEA 2V6NA 1TAWA 5JBCS 1E34B 4CRCA 1P9UA 1RS0A 1DUAA 3VXEH 2GV7A 1PQAA 2ZGXH 2W7SA 1A0HB 2Z3CA 3OEED 3UFAA 1WTGH 1ANCA 1RIWB 1MZAA 1J16A 1NS3A 1GVZA 2HRVA 3GY7A 1TGBA 2F9BH 3F1SB 5KEDA 1GJ7B 1K1JA 1W7GH 2F43B 2QY0B 4CRDA 5LPFA 1O2GH 1XX9A 1MBQA 4YLUA 3MU8A 3W94A 2WPJS 1Q2WA 3ODFA 5HIYA 3GCHC 1NRSH 2LELA 4O03A 3RLYH 1C9PA 1PYTC 3PLKA 4GPGA 1PPCE 4YZUA 4UONA 1JMOH 3FOAA 1H8HD 2CMYA 4A6LA 2FX4A 2VH0A 3MMGA 3E1XB 1HRTH 3PMJA 5GCHF 2BY5X 3D23A 1OOKB 2KFWA 1C2MA 1EOJA 3MWIU 1VJAU 2VVVA 2ZGJA 5ESTE 1KYNA 2BXUH 1ELGA 4Y0ZE 1BMLA 1A3EH 1JIMA 3C1KA 2A5KA 2A5AA 4MNYA 1GBAA 2A45B 1VR1H 1C2JA 3M35A 1C5YB 4K1EA 5EXLA 2BDYA 3K2UA 3Q3XA 3OE7D 1WOFA 3ZVGA 3MU5A 1NFUA 1H8IH 3ESTA 3U8TH 4JZFH 5BRRE 1GHBG 4WVPE 3B8JA 5C1UA 5C2ZA 3AAVA 1Z1JA 3BTQE 2QGRA 1BBRE 2Z94A 4ABIA 2YMSC 1TNLA 3ZYDA 5IDKA 4OS5A 1HAPH 2AMPA 2Y7XA 1TNHA 4ACBA 3V3MA 1RXPA 3UPEA 4K60A 1WDIA 3EA7A 2O8MA 3MHWU 1GHWH 1E38B 1KSNA 4ZCNA 1SQRA 5A0BA 2BVXH 1C2FA 3P8GA 4X1RU 2VB0A 3RUOA 1SC8U 4BTUB 1TMUH 4FXGH 2B8OH 3UTUH 2SNVA 2ZF0H 4AGJA 2UWOA 3M37A 4UFEH 1CT2E 3RXJA 1GHXH 1LVMA 2SFAA 4F48B 1TNJA 2SGPE 4YM9A 1TGNA 1YKTA 2SGDE 2OTVA 2IN2A 1NU9A 1VJ9U 1UTLM 1O2KA 1ZR0A 2VVCA 1LMWB 3SI4H 1TPSA 1K1OA 2BM2A 2ZA5A 3O8BA 2ZFTA 3NRLA 3U8RH 4ZHLU 1FZZA 1ZLRA 4K3JA 4FUHA 1QHRB 3HK6B 4AX9H 1THRH 2FM2A 1TMBH 2G00A 3F2FA 4WXVA 3UUZA 3A7ZA 3TGKE 3FP8E 1V2VT 3F9GA 1MQ5A 3O8RA 4JZ1A 1G32B 1QURH 1VKYA 2QF5A 1W2KH 5PTPA 1AQ7A 3DSPA 3L6PA 4FU8A 2A31A 3SV7A 1A5HA 1P11E 2ZEBA 4NSYA 3T5FH 3VGCC 3SZEA 5HM2A 3ZVFA 1JIRA 3PROA 5K0HA 1MD8A 1D3QB 1C1MA 2C8YB 5FX6A 5DKMA 1FY4A 2F9PA 6CHAB 1CE5A 1SR5C 1OHHD 1MZDA 2XBVA 1EATA 1GMDF 3GCNA 3CENA 1Y3XA 1O2ZA 3MFJA 2YNBA 1PPEE 2STAE 1C1UH 4X1SU 1SQTA 4GCHG 1GI4A 3STIA 2C4FH 1YM0A 2Z7FE 1UCYH 3UNQA 2ZTYA 4OS1A 5FPYA 2W7UA 4FUEA 3UR9A 3PTNA 4A5TS 1BOQA 1KLJH 2I6QA 1HAXB 2GT7A 2K1QA 2CN0H 3PMBB 1LHGH 3MOCA 2FESH 1GGDC 1ZTKA 1GGDB 2BZAA 2LP6A 1K1PA 1CHOG 2KM0A 5T3HA 3M3TA 1D9IA 4U2WA 2K8IA 3E6PH 4A7IB 1IQLA 1KIGH 2ULLA 3L33A 1OWHA 2F9UA 1B0FA 1CA0B 1LO6A 3CP7A 3E8LA 1Y3VA 1YPGH 3I77A 1HAHH 1UW7A 5A8YA 1WTHD 3QTVH 4B6EA 3QLPH 1L2EA 2PKSB 1TE0A 3H7OA 3D49H 5EOKA 5DJ7A 3MU1A 2G4TA 1CHGA 3M36A 4NIYA 2XC4A 1NTPA 4I86A 2XBXA 2BOKA 3N7OA 1TYNA 1H9LB 4U30A 5E2PA 5LH8A 2F9VA 4FVDA 1AE5A 1EFRD 1NFWA 1WSSH 3GDUA 2KAIA 3MH4A 1YGCH 5EG4A 1OP2A 2TGPZ 4X2VA 1DWEH 1UTOA 1TWXB 1ZYOA 1SMFE 1ARCA 1ZRKA 1F5RA 3AASA 2ZFFH 1LVOA 5FBEA 3KGPA 1N8OB 4NZQA 1ZSLA 2BD2A 1HB0B 1O31A 4CRAA 1IAUA 1EAWA 3CS0A 1SGYE 2SGFE 1DXPA 1EP5A 1GMCG 2D1JA 2OC8A 4CBOA 1V2OT 3ATMA 1BITA 5EU8A 1V6DA 1DFPA 1BA8B 3SHAH 2R2WU 1OSSA 2PTNA 1SLWB 5HXFA 1KLTA 2BQ7B 5C1XA 1EJMA 4ZKNU 1C5PA 1GG6B 2ZFQH 2VIDA 1C2EA 1KXCA 4INLA 1C1SA 1A61H 2XNIA 4NCYA 1DY9A 3PV2A 3S9BA 2BY8X 1PJPA 1S6LA 1Y59T 1QBNA 4BAOB 1OX1A 2W26A 2ZFSA 3OEHD 4AB9A 1PQ8A 3ZV8A 2ZI2H 3GCTG 3A8CA 4ISNA 4NWLA 3FN8A 3BG4B 1NBME 1UHBA 3Q3YA 4CHAC 2OLGA 4CHAB 4Q63A 1WYKA 1FPHH 2GCTC 2RA0A 3P6ZB 2KR7A 2WZQA 2ZHEH 1XUKA 3SNBA 2XCNA 5GIBA 3U28C 2FTLE 7GCHF 3A82A 1GJCB 1BUIA 1Z8RA 2VWLA 3VB3A 2WSSD 4NIVA 4D8NA 1GBJA 1O0DH 3ZVCA 2OC7A 4AOQA 2GZ7A 1AB9C 4AN7A 1AB9B 3BTME 1AO5A 1GJBB 2BDAA 3HATH 4JYVH 3MH5A 5GNDA 1FY3A 2A4RA 3MO9A 4K69A 3BEIB 4BNRA 1NBMD 1BY2A 2VIOA 1MTNC 2KZ4A 2QCYA 1DUEA 4FUJA 3F2HA 1LTOA 3QGJA 2ZDAH 5CE1A 1O2WA 3RXMA 8ESTE 3MI4A 1BBRH 2FX6A 3S9CA 1DDJA 2FWWA 3WWBA 1EUFA 1S0RA 1VCWA 4A92A 3T2NA 2XW9A 4Y8YA 1QNJA 1QQUA 2Q6DA 3V7TA 3SORA 5DK1A 5EXNA 1OP8A 1ETRH 4I8KA 2V3OH 4SGAE 4JZIA 4H6SB 1BRUP 1V2ST 1DOJA 1SGEE 3BN9A 1SB1H 3N99A 3IG6B 2HNTF 1UVPA 1FNIA 3AW0A 1HAGE 4THNH 4NSVA 1P8VC 2A7CA 3I78A 1H1BA 1FY8E 3SGBE 1UHBB 5IYTA 2FLRH 1F7ZA 1P03A 4X8VH 1O3OA 3A85A 1G37A 1XM1A 9ESTA 1AUJA 4NG9H 2ZDNA 2O8WA 4X6PA 4I8LA 4WJG2 3M7QA 3P95A 3EA8A 5C20A 2XTTB 4ZAEA 3RXPA 2IJD1 4IN2A 4MLFB 4ZKRU 1AWFH 3MYWA 1S81A 2YNAA 5C17A 1NN6A 2P59A 4K8BA 5A0CA 1C9TA 1DS2E 1EZQA 1AZZA 2Q6GA 2ANMH 1MMJN 1O5GH 2F4LA 2G81E 1SGFA 3PWBA 1O2RA 5C0TA 3BTKE 3SNCA 2Z3DA 3M5NA 5L2ZH 1B5GH 4KELA 2GMTC 4RSPA 2G8TA 3LC5A 4FU9A 4YXWD 1UTJA 4DG4A 1GHAF 2C8WB 4X1QU 2JDID 2V3HH 3SN8A 5HIZA 3RXUA 2W6ID 3EQ0H 2A2QH 3T29A 2OC0A 1SGCA 3PMAB 2PR3A 3RXKA 2EI7A 1OS8A 3SQEE 1SBWA 2HPPH 3U69H 1MCVA 1P06A 1O3AA 2CV3A 1EB1H 1C5WB 4J2YB 4DT7B 1GJ8B 1FJSA 2OUAA 1CSOE 1GBBA 1QTFA 2HVYB 1BQYA 1NFYA 5AHGH 2WPMS 2J97A 5HYOA 5LPRA 5C67A 2W5EA 1BTUA 3PLBA 4TWWA 5F53A 1SPJA 4HZHA 1DPOA 4ZHMU 5C1YA 1OWJA 1PPZA 2H2ZA 2NU1E 4Q7ZA 4VGCB 1C2HA 8GCHG 2GCHF 2VVUA 2H9TH 1YLDA 3BTGE 1NPMA 2HNTC 1BMNH 1CT4E 1O3HA 4MPUA 4LZ4B 3E0PB 3TIUA 5FBIA 2P3TB 4BXSA 3GISB 4D76A 2ANYA 3HK3B 1A5IA 2Q6FA 4NFEA 3A80A 1ESTA 4X2YA 2ZHDA 1UCYE 4XBBA 3WW7A 1ID5H 2G5NA 2P8OC 4Y76A 2FYQA 5C3NA 5JDUB 4FUGA 4Y10E 2O8LA 4CRFA 4BAQB 5I25A 3GY3A 1IQIA 3VB6A 1TBZH 2UWLA 3LGYA 1C4U2 3SHCH 1E0FD 4SGBE 2AMDA 1NU7B 4E7NA 1FMGA 3I29A 1C5UA 1C5ZB 3LC3A 1FX0B 1T4VH 1XVOA 1TX6A 2UUYA 1BT7A 4ABAA 1KXDA 2WPDD 3H7TA 1JBUH 1AIXH 3LGUA 1KXFA 2A1DB 3ZZ8A 2Y6TA 1T8MA 4ZXXH 1NY22 1TPOA 4Y11E 2L6OA 4AGKA 2P95A 2ZTXA 1C1OA 2PHBA 5B6OA 1CBWC 1BCUH 2J5UA 4BTIB 1CBWB 1D4PB 1F0TA 1NT1A 2A32A 1Z6EA 3HKIB 4KKDA 3NUMA 2WHXA 1COWD 2VH6A 4FUBA 1UTNA 1FAKH 2AMQA 1B0EA 1D3PB 4WMFA 1O3KA 1O5AB 2RDEA 3ZVBA 1VZQH 4YT6H 1CGJE 1Z8IB 3DA9B 2A7HA 1JRSA 1P04A 2NWNA 2ZGCA 1OYQA 3A83A 3GY8A 3RMLH 1LKAA 3EAJA 4U01A 1O38A 3M5OA 4Q2KA 5ABWA 1SOTA 2XWAA 4NZLA 1GHYH 3KQBA 3LGVA 3OAAD 1Y3UA 1W12U 1RD3B 1C5LH 1OYTH 2JETB 3UR6A 3M61U 5DP5A 3SJOA 2C8ZB 2FO9A 1HV7A 1L4DA 1NO9H 1O2JA 1O3DA 1O3JA 1DT2A 3QDZB 3RXVA 3AAUA 4X6OA 1QJ1B 1MTVA 2FMJA 2Z9IA 2ZNKH 3S9AA 1AVWA 3RU4E 3M5MA 2Z9LA 2HLCA 2H9EH 2V0BA 1K1NA 1TMTH 3HGNA 3NPSA 3VFEA 3UIRA 3KQCA 1MKXK 3ZZ9A 1GHZA 3PV4A 2BXTH 3RXOA 2HWLB 1V2UT 4ABBA 5B6LA 4K5ZA 4ZUHA 1ZGVA 1O5EH 3GDVA 4GUXA 1T8OA 3GYLB 1DWBH 1PQ5A 1EZSC 2TRMA 3ZZAA 4WF8A 4JYUH 1WQVH 3A86A 4YLQH 1G2MA 1AMHA 1K28D 2PGQB 1W0ZU 3GCHB 4DT4A 2BLWA 2ODPA 3PRBA 3FP6E 4I31A 3RU4D 2ZHFH 2BVSH 2BD3A 5L2YH 1PPGE 2BY7X 3TJVA 3KNXA 1V2TT 5E2OA 1S85A 3KF2A 4JYTA 1YPLH 1SGQE 3RXBA 4RKOB 2PKAA 3ZVAA 1K1MA 1EZXC 4AG1A 4XBCA 4D9RA 3PMHB 3PRDA 2FPZA 4E7RG 5SGAE 3GYMA 1O37A 4X6MA 3SJ9A 1XKBC 1O5FH 4UEHH 5GPIB 2ZU3A 1MAYA 1ACBE 1ARBA 4NA9H 1QCPA 4INKA 3MO6A 1W0KD 2OCVB 1EQ9A 5DP8A 1MTWA 1HFDA 1HGTH 3MH7A 3KQDA 1DANH 3A7VA 3FZZA 2NU0E 1IHTH 1DSUA 2ZPSA 1ZTJA 1INCA 1O3PB 2G4UA 4QT8C 3DT0H 1SGNE 3FZDA 2ZU4A 1L1GA 3EGKH 1XUJA 2YMSB 1KXAA 4HI3A 2WPLS 1DE7H 4YOIA 3BTDE 1C5SA 1XKAC 2IPQX 4X8UH 6ESTA 2ZU2A 3F0PA 3A7WA 3LU9B 3M7UA 2B7DH 3VPKA 3VB5A 3A7YA 1NROH 1GMHG 2W3IA 1P09A 1N1LA 1TBRH 1O2OA 1O2NA 1GBIA 3VG8A 2PSXA 1GBKA 3S69A 4DOQA 2F91A 2PGBB 2ZP0H 1J9CH 1RTKA 2ODYB 4PROA 1LVYA 2XBYA 5FHTA 1A2CH 5EQSA 3K9XB 4M9FA 2ZHQH 2ZU1A 4ISHH 2WV5A 1C1WH 2HVXA 2EY4C 2GD4B 3HGPA 1CVWH 1MUEB 4IS5A 1JWTA 1LQEA 2GZ9A 3A8AA 1ANBA 1AKSA 4TPYA 5EW1H 6GCHF 1J15A 4I33A 3F6UH 1CU1A 1MTSA 8KME2 4D7GA 1BBRK 4X6NA 2RCEA 1Z8GA 1HAZB 2PKAB 5TCCA 1WBGB 5LPEA 5DP4A 2FZZA 3SNAA 4J1YA 1ZSKA 1PPFE 1C4Y2 3SOSA 4IMQA 1UTMA 1LCYA 4K8YA 4IMZA 5EQQA 1VCQA 2ZG0H 3OY5U 5ETXA 5FCRA 1MKWK 3RMMH 3V0XA 1EPTC 3RDZA 2AIQA 3PWCA 2C8XB 1XXDA 4M7GA 2BOHB 2QN5T 2FOBA 4IC6A 4DGJA 3VGCB 1EAUA 5T6FA 1S6HA 3P8OA 3SV9A 1MAXA 4ASUD 4MNXA 1MBMA 1GPZA 1QFKH 2Y82A 2A7JA 2ZKSA 4AYYB 1J8AA 1TNGA 5JBTA 1C2LA 1O3NA 1UTPA 1LDTT 4JZEH 1UVTH 2ZC9H 1IQEA 3A8DA 3R3GB 2J2UA 3A7TA 1YWUA 3TK9A 3GICB 1F0RA 4OS4A 1DLKB 5A09A 4UDWH 4XSKU 1TNIA 5GJ4B 1K2I1 1BRAA 2JH6D 2GT8A 1WU1A 1HBTH 1FIZA 2JP0A 2J94A 4XFQA 1C2IA 1AVXA 3DUXH 3KYGA 1QZ8A 5EQRA 3WY8A 1ZPBA 3F9EA 5E8EH 1ANEA 1E1QD 1BTYA 2ALPA 3URDA 1FQ3A 4ABEA 3T28A 4DW2U 5E0JA 2ZQ1A 1XMNB 1AKSB 1O2HA 3RM0H 2OTTX 1GHBF 1YYY1 3SW2B 1ESBA 3CS7A 2THFB 3SZNA 1IQNA 2ZPRA 1NZQH 1X7AC 3ATWA 4D7FA 1H8ED 2FOHA 1ABJH 1HCGA 5J4SA 1LQDB 1AUTC 1ETTH 1LHFH 3BIVH 1F5LA 1D3DB 1KXEA 2VGCC 4KGAA 4UFFH 1F5KU 3SNEA 3ITIA 2FOGA 4WXIA 1GCTC 4X0WU 2JH0D 3AW1A 3Q00A 4Y71A 3LGTA 1A0LA 1SL3A 2SGQE 3STJA 4GSOA 1TPAE 2CK3D 2J4IA 4DIIH 1KTTB 1SFIA 5CHBA 2CGAA 1BDAA 1LKBA 2W6JD 4YTAA 1KMHB 3UB0A 3QX5H 3ZZ7A 1EX3A 3E90B 4TPIZ 3SNDA 3LT3A 5DP7A 3ZV9A 2BTCE 1EKBB 1B7XB 4Y7AA 1Y5UT 1WV7H 2A0QB 2XYAA 3KIDU 5DO4H 1FPCH 2FYRA 1Z6JH 4WY3A 2GP9B 5HM9A 3KHVA 1SHYA 2P3UB 1OWDA 1O34A 2FXRA 2VNTA 2OQ5A 3PM3A 1TFXA 3EDXB 2W3KA 2JKHA 4ISIH 4OM9A 2OQUA 1GBCA 3K6ZA 1DICA 1G3BA 3OYPA 2LPRA 1O2VA 1NM6A 3VB7A 2AGEX 3S7KB 4GHQA 1SGFG 1QRXA 5C94A 1RTFB 1N6XA 2EI6A 1IQHA 1GJ4H 3TPIZ 2C3SA 2CF8H 5DP6A 7KMEH 3PYHA 1A5GH 2Y5GA 2QXJA 5EJZA 3SGAE 3ZVEA 1VGCC 1ZMJA 1THSH 3EE7A 2ANKH 5GWZA 1CO7E 1TONA 5EGMA 1W14U 3P17H 2GCTB 2TIOA 4GCHF 1L1NA 2QE7D 1UK4A 2P16A 3U8OH 4F49A 1BTXA 2HLDD 2JA4A 1QL8A 2PLXA 3RXGA 3RXLA 1ZMLA 1UJ1A 2Q1JA 2ZCKP 3Q76A 1NC6A 4Y0YE 1IHSH 1SGDE 2BDIA 1P2JA 2VWOA 1Q3XA 1VITF 4ABJA 1GBHA 1ELCA 1S84A 4CREA 2VWMA 1MH0A 2BX4A 1CHOF 2ZDMA 1ZJDA 3A81A 2Y5FA 1GI5A 2J92A 3PLPA 1O2LA 4I8JA 1EJAA 1UTKA 4HGCA 2BLVA 3TH3H 4GLYA 3UOUA 2XBWA 1MTNB 4RI0A 1ELEE 5FAHA 3F9HA 1BTZA 1QJ6B 1P02A 5EODA 3VEQB 4B76A 1C2DA 3SUEA 4FOUC 1AHTH 1OP0A 2QF3A 5CMXH 1O2TA 1HNEE 1K21H 1GBTA 2I6SA 5F03A 1P2MA 2GCHG 1FLEE 2VIQA 1PFXC 2TGAA 4B2AA 1D6WA 3TH4H 4Q7XA 1HLTH 3BTWE 4A1TA 3TJUA 2BDGA 2A5IA 5JBBS 1QBVH 2ZFPH 1FN8A 1PYTD 1SHHB 3DSOA 2BLOA 3P8FA 3SI3H 1ZHRA 2AGGX 1P9SA 5EXMA 1YPKH 3F0OA 1C1NA 2FOAA 5JBAS 1BTWA 5DPAA 4LZ1H 1IOEA 1SFQB 1P3CA 2R3YA 3TH2H 2ZPQA 2PV9B 5HGGA 1ZSJA 4CRGA 4CBNA 1AY6H 4ABDA 2GV6A 1GI1A 3LH3A 1KTSB 4O9VA 1MU8B 1H8DH 2Y5HA 1AVGH 1NESE 4HG6A 1ELFA 4OS2A 3W1EA 1PQ7A 2R0KA 3VB4A 4U32A 3SV6A 4JK6A 7ESTE 4INHA 1YY3A 2J95A 5DP9A 1HJ9A 2XC5A 5E0GA 9LPRA 1S0QA 2G55A 1G3DA 2A4QA 2BX3A 1QY6A 1V2WT 3PO1C 1HJAC 2Y7ZA 2PW8H 1AFEH 3T27A 1BHXF 3N7EA 4KP0A 2SGAA 2QV1A 4RKJB 1O2QA 1GJ6A 4RT1A 1H9HE 2BB4A 3PB1E 5TJXA 4B2BA 3G01A 1O33A 2YMSD 1AGJA 3EE0B 2GGVB 3M7TA 3A7XA 5DP3A 2OYAA 4ISOA 3SU5A 2EQNA 4HFPB 1WAYB 1O5DH 2GMTB 4BAHB 4CH8B 1AFQC 1J17T 5DG6A 2RDLA 1YP9A 1S5SA 3H09A 4Z6AH 5FXLA 5A8XA 3E91A 1V2QT 3A8BA 2NU2E 3GY2A 4YOJA 3ZZ5A 4AB8A 1C1RA 3KN2A 1O3CA 4NIWA 2WV9A 3RMOH 4AZ2B 4AC9A 4E05H 2Z9JA 4B6FA 3GS9A 1ELAA 3S7HB 2NU3E 1FUJA 2ZZUH 1LPZB 1PPBH 1Z7KA 3BIUH 4D9QA 5FCKA 1C5MD 2OY3A 2BDBA 4X2WA 1J14A 3SU1A 3TJOA 1O2YA 3NZIA 3LPRA 3QTOH 4AFSA 3ATIA 1WCZA 2BMGB 2BQWB 1H4WA 4DY7B 3SYJA 3ZZ4A 1QL9A 3MU4A 3SU2A 3DD2H 4ZKOU 2H5DA 4ASHA 1KY9A 1RRKA 4I7YH 2F83A 3LKWA 1HJ8A 1XUHA 1Y5AT 3LONA 3OY6U 1HYLA 2M5TA 1ELBA 4K1TA 2Y80A 3DFLA 3NKKA 4BAMB 4HTCH 1JOUB 4XOJA 1NRPH 1XUIA 3GY5A 1MTUA 2P8OB 1O3MA 3FANA 3T25A 2KCOA 4YO9A 4Q7YA 2V35A 3B23B 2O9QA 1V2JT 2BD7A 1GDQA 1WQSA 1C5XB 3TU7H 1UK2A 4DIHH 1E35B 1OXGA 3NXPA 5JB9S 4MTBA 5AFYH 4AFQA 2ZHWH 3U1IB 4MPWA 1RGQA 1O3EA 5GCHG 3RXTA 1UO6A 3GDSA 1WUNH 1FI8A 1OKXA 1TA6A 1ZPZA 4H6TA 4Y6DA 4I32A 2PUXB 1P10A 4A1XA 3UQVA 3A88A 1MQ6A 1EXFA 1A7SA 5EPYA 3SU0A 3JZ1B 2WUBA 4P02A 2L74A 1Z71A 2QF4A 1UCYK 1K0HA 2ALVA 2WUCA 3TK6A 2AYWA 4CR5A 1C5QA 1F0SA 2HOBA 1L1JA 1YC0A 1A0JA 1W0JD 5L30H 2EA3A 1BTPA 2IJOB 5JB8S 2WPIS 1DY8A 3E3TA 2ZCLP 1HAOH 2KCAA 1GI8B 3ZVDA 1FN6A 1NRQH 4ZMAH 1YLNA 1GJ9B 4ZHAA 1GL1A 1T7CA 1GBFA 2BY6X 4NGAH 1P05A 5CHAC 1AU8A 1K9OE 2JJ1D 1TQ7B 4FUFA 1D3TB 1LVBA 4AG2A 2A4OA 1O5CB 2F9NA 5EJLA 1LPGB 2OINA 4B75A 1QJ7B 1ZOMA 1SGRE 1A46H 2HALA 2QA9E 4R0IA 4GVUA 1YF4A 1K22H 1EASA 3SU3A 2ZFRH 2AHME 3KL6A 3S0NA 2FI4E 5DN6D 1AE8H 4WH8A 2QXIA 3L3TA 1UTQA 4XE4A 3OU0A 1BRBE 3D65E 4F55A 2OP9A 2PTCE 2ZU5A 3P92A 1GBEA 3BTHE 2XRCA 5F8ZA 1QB1A 3M3VA 1O3BA 8GCHF 1RIWC 1KLIH 4MNVA 1RFNA 4Y8ZA 5F8TA 2BD4A 3SJIA 2CJIA 2KCPA 1DXWA 1W0YH 3LDXH 3U1JB 3UAIC 2STBE 1TGCA 3UY9A 1JRTA 4ZKSU 4O97A 1C2KA 3MNSA 5GXPA 1Y5BT 3M5LA 2ZCHP 1V3XA 4RT0A 2QYIA 2ILNA 1GMDG 1FAXA 2ASUB 2Z9KA 4TSFD 5F8XA 2BY9X 4TY7A 1YPHC 4DJZB 3RU4T 3F2GA 2K0QA 4MVNA 3TITA 2G5VA 3RXIA 4LK4A 1P2OA 1G3EA 2FOFA 3CNRA 1BMAA 2H6MA 1EPTA 2OC1A 3UOPA 3QWCH 1W3CA 4FUDA 5A2MH 1DM4B 5EIYA 5LGOA 1CGHA 3DHKH 1ELDE 2VWNA 2OXSA 2BHGA 8LPRA 1Z8JB 2QIQA 3RLWH 3FAOA 5J4QA 4YESB 1THPB 1Y3YA 5EPNA 3F3BA 1ZZZA 1TPPA 4ABHA 3SUGA 3ZIAD 3KEEA 1HXEH 3MU0A 4MDSA 1SKYE 2WYGA 4UD9H 3BG8A 3QGNB 1SLUB 1F2SE 1O3GA 1FV9A 5EJ1A 1N6YA 1C2GA 2OBOA 2FI5E 2AEIH 1GI7B 3KCGH 1AZ8A 3GCOA 5L6NH 1AWHB 2FOCA 2D8WA 2A2XH 4IN1A 1MD7A 1OPHB 2WINI 1GJAB 1IQKA 3IWMA 1TQ0B 2RG3A 3TGIE 1KDQA 1QA0A 2R0LA 3RXAA 3V13A 3RMNH 3BTEE 5FPSA 3B9FH 2UWPA 3M3SA 1QB6A 2UUFB 1QRZA 3URCA 4Z0KA 2XCFA 3LJJA 1UVUH 3AK5A 5E0HA 2ZTZA 3LH1A 4Q4LA 1EAXA 3RXFA 1MCTA 2SGEE 2ZGHA 1TRYA 2ZDVH 2VU8E 2EEKA 3OTPA 4Y8XA 4Q80A 7LPRA 3TNSA 3BV9B 1EPTB 3P8NA 1SGIB 1YCPH 2Z6BD 3ENSB 1E79D 1O2IA 5AFZH 5CDFE 2Z9GA 4BOHA 2B5TB 1Y8TA 3NK8A 1DITH 2ZDKA 3BEUA 2BYAX 2B0FA 3K65B 1BMFD 4H42U 1GWAA 5T6GA 4B2CA 1DSTA 2OK5A 2ZDLA 2H9HA 3GY4A 2V3MA 5A0AE 1GVLA 2D26C 3P70B 4WH6A 1P12E 4XD7D 2FOEA 1S83A 1SLXB 1DVAH 3EYDA 4ZH8A 1HDTH 1LHDH 3MTYA 1TALA 2EC9H 5F6MA 4UFDH 3OX7U 3FKSD 1EP6A 2J98A 3SO3A 1T8NA 4TT3D 4XBDA 6CHAC 3K6YA 1ESAA 3FVFB 2JH5D 3T26A 4MNWA 1TLDA 2A4GA 4CRBA 1C1PA 4ESTE 1LPKB 1G9IE 2PP6A 3A84A 2DUCA 2BDCA 2P93A 4X2XA 1GJDB 2CHAC 2CHAB 1A3BH 4FETA 2KCYA 3ZZCA 4FUIA 1O32A 3EA9A 2ZQ2A 1RJXB 7GCHG 2IOTA 2HNTE 1FXYA 3E0NB 2FS9A 1NRNH 1O39A 1FONA 1KDQB 1NFXA 1E1RD 4BAKB 1VITG 2F3CE 3DSGA 1G2LA 3Q3KA 3RXEA 4IGDA 1OWKA 1QBOA 3E16B 1MABB 5H4IB 1HIAA 1O36A 1SGPE 1W10U 3GOVB 3KYFA 6LPRA 2RFKC 3MQKC 1CA0C 3OTJE 3W95A 2JOPA 1GMHF 2J38A 3SJ8A 1SQAA 1ZHPA 4RN6A 3SU4A 2VGCB 1FIWA 4MPVA 5HKKD 2O8UA 4GAWA 4BXWA 2XOKD 3D62A 1ZJKA 4JCNA 1GCTB 3TJNA 4KTSA 1QIXB 1XXFA 2PKSC 2GJGA 3OSYA 2C90B 5AF9H 1L4ZA 1CT0E 4P00A 1DWDH 1F0UA 1MKXH 2B9LA 2FDAA 4AFZA 2DE9A 2AGIX 2G51A 5JPMH 1GBMA 1Y3WA 1P2IA 3BTTE 5C5OA 3ZZ3A 1SLVB 3LIWA 2J98B 2H1UA 3RXHA 1GI2A 1W8BH 5DGJA 1WXRA 1QR3E 3RXQA 3ZZDA 1W7XH 4FVBA 1LHCH 3SU6A 1ZRBA 1V2RT 4Z1MD 1V2KT 1N8OC 4X8SH 4ABGA 4WMEA 3R0FA 3A89A 3RP2A 2HPQH 1ZTLA 2XWBI 1ORFA 1HXFH 1UVOA 3NCLA 2TGDA 4Y79A 1TB6H 5TCAA 3UQOA 3TNTA 1E37B 1BB0B 5FL7D 1O2SA 3O8DA 1UVSH 3RXDA 2VBCA 1C5TA 2ESTE 2J9NA 1V2PT 1ETSH 3FP7E 4DVAU 1GG6C 1VGCB 2TPIZ 1GCDA 1T8LA 2R2MB 1P2NA 2AIPA 1ANDA 1HIAB 4GHTA 3SV2H 1SG8B 3PV5A 4LXBH 1IQGA 3FO8D 2LNCA 3SV8A 2OD3B 4LOYH 1C5VA 1V2NT 2P94A 4FUCA 1TGTA 1GHAG 3BSQA 4R8TB 5JFBA 3BG4C 4TYDA 1EOLA 1O2UA 1HPGA 1AI8H 4BANB 3QK1A 2GDDA 1XUGA 2RA3A 3SUDA 4OGXA 1C5NH 1A4WH 3HKJB 4NA8A 3SJKA 2BQ6B 3SBKA 1TRMA 1O5BB 1JXPA 1L0ZA 1C4V2 2QC2A 1T31A 3LJOA 4UFGH 4DCDA 1V2LT 1H9IE 1QQ4A 3QZQA 3RM2H 2M2AA 3GY6A 4Y7BA 1AN1E 2IPHA 1EZUC 2PWXA 2KAIB 2SNWA 2PFEA 1ELTA 2ODQA 3UREA 2GX4A 3UNRA 1DWCH 2VIPA 1O5EL 3TLOA 3RC6A 1YPHE 3ELAH 1C1QA
chains in the Genus database with same CATH topology
4OS7A 3U9AH 3F68H 2ANWA 1G3CA 1IQJA 2UUKB 1DLEA 4I8HA 1DX5M 1MU6B 1Z1IA 3ZYEA 1HAYB 2ZIQH 2C93B 4NIXA 3C27B 2O8TA 1TNKA 2BD5A 5AVDA 4F4OC 1AD8H 1GVKB 4KTUA 4JMYA 1MKWH 4AFUA 1O2MA 2FS8A 1O5FL 4ZROA 1GMCF 2VJ1A 2AFQB 2HGTH 1TRNA 2QAAA 4O3TA 1KXBA 1O3IA 2ZGBH 2ZO3H 3QUMP 3O8CA 1SVPA 1TIOA 1D6RA 3BTFE 2FLBH 2FIRH 4IW4E 2BLQA 1F92A 2AERH 3RC5A 3F9FA 1O2PA 2AH4X 3PO1B 1O3LA 1QL7A 1HJAB 1XVMA 5FX5A 1QRWA 1K1IA 4K1SA 4MPXA 2PUQH 2WV4A 1GDNA 5K7RA 1P2KA 1VITH 1S82A 1M9UA 1OWIA 5ESBA 4DURA 5EW2H 1SI5H 1OWEA 1BRCE 5GDSH 2GDEH 2EI8A 2QXHA 2VIVA 4KTCA 5G4BA 5FPTA 4WWYA 1C5RA 1TX8A 1GL0E 1RTLA 1O2XA 1ZHMA 3V12A 1FY5A 1GHVH 1IQFA 2VINA 1GI0A 3UWIA 1AFQB 3GCTF 1FY1A 1SQOA 4CH2B 1YCPM 4CR9A 3Q77A 4IBLH 3AVZA 3BEFB 1GJ5H 2J34A 2GVFA 4H4FA 3RXCA 1YPJH 3QO6A 4B74A 4X8TH 1SOZA 1HAVA 2P3FH 1SSXA 3ATLA 1TABE 4OGYA 4JZDH 1T32A 2TGTA 3ZZ6A 3MNBA 4B73A 2BD9A 2FI3E 4XDEA 1ZPCA 2ZECA 1TOMH 4B1TA 4NWKA 2BZ6H 2UUJB 1O30A 2ZWLH 4B71A 1P57A 1P2QA 4IC5A 5I46H 1GI6A 1YPMH 3MH6A 5BPEA 3SGQE 2FP7B 1CA8B 2WPHS 4K2YA 1QGFA 1QA7A 2Z3EA 1BJVA 1BJUA 3MNXA 3QN7A 4OS6A 4X1NU 1HAIH 1G30B 1GI3A 2BVRH 4TWYA 2NU4E 4VGCC 4YOGA 3MO3A 3DFJA 1FDPA 2GTBA 4UE7H 3LOXA 2G52A 3BF6H 4O3UA 2R9PA 1EB2A 1YPEH 1YLCA 2GZ8A 3H5CB 1E36B 2QXGA 1A1RA 3U98H 1O3FA 2FTMA 3LGIA 1CQQA 3T62A 4X1PU 1BHXB 1YCPK 2QF0A 3VXFH 4MQAA 1VCPA 1ABIH 1ELVA 1GDUA 1P0SH 1P3EA 2D2DA 1C1VH 1GBDA 2WPKS 1XUFA 1Q31A 1ZGIA 1IQMA 1S6FA 1TBQH 2PSYA 1GBLA 1O35A 3ODDA 1UK3A 1V2MT 3MNCA 4WMDA 3IITA 1TOCB 1TGSZ 2BDHA 2FOMB 3TVJB 3PTBA 2F9OA 2CXVA 4ABFA 5A8ZA 3HPTB 1GI9B 1W11U 1HAVB 4AYVB 2TBSA 1G36A 4NFFA 1SGTA 3RC4A 2FEQH 1UMAH 3TK5A 1CGIE 3QZRA 2WYJA 2AS9A 2YOLA 4E06H 3FFGA 3ATKA 1P57B 3TGJE 1TA2A 3ZZBA 4JK5A 4TY6A 2R3UA 1W13U 2VIWA 2DE8A 1TX7A 3LGWA 2FODA 2XXLA 4ISLA 3JZ2B 1C5OH 4BTTB 5JYIA 3UWJH 4ZXYH 5CHAB 3RXSA 1HUTH 3SQHE 1K1LA 4AORA 3SUFA 2BD8A 2OBQA 2Y81A 1LHEH 2GKVE 2XC0A 4FU7A 5HMAA 1BIOA 1T4UH 1BMMH 1NRRH 4I8GA 1C1TA 4A1VA 3RXRA 1PPHE 2CF9H 1ZMNA 2H5CA 1EAIA 2JETC 6GCHG 1QB9A 4NA7A 1BZXE 3NWUA 1EJNA 1YBWA 5C5NA 5T6DA 4MG3A 3A87A 3UNSA 1U6QA 4YT7H 1BTHH 1P01A 3KQEA 2V6NA 1TAWA 5JBCS 1E34B 4CRCA 1P9UA 1RS0A 1DUAA 3VXEH 2GV7A 1PQAA 2ZGXH 2W7SA 1A0HB 2Z3CA 3UFAA 1WTGH 1ANCA 1RIWB 1MZAA 1J16A 1NS3A 1GVZA 2HRVA 3GY7A 1TGBA 2F9BH 3F1SB 1GJ7B 1K1JA 1W7GH 2QY0B 4CRDA 5LPFA 1O2GH 1XX9A 1MBQA 4YLUA 3MU8A 3W94A 2WPJS 1Q2WA 3ODFA 3GCHC 1NRSH 4O03A 3RLYH 1C9PA 1PYTC 3PLKA 4GPGA 1PPCE 4YZUA 4UONA 1JMOH 4A6LA 2CMYA 2FX4A 2VH0A 3MMGA 3E1XB 1HRTH 3PMJA 5GCHF 2BY5X 3D23A 1OOKB 1C2MA 1EOJA 3MWIU 1VJAU 2VVVA 2ZGJA 5ESTE 1KYNA 2BXUH 1ELGA 4Y0ZE 1BMLA 1A3EH 1JIMA 3C1KA 2A5KA 2A5AA 4MNYA 1GBAA 2A45B 1VR1H 1C2JA 3M35A 1C5YB 4K1EA 5EXLA 2BDYA 3K2UA 3Q3XA 1WOFA 3ZVGA 3MU5A 1NFUA 1H8IH 3ESTA 3U8TH 4JZFH 5BRRE 1GHBG 4WVPE 3B8JA 5C1UA 5C2ZA 3AAVA 1Z1JA 3BTQE 2QGRA 1BBRE 2Z94A 4ABIA 1TNLA 3ZYDA 5IDKA 4OS5A 1HAPH 2AMPA 2Y7XA 1TNHA 3V3MA 1RXPA 3UPEA 4K60A 3EA7A 2O8MA 3MHWU 1GHWH 1E38B 1KSNA 5A0BA 2BVXH 1C2FA 3P8GA 4X1RU 2VB0A 3RUOA 1SC8U 4BTUB 1TMUH 4FXGH 2B8OH 3UTUH 2SNVA 2ZF0H 4AGJA 2UWOA 3M37A 4UFEH 1CT2E 3RXJA 1GHXH 1LVMA 2SFAA 1TNJA 2SGPE 4YM9A 1TGNA 1YKTA 2SGDE 2OTVA 2IN2A 1NU9A 1VJ9U 1UTLM 1O2KA 1ZR0A 2VVCA 1LMWB 3SI4H 1TPSA 1K1OA 2BM2A 2ZA5A 3O8BA 2ZFTA 3U8RH 4ZHLU 1FZZA 1ZLRA 4K3JA 4FUHA 1QHRB 3HK6B 4AX9H 1THRH 2FM2A 1TMBH 2G00A 4WXVA 3UUZA 3A7ZA 3TGKE 3FP8E 1V2VT 3F9GA 1MQ5A 3O8RA 4JZ1A 1G32B 1QURH 1W2KH 5PTPA 1AQ7A 3L6PA 4FU8A 2A31A 3SV7A 1A5HA 1P11E 2ZEBA 4NSYA 3T5FH 3VGCC 5HM2A 3ZVFA 1JIRA 3PROA 5K0HA 1MD8A 1D3QB 1C1MA 2C8YB 5FX6A 5DKMA 1FY4A 2F9PA 6CHAB 1CE5A 1SR5C 1MZDA 2XBVA 1EATA 1GMDF 3GCNA 3CENA 1Y3XA 1O2ZA 3MFJA 2YNBA 1PPEE 2STAE 1C1UH 4X1SU 1SQTA 4GCHG 1GI4A 3STIA 2C4FH 1YM0A 2Z7FE 1UCYH 3UNQA 2ZTYA 4OS1A 5FPYA 2W7UA 4FUEA 3UR9A 3PTNA 4A5TS 1BOQA 1KLJH 2I6QA 1HAXB 2GT7A 2K1QA 2CN0H 3PMBB 1LHGH 3MOCA 2FESH 1GGDC 1ZTKA 1GGDB 2BZAA 1K1PA 1CHOG 5T3HA 3M3TA 1D9IA 4U2WA 3E6PH 4A7IB 1IQLA 1KIGH 2ULLA 3L33A 1OWHA 2F9UA 1B0FA 1CA0B 1LO6A 3CP7A 3E8LA 1Y3VA 1YPGH 3I77A 1HAHH 5A8YA 1WTHD 3QTVH 3QLPH 1L2EA 2PKSB 1TE0A 3H7OA 3D49H 5EOKA 5DJ7A 3MU1A 2G4TA 1CHGA 3M36A 4NIYA 2XC4A 1NTPA 2XBXA 2BOKA 3N7OA 1TYNA 1H9LB 4U30A 5E2PA 5LH8A 2F9VA 4FVDA 1AE5A 1NFWA 1WSSH 3GDUA 2KAIA 3MH4A 1YGCH 5EG4A 1OP2A 2TGPZ 4X2VA 1DWEH 1UTOA 1TWXB 1ZYOA 1SMFE 1ARCA 1ZRKA 1F5RA 3AASA 2ZFFH 1LVOA 5FBEA 3KGPA 1N8OB 4NZQA 1ZSLA 2BD2A 1HB0B 1O31A 4CRAA 1IAUA 1EAWA 3CS0A 1SGYE 2SGFE 1DXPA 1EP5A 1GMCG 2D1JA 2OC8A 4CBOA 1V2OT 3ATMA 1BITA 5EU8A 1V6DA 1DFPA 1BA8B 3SHAH 2R2WU 1OSSA 2PTNA 1SLWB 5HXFA 1KLTA 2BQ7B 5C1XA 1EJMA 4ZKNU 1C5PA 1GG6B 2ZFQH 2VIDA 1C2EA 1KXCA 4INLA 1C1SA 1A61H 2XNIA 4NCYA 1DY9A 3S9BA 2BY8X 1PJPA 1Y59T 1QBNA 4BAOB 1OX1A 2W26A 2ZFSA 4AB9A 1PQ8A 3ZV8A 2ZI2H 3GCTG 3A8CA 4ISNA 4NWLA 3BG4B 1UHBA 3Q3YA 4CHAC 2OLGA 4CHAB 1WYKA 1FPHH 2GCTC 2RA0A 3P6ZB 2ZHEH 1XUKA 3SNBA 2XCNA 5GIBA 2FTLE 7GCHF 3A82A 1GJCB 1BUIA 1Z8RA 2VWLA 3VB3A 4NIVA 4D8NA 1GBJA 1O0DH 3ZVCA 2OC7A 4AOQA 2GZ7A 1AB9C 4AN7A 1AB9B 3BTME 1AO5A 1GJBB 2BDAA 3HATH 4JYVH 3MH5A 1FY3A 2A4RA 3MO9A 4K69A 3BEIB 4BNRA 1BY2A 2VIOA 1MTNC 2QCYA 1DUEA 4FUJA 1LTOA 3QGJA 2ZDAH 5CE1A 1O2WA 3RXMA 8ESTE 3MI4A 1BBRH 2FX6A 3S9CA 1DDJA 2FWWA 1EUFA 1S0RA 1VCWA 4A92A 3T2NA 2XW9A 4Y8YA 1QNJA 1QQUA 2Q6DA 3V7TA 3SORA 5DK1A 5EXNA 1OP8A 1ETRH 4I8KA 2V3OH 4SGAE 4JZIA 4H6SB 1BRUP 1V2ST 1DOJA 1SGEE 3BN9A 1SB1H 3IG6B 2HNTF 1UVPA 1FNIA 3AW0A 1HAGE 4THNH 4NSVA 1P8VC 2A7CA 3I78A 1H1BA 1FY8E 3SGBE 1UHBB 5IYTA 2FLRH 1F7ZA 1P03A 4X8VH 1O3OA 3A85A 1G37A 1XM1A 9ESTA 1AUJA 4NG9H 2ZDNA 2O8WA 4X6PA 4I8LA 4WJG2 3M7QA 3P95A 3EA8A 5C20A 2XTTB 4ZAEA 3RXPA 4IN2A 4MLFB 4ZKRU 1AWFH 3MYWA 1S81A 2YNAA 1NN6A 2P59A 4K8BA 5A0CA 1C9TA 1DS2E 1EZQA 1AZZA 2Q6GA 2ANMH 1MMJN 1O5GH 2G81E 1SGFA 3PWBA 1O2RA 3BTKE 3SNCA 2Z3DA 3M5NA 5L2ZH 1B5GH 4KELA 2GMTC 4RSPA 2G8TA 3LC5A 4FU9A 1UTJA 4DG4A 1GHAF 2C8WB 4X1QU 2V3HH 3SN8A 3RXUA 3EQ0H 2A2QH 3T29A 2OC0A 1SGCA 3PMAB 2PR3A 3RXKA 2EI7A 1OS8A 3SQEE 1SBWA 2HPPH 3U69H 1MCVA 1P06A 1O3AA 2CV3A 1EB1H 1C5WB 4J2YB 4DT7B 1GJ8B 1FJSA 2OUAA 1CSOE 1GBBA 1QTFA 1BQYA 1NFYA 5AHGH 2WPMS 5HYOA 5LPRA 5C67A 2W5EA 1BTUA 3PLBA 4TWWA 1SPJA 4HZHA 1DPOA 4ZHMU 5C1YA 1OWJA 1PPZA 2H2ZA 2NU1E 4Q7ZA 4VGCB 1C2HA 8GCHG 2GCHF 2VVUA 2H9TH 1YLDA 3BTGE 1NPMA 2HNTC 1BMNH 1CT4E 1O3HA 4MPUA 4LZ4B 3E0PB 3TIUA 5FBIA 2P3TB 4BXSA 3GISB 4D76A 2ANYA 3HK3B 1A5IA 2Q6FA 4NFEA 3A80A 1ESTA 4X2YA 2ZHDA 1UCYE 4XBBA 1ID5H 2G5NA 2P8OC 4Y76A 2FYQA 5C3NA 5JDUB 4FUGA 4Y10E 2O8LA 4CRFA 4BAQB 5I25A 3GY3A 1IQIA 3VB6A 1TBZH 2UWLA 3LGYA 1C4U2 3SHCH 1E0FD 4SGBE 2AMDA 1NU7B 4E7NA 1FMGA 3I29A 1C5UA 1C5ZB 3LC3A 1T4VH 1XVOA 1TX6A 2UUYA 1BT7A 4ABAA 1KXDA 3H7TA 1JBUH 1AIXH 3LGUA 1KXFA 2A1DB 3ZZ8A 2Y6TA 1T8MA 4ZXXH 1NY22 1TPOA 4Y11E 4AGKA 2P95A 2ZTXA 1C1OA 2PHBA 5B6OA 1CBWC 1BCUH 4BTIB 1CBWB 1D4PB 1F0TA 1NT1A 2A32A 1Z6EA 3HKIB 4KKDA 3NUMA 2VH6A 4FUBA 1UTNA 1FAKH 2AMQA 1B0EA 1D3PB 4WMFA 1O3KA 1O5AB 3ZVBA 1VZQH 4YT6H 1CGJE 1Z8IB 3DA9B 2A7HA 2NWNA 1JRSA 1P04A 2ZGCA 1OYQA 3A83A 3GY8A 3RMLH 1LKAA 3EAJA 4U01A 1O38A 3M5OA 4Q2KA 5ABWA 1SOTA 2XWAA 4NZLA 1GHYH 3KQBA 3LGVA 1Y3UA 1W12U 1RD3B 1C5LH 1OYTH 2JETB 3UR6A 3M61U 5DP5A 3SJOA 2C8ZB 2FO9A 1HV7A 1L4DA 1NO9H 1O2JA 1O3DA 1O3JA 1DT2A 3QDZB 3RXVA 3AAUA 4X6OA 1QJ1B 1MTVA 2FMJA 2Z9IA 2ZNKH 3S9AA 1AVWA 3RU4E 3M5MA 2Z9LA 2HLCA 2H9EH 2V0BA 1K1NA 1TMTH 3HGNA 3NPSA 3VFEA 3UIRA 3KQCA 1MKXK 3ZZ9A 1GHZA 3PV4A 2BXTH 3RXOA 2HWLB 1V2UT 4ABBA 4K5ZA 4ZUHA 1ZGVA 1O5EH 3GDVA 4GUXA 1T8OA 3GYLB 1DWBH 1PQ5A 1EZSC 2TRMA 3ZZAA 4WF8A 4JYUH 1WQVH 3A86A 4YLQH 1G2MA 1AMHA 1K28D 2PGQB 1W0ZU 3GCHB 2BLWA 2ODPA 3FP6E 4I31A 3RU4D 2ZHFH 2BVSH 2BD3A 5L2YH 1PPGE 2BY7X 3TJVA 3KNXA 1V2TT 5E2OA 1S85A 3KF2A 4JYTA 1YPLH 1SG