2XRCA

Human complement factor i
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
548
structure length
461
Chain Sequence
b'EDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAMDAERRRIKSLLPKLSCGVDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGQWGEVKLISNCSKFYGNRFYEKEMECAGTYSGGPLVCMDANNVTYVWGVVSWPEFPGVYTKVANYFDWISYHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN COMPLEMENT FACTOR I
molecule tags Immune system
publication title Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
pubmed doi rcsb
total genus 92
structure length 461
sequence length 548
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.45: Complement factor I.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00089 Trypsin Trypsin
A PF00530 SRCR Scavenger receptor cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xrcA04
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 2xrcA03
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2xrcA02
2R0LA 3AVZA 4MG3A 3ZVEA 4KTCA 1CGHA 6LPRA 1KLTA 2FX6A 1EP6A 1RRKA 3DFJA 1S82A 1AVWA 1HAVB 1PPFE 1IHTH 2VWOA 3RC5A 2D2DA 3A86A 2BTCE 3GY3A 1GJBB 4SGAE 6GCHF 3TJUA 3MH4A 2ODYB 1V2LT 4CRFA 1AVXA 6CHAB 2FIRH 2A7HA 3SGAE 2BVSH 2XC5A 2GKVA 4JCNA 3MTYA 1C2MA 3HKJB 3S0NA 2B8OH 4D7GA 1O3AA 3RXPA 1G37A 1YPGH 1ZMJA 2CGAA 1KLJH 4XOJA 2V6NA 1IQHA 1ZMLA 4HGUA 2Y81A 3RXVA 2P6AC 3MU4A 1RD3B 1GJ9B 3ZZAA 1K1PA 5DP9A 3F9HA 1LR9A 4TWYA 2R3UA 1DSUA 4FUJA 2A2XH 1W8BH 4ABAA 1ANEA 2EI8A 1EAXA 2H9EH 3SGQI 2ZU2A 4LOYH 2A1DB 3TGKE 4HTCH 1C2EA 1VCWA 1YPKH 3GDUA 4X2WA 3BN9A 1QBNA 1N8OB 2BDBA 3NWUA 1G2LA 1EOLA 5EPNA 3SUFA 2ZHFH 2GVFA 4Y7AA 1GHBF 1JWTA 2BDIA 1Z7KB 3PROA 2FOHA 2ZU4A 3MH7A 2WUCA 1NU7B 2Y82A 1TBQR 1KXEA 1F0RA 4I8JA 2BD2A 1FY5A 2FOBA 2LPRA 4X6OA 1PQ7A 3A7YA 2SGFI 3UWIA 1ELGA 2R9PA 1O33A 3SJKA 1O5EL 5HM2A 2GMTB 2CHAB 1LR7A 2CJIA 3TIUA 1QB9A 4BTIB 4O03A 2AMPA 3ATMA 1SSXA 3K65B 3MNXA 3VFEA 5DO4H 1BMLA 2O9QA 3CS7A 1ZZZA 1SGDE 1XXFA 1LDTT 1Z8IB 2RCEA 4ZROA 3LOXA 1WQVH 1SGQE 1TWXB 2A5AA 1P2IA 3OSYA 2FLBH 4GHQA 4JMYA 4TY6A 2TGTA 1P8VC 1MKWK 3E0PB 3MU0A 3S9CA 1HJAB 1BBRH 1E38B 2ZFTA 1GL0E 3UQOA 1TIOA 1BT7A 1O2SA 1XVOA 1MBQA 2GGVB 5T3HA 2RDLA 4ZXYH 1AMHA 1UK2A 2FOEA 2PKAA 5GCHG 1T8LA 4IW4E 1LPZB 1UTJA 4Q2KA 2Z9IA 5JBAS 3EA8A 2EA3A 3E90B 4HFPB 3GDSA 3SV9A 1S5SA 1AE5A 2A45B 1U6QA 2F9PA 1N8OC 2XBVA 4Y6DA 2GZ8A 2AEIH 5F8TA 3PV4A 1HXFH 4AOQA 1TPAE 4YOIA 1DPOA 3F9EA 1NFXA 1J16A 4B76A 5A2MH 1Z8RA 1SGPI 3TJQA 4NA8A 2JH6D 2PKSC 1RFNA 2VH6A 5AVDA 4XBDA 1QB6A 5BRRE 1MUEB 4O3UA 2HLCA 3SJOA 5DG6A 2JOPA 1NY22 3BTGE 4MQAA 2I6QA 1O3DA 1F5KU 2K1QA 1BDAA 1TPPA 2QAAA 3M3TA 3NUMA 1OP2A 1OPHB 2N52A 2NWNA 2WYJA 1YLDA 2YNBA 4WH8A 4CRDA 4AYYB 1QJ7B 3SU1A 1C1UH 1SR5C 2G5NA 4UEHH 4IN2A 2PKAB 1TBZH 2A7JA 2F9OA 4IS5A 5DP7A 2Y5GA 3RXSA 1PQAA 5J4QA 1L4DA 4DVAU 4X2YA 2ZTZA 1QGFA 1AN1E 5GIBA 3SV6A 3TITA 1LHFH 4Y10E 1Y5UT 1ZPZA 3BV9B 1YLCA 4UFEH 2Z9KA 1HYLA 8GCHG 1BRBE 5A09A 1F2SE 1KY9A 4SGBI 1UVOA 3T5FH 4JZDH 1DANH 5K7RA 2VH0A 3SQEE 1QBOA 1DLEA 1NO9H 5B6OA 2PTNA 1O3LA 1QBVH 1L1GA 3SU5A 4FU7A 1GJCB 1V2RT 1AI8H 4I31A 2ZWLH 2A7CA 1HBTH 2IPHA 1QNJA 1K21H 1YPHE 2BX3A 2G55A 2NU1E 1OVOA 5DKMA 2KMOA 1H9IE 1T31A 4K5ZA 3ZYEA 2ZGCA 2WYGA 3B4VC 1ETTH 2ZQ1A 2C93B 3KQCA 1A0JA 3F6UH 5DP6A 1OSSA 2QIQA 4PROA 4ABBA 1OWJA 2FXRA 4A92A 1A0HB 2GKTI 1O2UA 1IQKA 2NU0I 1E37B 5F6MA 3MNBA 1P3CA 2ZTXA 1SB1H 4X6MA 4WMDA 1A5IA 4D8NA 2QV1A 1GBDA 3GCNA 3STIA 2WPHS 4A7IB 1WAYB 2JZMA 1G2MA 1QL9A 1NRSH 1O32A 1Q3XA 2CMYA 1FLEE 1E36B 2BUSA 2GCTC 3A85A 4MPVA 1C2IA 1C2DA 4ZMAH 2BHGA 1TNGA 1UO6A 2ARPF 1C5ZB 1GMDG 4NIVA 1ZHPA 2NU4I 6CHAC 3GY7A 1C2JA 1HAYB 2F83A 2OLGA 4BXSA 1LHEH 2J38A 4R0IA 1C5MD 2Z3DA 1TQ0B 2GKVE 5T6DA 2A4RA 5HGGA 1HXEH 3QO6A 2ZF0H 5EU8A 3Q00A 1OYVI 1J14A 5A8YA 3SORA 5FX6A 4Y76A 1SGDI 3RC6A 4NIWA 5C5OA 1JOUB 1TPSA 1UMAH 1DXWA 2BD8A 2I6SA 1O2HA 1RIWC 1ABIH 1C5VA 1H8DH 2O8LA 3SUEA 4ABIA 2XTTB 8GCHF 3PB1E 4A5TS 1THSH 3RXJA 1O2TA 2GP9B 3TK6A 1UUCA 4IMQA 1GBTA 5FPSA 2ODPA 1HAHH 1T4VH 4Z6AH 1HFDA 1KDQB 2VVCA 3U1JB 1BIOA 1E35B 1FXYA 1IY6A 3OU0A 8ESTE 3P8FA 3HPTB 1GJ4H 3Q76A 5EPYA 2G00A 2RG3A 2CV3A 3RXFA 1YBWA 3RXUA 1O2ZA 3MH5A 1ZJDA 1AKSB 7LPRA 4CRAA 5DAEA 1OMTA 7GCHF 2ESTE 3MYWA 1V6DA 3P95A 2ZGXH 1ESBA 3M5OA 2VJ1A 1F7ZA 1O2XA 1GCTC 3F9GA 1GBEA 3GY6A 2FM2A 4JYVH 1TMBH 3GYLB 4IC6A 2KMRA 5L2ZH 4JK5A 3HATH 3LGWA 4AORA 1YCPH 1OWIA 2ZDNA 2P3TB 3HK6B 4WF8A 4NWKA 1BQYA 1O37A 3LGVA 1SVPA 5LPEA 4IC5A 1ZRBA 1ZR0A 1GHYH 1K22H 2CN0H 3TPIZ 3RU4D 1J9CH 2DE8A 4ZHMU 5AF9H 1CT2E 2ALPA 3KF2A 2PV9B 1CVWH 1HPTA 4U2WA 1LR8A 2ZI2H 2BB4A 2A5IA 4YLQH 2BMGB 2Y5FA 2FOGA 2HRVA 1XUFA 3IWMA 1AB9B 3FP6E 1GJAB 4GUXA 4NCYA 4XFQA 5JYIA 1B5GH 5HYOA 1SGNE 4K60A 4AFZA 4B2BA 3PLKA 1C5QA 1QA0A 2VINA 6ESTA 1AIXH 1GJ5H 1P09A 5LH8A 4K1EA 1TMUH 1KSNA 3VB7A 2Q6DA 3M5MA 3ESTA 1PPCE 4KKDA 1DWDH 1CA0C 4ABGA 1Y3XA 1EPTB 1PQ5A 1J8AA 1ELDE 5T6FA 1O39A 1MQ5A 1W3CA 1SFIA 2LNCA 3BF6H 1DDJA 2VWMA 1GDNA 2XC0A 1G32B 4Y71A 4CBOA 1FUJA 1IQEA 4ISHH 3I78A 1C4V2 1O2IA 1UVFA 1CT4E 2SGPE 2ANMH 1W7GH 1YYY1 1VGCB 1NC6A 1NFWA 3BEIB 2PGQB 1ZPBA 2QC2A 1P05A 4GLYA 1SHYA 1O2NA 2M5TA 3VGCC 1YU6C 1D9IA 1SPJA 3P70B 1MTNB 4K8YA 2XBXA 1WCZA 1UVSH 2GCHG 3GDVA 1EJMA 1A4WH 2ZFRH 2Y80A 1TONA 5L30H 3O8RA 4LK4A 4D76A 3S7KB 1TRNA 2G4TA 4NWLA 5C2ZA 3SU6A 2J4IA 1O35A 1AGJA 2F9NA 2ZCKP 1DITH 4K2YA 2FYQA 2BQWB 1D3DB 1YKTA 1QQ4A 2A5KA 2ALVA 2JYYA 4ZKOU 3SU2A 1QIXB 1H0ZA 2GV6A 2Z9JA 2OQUA 3BG4B 4NZLA 2B5TB 2FODA 4DIHH 3U8OH 1D6RA 1O2MA 2NU2I 2YNAA 2ANWA 1HAVA 2WPKS 2R2WU 4FUEA 1O31A 3P8NA 1IW4A 3ZZBA 4WXIA 1CGIE 1PYTC 4Y8XA 1O2KA 4Y11E 1NT1A 2SGPI 1TRYA 3SV2H 2SNWA 1CE5A 4FUGA 4BNRA 4DY7B 4YOGA 1IQMA 3UFAA 2XBYA 1M8BA 3TNTA 1KYNA 5EQRA 4I8LA 3L6PA 3ZVFA 1M8CA 3U98H 1Z1IA 2OVOA 1OP0A 2ZIQH 1ETSH 2GMTC 1B7XB 5CE1A 1GBKA 1OWDA 1P2MA 4NA7A 3SBKA 3ZVGA 2Z9LA 1V2JT 5T6GA 3VB3A 2ZDLA 2WPLS 3IG6B 4K1SA 2P3UB 4IN1A 4CRCA 1GL1A 3NZIA 2ZDVH 1V2WT 3SN8A 1F5RA 1QRZA 4NFEA 1GI6A 1P10A 3LPRA 4M7GA 1TBRH 2BLOA 5FHTA 2PW8H 1C1OA 1V3XA 2ULLA 1GCDA 1LKAA 2Z7FE 1A5GH 4JZIA 1TGCA 1HRTH 3UREA 1UCYE 3ZZ5A 1DY8A 2HNTF 3MU5A 5DGJA 1QB1A 1UCYK 2BQ6B 1G3CA 3V3MA 1NN6A 1QY6A 2FOCA 2ZU3A 1YPJH 2GDEH 1CA8B 3QTLD 2VIQA 1H8IH 2CXVA 1EP5A 1AFQB 3T25A 1W14U 1FAXA 3V7TA 4I8KA 5FCKA 3FZDA 1CGJI 1GG6C 1EPTC 1K1MA 1EAUA 2VGCB 4X1RU 2ZGHA 3TLOA 3BSQA 2J9NA 3PWCA 1XUIA 1TGSZ 2FDAA 4ABJA 4DIIH 1CT0I 1W0ZU 1SGQI 2PSXA 1ZYOA 4B71A 2FPZA 2PUXB 4BAQB 1FPCH 1RIWB 3SGBI 2NU3E 1O2YA 4JZ1A 4E7NA 1R0RI 3ZVBA 1D4PB 3AAUA 3DUXH 1GJ8B 2BLVA 1LHDH 1MKXH 1GMHG 1GI5A 5C1XA 4Y8YA 1TGSI 1SGCA 3QK1A 4O97A 1LPKB 4UDWH 3RXOA 1C5LH 1D3TB 1NPMA 3TJNA 3KIDU 1D6WA 1O38A 2A31A 1GI8B 1GVLA 1P57B 4AG2A 2IJOB 3B23B 4H42U 1BTHH 1O2PA 1W7XH 3HKIB 2XRCA 1O5BB 3RXHA 2RA0A 1A0LA 1TNIA 3S69A 5I46H 4NFFA 1WUNH 4MLFB 2NU3I 4CBNA 1KDQA 1GHXH 1XUGA 3SGBE 4ISIH 5CMXH 5A8XA 1LVYA 3SGQE 3SNCA 1A7SA 3SHAH 3GISB 3MWIU 1FYBA 1ZTKA 5GPIB 4FUDA 2QF3A 1NFUA 3SV8A 3MHWU 4OGXA 3RXCA 2HPPH 1WOFA 3ZZ9A 1TGBA 1L1NA 1MQ6A 1VITG 5EXNA 1BJUA 2FS8A 1WBGB 3A8AA 3RXMA 3TU7H 2P8OB 2GTBA 1FJSA 3EA9A 2B9LA 3AW1A 3GCHB 3OY6U 1SBWA 4XSKU 1CT0E 2D26C 4ISNA 4YM9A 1OWEA 1S85A 4FU8A 4ABFA 4LZ1H 3KCGH 3LC5A 3D65E 1AO5A 2BZ6H 3ZZ7A 1ZSKA 1EJNA 2F91A 1O3JA 1LVMA 1ANBA 1JIRA 3ENSB 2ZGBH 4DCDA 3RU4E 2BLWA 1ELVA 2FMJA 4I33A 2FZZA 1MBMA 5A0BA 1CHOF 4WWYA 3BEFB 4WVPE 1O5FL 1VGCC 2KAIB 1SQAA 1C5YB 2H9HA 5C3NA 1GVZA 2Z94A 1HJAI 4FVBA 4THNH 1K1IA 1TURA 2RA3A 2KCXA 2NU1I 1V2UT 1GI1A 2VIDA 1P03A 1HDLA 1UTOA 1D3QB 1SGRI 2UWPA 5EXLA 4WXVA 1TUSA 2Z9GA 2HALA 4D9QA 1H1BA 5C1UA 3T28A 1P02A 1F0UA 4GCHG 1E34B 1MU8B 3GY8A 4E05H 3BG8A 1DT2A 3JZ1B 1VCPA 2GCTB 4OS6A 3UNSA 4SGBE 3NPSA 2QQCA 1INCA 1CBWC 1C1RA 3TVJB 1N6YA 1P04A 3TK5A 3TJVA 3DD2H 3A8DA 3GCHC 3A7WA 2AYWA 2JP0A 3ZZ3A 1HAXB 1Y8TA 1IAUA 2F9BH 2P3FH 4OGYA 1GDUA 4KELA 2OP9A 3SQHE 2BD3A 2VVVA 1JXPA 1G3BA 3O8BA 1NZQH 1BITA 4WMFA 1FY3A 2NU2E 1UK3A 4ZAEA 3MNCA 3UQVA 4NZQA 1UJ1A 1HIAB 3Q77A 1O3GA 2UUKB 1KTTB 2TBSA 3A80A 3ZVDA 1RTKA 3CP7A 1ZGIA 3SNDA 2A0QB 4TPIZ 1GHAF 4Y0YE 1C9PA 3VGCB 2H5CA 2ZKSA 3BEUA 2JA4A 1A3BH 1AZ8A 3LJOA 2HGTH 2B0UC 2ZHDA 2ZA5A 4AFSA 4O9VA 3EE0B 2EEKA 1DFPA 2XCFA 3AW0A 3W94A 1ZTLA 1HAZB 2UUJB 1FDPA 2WPJS 1AU8A 4K69A 3EA7A 2WV4A 2AGIX 1QR3E 1GHWH 1RXPA 1C5RA 4FUHA 2OD3B 5GXPA 3PYHA 1UHBB 1A46H 4BAMB 3ODDA 2BQ7B 5PTPA 1VITH 2QXGA 2OXSA 3DT0H 4AB9A 1DWBH 2PGBB 1PJUA 9ESTA 1ZSJA 2W3IA 1CT4I 1ANDA 4CRGA 1PPGE 3EYDA 8LPRA 1E0FD 1SLUB 1W0YH 1GBCA 1OMUA 4CH8B 1BHXF 1L2EA 1AKSA 3RU4T 4GAWA 2F9VA 1C5WB 1GBAA 2QXHA 1CSOE 2Q1JA 1HLTH 2XBWA 2ZDAH 3ZZDA 2ZCHP 1DUEA 1YPEH 4Q7YA 5A0AE 1S84A 1YPMH 5EOKA 1QTFA 3FFGA 4UE7H 2V0BA 1OS8A 4OS1A 3SW2B 3I29A 1A61H 3LONA 1UVTH 4GVUA 1SGNI 2F3CE 2OC0A 4TPYA 3D62A 1BBRK 3NK8A 5C67A 1PYTD 3A89A 4B74A 1TX7A 1OX1A 2H6MA 1GGDC 4TY7A 2BDYA 1YF4A 1TAWA 1QL7A 1C4Y2 3K2UA 3PLBA 2GV7A 3VB6A 2SGEI 3GY2A 2ZDKA 3QGNB 4U32A 5ESBA 1K2I1 2F9UA 2FO9A 2HPQH 2ANKH 4BOHA 4LZ4B 1SGYE 3KN2A 1YTPA 3U9AH 1H4WA 1SLWB 3QTVH 2TGAA 4UD9H 3GY4A 5C1YA 4E7RG 4FU9A 1AB9C 2XXLA 2OTVA 1OYTH 3STJA 3VB5A 1GBMA 1V2KT 4MPXA 4ABHA 1TALA 1X7AC 3F1SB 4XE4A 1G30B 1WV7H 3ZVCA 5LGOA 1EUFA 4Z0KA 3RXGA 1DICA 1DWEH 3E1XB 4BAHB 4B2AA 2SGDE 1BA8B 3C27B 1S81A 5SGAE 3QUMP 1HPGA 1B0EA 3BG4C 3A87A 2KMPA 1TIHA 3MI4A 1BUIA 2AMQA 5DPAA 1TNLA 5JBTA 3TNSA 2OC8A 2A4OA 1PCEA 1YCPM 1TFXA 3TK9A 4I8GA 3V0XA 5EQSA 2C8XB 2QXJA 1LVOA 5EXMA 2BVRH 2ZPQA 1ELTA 2AGGX 1BHXB 3UR9A 1BTUA 5F03A 1SMFE 1GGDB 3LGIA 1ZTJA 3MU1A 3W95A 2XC4A 3LKWA 1W13U 1AVGH 4BTUB 2ZC9H 1O3HA 2ZHQH 3A7VA 1TABE 2C8ZB 4JK6A 1K1NA 3P6ZB 1HJAC 3H7OA 1C1NA 3RXEA 3URCA 1CO7E 1CU1A 3RMOH 1ZSLA 5HXFA 2W26A 3TGJE 1NRNH 1KLIH 1ELBA 1GBFA 1TA6A 3M3VA 2BD9A 5JDUB 1Y1BA 3TGIE 2JH5D 1ZHMA 1FV9A 1C1WH 2BXTH 2ZHEH 2NU4E 4GSOA 3RM2H 1W10U 3ATWA 1S83A 1B0FA 2HVXA 1W12U 4X1PU 1TNKA 4RSPA 4XBCA 4U30A 3CENA 4FUFA 5L2YH 1XXDA 1HAOH 2EI7A 3QWCH 3BTFE 5FXLA 3GCTF 2CF8H 3OYPA 2VGCC 2CHAC 2SGQE 1Y59T 2STBE 2UWOA 1Y3VA 2Z3EA 2CF9H 1LQEA 3EGKH 3M37A 1YC0A 3ODFA 4QT8C 8KME2 5H4IB 4ZHAA 1IQLA 1ARBA 1FAKH 1O2QA 4ISLA 4YZUA 1L0ZA 1IOEA 1CE3A 1AFEH 1RGQA 3RXLA 4VGCB 4X8VH 4Y7BA 4TYDA 2C3SA 3SUDA 3U8TH 2AFQB 1QQUA 1ETRH 2BDAA 3K6ZA 3SO3A 1O2LA 1KXCA 1AUJA 2FOMB 4JYUH 2OUAA 1AD8H 1GG6B 2GKRI 1F92A 4ZXXH 1ARCA 5C20A 2N71A 3A7TA 3ATLA 2VU8E 5DP8A 1C5NH 1MAYA 4BTTB 3UIRA 1V2PT 2UUFB 5E0GA 1ZGVA 5CHAB 1O3NA 1NS3A 5TCAA 1AE8H 1K1LA 4NSVA 3U1IB 1DLKB 3RC4A 4A1XA 3T62A 1K28D 2GT8A 2VIWA 1O5AB 1OWKA 2VWNA 1XKBC 1V2NT 4TWWA 2AIQA 4YT7H 4MNWA 1A1RA 1HCGA 1O2OA 3BTQE 3G01A 4KP0A 3UR6A 1MAXA 2D1JA 4X0WU 1C2KA 1GHZA 2PKSB 3RLYH 3DA9B 1EKBB 2AERH 1HGTH 3A82A 5EGMA 1N13A 1EZQA 2GZ9A 1GMDF 4NIYA 4VGCC 4K3JA 3QZRA 2VB0A 1CHOG 2HWLB 5ETXA 5EG4A 1GI7B 1MTNC 1O3CA 1V2QT 2G51A 2G52A 3NCLA 1KXDA 2ZDMA 2FTMA 1NUBA 3O8CA 1YPLH 1KXFA 1THPB 2Y6TA 1EAIA 1JRSA 1ANCA 2SFAA 1K9OE 3KQBA 4WH6A 2J94A 1P57A 2FLRH 5E8EH 1MZAA 3TH2H 3RP2A 4MDSA 4RKOB 1UHBA 3FANA 5J4SA 4B2CA 3UTUH 5ABWA 3SI3H 3ITIA 1FZZA 3GOVB 1FNIA 2FOAA 3P8OA 5EQQA 1A2CH 4BAOB 2ODQA 3UOUA 3URDA 1O5CB 1C2GA 2FX4A 2XWAA 4FVDA 5AFYH 3A83A 5FX5A 1Y3WA 1O30A 2PTCE 5ESTE 2BY7X 1FN6A 5FBEA 4BANB 1Y3YA 3BIVH 2H9TH 1AUTC 2Y7XA 1O5DH 1K1JA 1D3PB 1SGTA 2ZECA 2ZZUH 1OP8A 1G3EA 3CS0A 1C5UA 1JRTA 1NRPH 3RUOA 3E8LA 3HK3B 2SGFE 2BM2A 1TX6A 1GHVH 1Z8GA 3PMBB 4ASHA 2BLQA 5F8ZA 3I77A 2KAIA 1TOMH 3V13A 3M7QA 4BXWA 5I25A 1C5SA 3SI4H 1Q2WA 1KIGH 3ZZ4A 1TPOA 3LGYA 1ZOMA 2ZFFH 1NFYA 1O2VA 4KGAA 1BZXE 1O3EA 4HGCA 5DP4A 1HAGE 1GJ7B 1EX3A 2AS9A 3JZ2B 3SU4A 3SJ8A 2JETC 3TH4H 3UNQA 4INLA 1NU9A 2KMQA 2FS9A 1TLDA 2BDCA 5HM9A 2ZGJA 1MTSA 1XKAC 1BMNH 3KGPA 1LPGB 1P9SA 1IHSH 1G9IE 5LPRA 5A8ZA 2BYAX 1PPHE 4X8TH 2PHBA 4ISOA 4YT6H 1XX9A 1SC8U 1VJ9U 4X2VA 1FONA 1XVMA 9LPRA 1UTLM 1SGYI 3LIWA 2SGAA 1RJXB 1UK4A 1BTXA 5K0HA 2BY5X 2W3KA 3RM0H 7GCHG 1XUKA 5IDKA 4IGDA 2UUYA 4YLUA 3GCOA 1J17T 5JB8S 4I8HA 3FVFB 1EXFA 3KHVA 4X1QU 1O0DH 1T8OA 1CGJE 4OS2A 3GICB 5E0HA 2AH4X 1P2QA 3RMNH 2XYAA 3MOCA 2F3CI 4ZKRU 2GZ7A 1SOTA 3ZZCA 1FI8A 1GBLA 2QYIA 4UFFH 3E3TA 2BXUH 2A4GA 5EODA 3F68H 2R3YA 1P2JA 1BMMH 1LTOA 5A0CA 2XCNA 1NM6A 2OC7A 3AAVA 1P06A 3OX7U 2UWLA 2BX4A 2VNTA 3PMHB 5E2OA 3LU9B 3VB4A 2QN5T 3A7ZA 4AGJA 1GHAG 1QA7A 3TH3H 1V2OT 1DSTA 5GWZA 1L1JA 3UUZA 2O8MA 2R2MB 3NKKA 4A6LA 2BD7A 2QQDA 4MNXA 2AGEX 1Z1JA 2W7SA 1GCTB 4ESTE 4AZ2B 1UTQA 1Q31A 5LPFA 2OYAA 1PFXC 1PQ8A 5JFBA 3UPEA 1IY5A 1IQGA 3M7TA 1GBJA 3PO1B 2WPMS 2DE9A 4H4FA 1DS3I 1ACBE 1EAWA 1UVPA 3OY5U 1T8NA 1P0SH 3U8RH 2PLXA 5GDSH 3SUGA 3TJOA 4GPGA 2H5DA 5EW2H 1M9UA 2FI3E 2P59A 2ZPSA 1Y3UA 4XDEA 1H9HE 1WU1A 1C1QA 1QRWA 2ZO3H 2ZEBA 2BY9X 3SNBA 1EPTA 1F5LA 3VEQB 4AN7A 4F4OC 3ZV9A 1C5OH 1C5XB 3NXPA 2BY6X 1QRXA 2VIPA 1ZRKA 1PJPA 3RXIA 3A81A 3QTOH 2G5VA 2HOBA 4J1YA 4X6NA 1C9TA 1TNJA 5E0JA 1EASA 3Q3XA 1GPZA 1O3IA 2OINA 5IYTA 1GMHF 3ZZ6A 1IQJA 1C2HA 4MNVA 1MKXK 1A5HA 1BBRE 1P2KA 3M7UA 1C2LA 1P11E 1AWHB 4UFDH 2OC1A 2BZAA 3D23A 2BVXH 1RS0A 2IN2A 2QA9E 5L6NH 3SOSA 5EW1H 2PWXA 6GCHG 1BRAA 1C1MA 1TMTH 2O8UA 4UFGH 3ZVAA 1WTHD 3ATKA 1TBRR 1ZLRA 2QY0B 3BTME 3SZNA 1P12E 1HAPH 1ESAA 2VVUA 3MO6A 1HB0B 1O2RA 1GI4A 1SQOA 1ELFA 2QF0A 1TOCB 4JYTA 3LH1A 1HDTH 3PTBA 4AG1A 2SGDI 4CREA 1CHGA 2OQ5A 4MNYA 1OKXA 1O3MA 2STAE 2DUCA 4ZKNU 5G4BA 3R0FA 1VR1H 1N1LA 3D49H 3UOPA 1EZUC 1DY9A 1GMCF 4J2YB 1SGPE 1GI0A 1EATA 4WJG2 1WYKA 1O2GH 1ZHRA 2XW9A 5DP3A 1BUSA 4K1TA 2FYRA 3HGNA 1YGCH 4CR5A 4Y0ZE 3MMGA 2A32A 1WQSA 1CBWB 1MMJN 4LXBH 3SU3A 3KQDA 2PSYA 1P2NA 5JPMH 3VXFH 1IQNA 2JKHA 1MTWA 7KMEH 1O3PB 1TX8A 3BTKE 4I32A 4X2XA 3N7OA 4NGAH 2PFEA 2C8WB 4DOQA 2BDGA 1O5GH 3LT3A 4IBLH 4ABDA 4AFQA 4I7YH 1SQTA 2Z3CA 4FUIA 3R3GB 5DK1A 3QX5H 1SL3A 3FZZA 1LKBA 1TB6H 4AB8A 2FESH 4AFUA 1MH0A 2BOKA 2VIOA 1GHBG 5GCHF 2BY8X 5CHAC 1SG8B 1DS2E 4A1VA 3RXDA 1QJ6B 2ZP0H 1NRRH 2GCHF 3FP8E 1KTSB 2OCVB 3M35A 2Q6GA 1W11U 1BMAA 1F0SA 3M3SA 2ZFQH 1BCUH 2TGPZ 1W2KH 3B8JA 1S0QA 1WTGH 4ZKSU 1XUHA 3HGPA 3KEEA 1P2OA 2JETB 1UTPA 2G4UA 4BAKB 4X8UH 3RLWH 1C5TA 3RXBA 1GWAA 1JIMA 1MZDA 4RKJB 3BTEE 5JB9S 3HH2C 1EB1H 3PWBA 3SV7A 1GVKB 1V2MT 3RXTA 3RXRA 2ZCLP 7ESTE 3ZV8A 3P8GA 1UVGA 5JBCS 1S6FA 1AZZA 1O2WA 1DVAH 2TPIZ 1GJ6A 1GI3A 2J2UA 3H5CB 2C8YB 1SGFA 1C4U2 1LMWB 1VCQA 4CHAB 3PLPA 1T8MA 1BTPA 1UCYH 2HNTC 1CHOI 2OBOA 4OVOA 1CQQA 2C4FH 1NROH 2P8OC 1AQ7A 1C1PA 3UNRA 2AIPA 3GCTG 3MO3A 1O34A 5FPTA 4MPUA 1FY1A 3C1KA 4YESB 1O36A 1PPBH 1MTVA 3VPKA 4AGKA 2EC9H 4FXGH 2JH0D 3MNSA 5E2PA 2FOFA 1Z6EA 1SI5H 1ELAA 3PMAB 2THFB 1T32A 2LEOA 2O8WA 4GCHF 3RXKA 5TJXA 3KNXA 2BD5A 1FN8A 3EQ0H 1LVBA 3P17H 3QDZB 3RMLH 3DHKH 3WY8A 2A2QH 2ZU1A 1BRCE 1OXGA 1OYQA 2NU0E 2EI6A 3K6YA 5BPEA 3MO9A 2BD4A 1H9LB 3QLPH 2ZQ2A 3RXQA 4ZHLU 4JZFH 1WSSH 2ZHWH 1MTUA 5FCRA 1O5EH 1Y1CA 2FI5E 1O3KA 1XM1A 2FWWA 2ZU5A 4GHTA 2ZNKH 1HNEE 4DW2U 2VIVA 3A84A 1MD8A 3SNAA 1UTNA 1FQ3A 2V35A 4H6TA 1QCPA 1EB2A 2ANYA 1SGRE 4B1TA 1TBQH 1Y5BT 1MCTA 2BDHA 1DE7H 1BMOA 3EAJA 1EZSC 4K8BA 1TA2A 3E16B 3Q3KA 1P9UA 1ZMNA 2G8TA 2B7DH 3OTJE 1O3BA 4OS7A 2OBQA 4D9RA 2J34A 3LC3A 1HUTH 4OS5A 4MVNA 5AFZH 1LHCH 1YCPK 1HIAA 5FBIA 5TCCA 2SNVA 4CR9A 1TQ7B 1AN1I 3ATIA 4WMEA 2OY3A 1XUJA 1YP9A 2WINI 1TGTA 1AY6H 4KTUA 3A88A 1A3EH 1DX5M 3T29A 2TRMA 1QFKH 1FIWA 3EDXB 5FAHA 3RXAA 4AYVB 3VXEH 3BIUH 5C5NA 2Y5HA 3S9AA 3UY9A 1L4ZA 1GJDB 1V2VT 2P16A 3BTDE 3H7TA 3QZQA 2P94A 2ILNA 2ZFSA 1UTMA 4HZHA 3L3TA 3QGJA 3M61U 1V2ST 1NRQH 2FTLE 3T2NA 3L33A 3SU0A 1KXBA 3MH6A 2N17A 2J95A 2W5EA 1Z7KA 1MU6B 5GJ4B 4Q7ZA 1PPZA 1QURH 4R8TB 1NTPA 3E6PH 4HI3A 2ERWA 1DWCH 4DT7B 1EOJA 1ESTA 4DJZB 1IQFA 3MFJA 2H1UA 2OTTX 1ELEE 4ZUHA 1EZXC 1V2TT 1C1TA 1GBHA 3Q3YA 1XMNB 3PTNA 3LGTA 1CA0B 5FPYA 4UONA 1KXAA 3E91A 2Z6BD 2PR3A 3PO1C 1ELCA 3V12A 3QN7A 3SJIA 3OVOA 3DFLA 2C90B 2V53A 1ABJH 4E06H 1PPEE 1DXPA 1GI2A 1SFQB 1G3DA 1OWHA 4AX9H 3KL6A 1T4UH 4RN6A 4B75A 3RMMH 1RTLA 3BTWE 3RDZA 1DOJA 1SOZA 2M5XA 2SGEE 4D7FA 2TIOA 1DS2I 3BTTE 1CT2I 4CH2B 5JBBS 1FIZA 4H6SB 3SNEA 1O3FA 2GX4A 1THRH 3UWJH 4NIXA 1TNHA 1SLXB 2ASUB 4INKA 4GI3C 1FPHH 5AHGH 1EJAA 2V3HH 1VZQH 1BTWA 4JZEH 3M5LA 1QL8A 1LCYA 2B0FA 2A4QA 3A8CA 1TE0A 3SHCH 2ZTYA 2WV5A 4F49A 4U01A 3MU8A 1HAIH 1OOKB 1SGIB 1TRMA 2FP7B 3S9BA 2TGDA 2D8WA 1LO6A 3ZZ8A 2V3OH 1CSOI 1ZPCA 3A7XA 4MPWA 1NESE 3SEKC 4MTBA 4O3TA 4YO9A 1ID5H 1AHTH 1UTKA 1JMOH 2R0KA 4DG4A 1GBIA 4INHA 1FMGA 2J92A 4X6PA 1Y5AT 4CHAC 5JHWC 2Y7ZA 2GT7A 4ZH8A 1EQ9A 1TYNA 1N6XA 1IQIA 1BTZA 2WPIS 2PUQH 2P93A 4B73A 2YOLA 1F0TA 2WUBA 2W7UA 1HJ9A 1BRUP 2ZPRA 3LH3A 1DM4B 2GD4B 1RTFB 3P92A 5DJ7A 1AFQC 4X1SU 4NA9H 3ZYDA 3PM3A 4NG9H 3SJ9A 2JXDA 1GDQA 1GMCG 1CGII 1MT1A 4YOJA 3FAOA 3O8DA 1PPFI 4NSYA 1GBBA 1BOQA 1DUAA 1ORFA 2QXIA 3IITA 1MD7A 2P95A 4WY3A 1HV7A 1KMAA 3S7HB 1O5FH 1VJAU 1LQDB 4KTSA 2FEQH 1FY4A 1YM0A 2GDDA 1BY2A 3GY5A 4X8SH 2HNTE 3FP7E 3BTHE 3T26A 1SGEE 3KQEA 4Q80A 5F8XA 5DP5A 1BB0B 1C2FA 1S0RA 4DURA 1ZJKA 3E0NB 3K9XB 1Z6JH 1QHRB 3U69H 4OS4A 3AASA 4X1NU 2XNIA 3LGUA 4ABEA 1P01A 2SGQI 4IMZA 4YTAA 1HJ8A 4XBBA 1TGNA 4Q7XA 1UVUH 1Z71A 3LDXH 1JBUH 1C1SA 1LHGH 3M36A 1O2JA 3T27A 2AMDA 1FY8E 1SGFG 2G81E 2WCYA 2H2ZA 1Z8JB 2VWLA 2O8TA 1YPHC 4A1TA 3ELAH 1J15A 1AWFH 1VITF 2Q6FA 4FUBA 3B9FH 4Y8ZA 2IOTA 4Y79A 3PMJA 3GYMA 4FUCA 3LJJA 2BOHB 3F9FA 1C5PA 1T7CA 2XWBI 1SLVB 2ZG0H 2QCYA 1MCVA 1C1VH 1P3EA 1K1OA 1GI9B 3M5NA 1QJ1B 2ZFPH 4CRBA 3A8BA 1O3OA 1S6HA 1G36A 1SGEI 4DGJA 2FI4E 2QGRA 5HMAA 1BJVA 1BTYA 1MKWH 1SHHB
chains in the Genus database with same CATH superfamily
2R0LA 3AVZA 3VDPA 4MG3A 3ZVEA 4KTCA 1CGHA 6LPRA 1KLTA 2FX6A 2J97A 1EP6A 1RRKA 3DFJA 1S82A 1AVWA 1HAVB 1PPFE 1IHTH 2VWOA 3RC5A 2D2DA 3A86A 2BTCE 3GY3A 1GJBB 4SGAE 6GCHF 3TJUA 3MH4A 2ODYB 1V2LT 4CRFA 1AVXA 6CHAB 2FIRH 2A7HA 3SGAE 2BVSH 2XC5A 2GKVA 4JCNA 1K7TA 3MTYA 1C2MA 3HKJB 3S0NA 2B8OH 4D7GA 1O3AA 3RXPA 1G37A 4DNCA 1YPGH 3GOXA 1ZMJA 2CGAA 1KLJH 4XOJA 2V6NA 1IQHA 1ZMLA 4HGUA 2Y81A 2CWGA 3RXVA 2P6AC 3MU4A 1RD3B 1GJ9B 3ZZAA 1K1PA 4XRNA 5DP9A 3F9HA 1LR9A 4TWYA 2R3UA 1DSUA 4FUJA 2A2XH 1W8BH 2QF5A 2UZ3A 4ABAA 2A20A 3UOEA 1ANEA 2EI8A 1EAXA 2H9EH 3SGQI 1K7VA 2ZU2A 4LOYH 2A1DB 3TGKE 4HTCH 1C2EA 1VCWA 1YPKH 3GDUA 4X2WA 3BN9A 1QBNA 1N8OB 2BDBA 3NWUA 1G2LA 1EOLA 4M9FA 5EPNA 3SUFA 2ZHFH 2GVFA 4Y7AA 1GHBF 1JWTA 2BDIA 1Z7KB 3PROA 1WDIA 2FOHA 2ZU4A 3MEKA 3MH7A 2WUCA 1NU7B 2Y82A 3SYJA 1TBQR 2K9HA 1KXEA 1F0RA 4I8JA 2BD2A 1FY5A 2FOBA 2LPRA 4X6OA 1PQ7A 3A7YA 2SGFI 3UWIA 1ELGA 2R9PA 1O33A 3SJKA 1O5EL 5HM2A 2GMTB 2CHAB 1LR7A 2CJIA 3TIUA 3OL0A 1QB9A 2X3TA 4BTIB 1RFHA 3PRBA 4O03A 2AMPA 3ATMA 1SSXA 3K65B 3MNXA 3VFEA 5DO4H 1BMLA 2O9QA 3CS7A 1ZZZA 3H09A 1SGDE 1XXFA 1LDTT 1Z8IB 2RCEA 4ZROA 3UGLA 3LOXA 1WQVH 1SGQE 1TWXB 2A5AA 1P2IA 3OSYA 2FLBH 4GHQA 4JMYA 4TY6A 2TGTA 1P8VC 1MKWK 3E0PB 3MU0A 3S9CA 1HJAB 1BBRH 1E38B 2ZFTA 1GL0E 3UQOA 1TIOA 5B6LA 1BT7A 1O2SA 1XVOA 1MBQA 3TO9A 2GGVB 5T3HA 2RDLA 2PP6A 4ZXYH 1AMHA 1UK2A 2FOEA 4TT3D 2PKAA 5GCHG 1T8LA 4IW4E 1LPZB 1UTJA 4Q2KA 2Z9IA 5JBAS 3EA8A 2EA3A 3E90B 4HFPB 2IPQX 3GDSA 3SV9A 1S5SA 1R79A 1AE5A 2A45B 1U6QA 2JA1A 2F9PA 1N8OC 2XBVA 4Y6DA 1WKXA 2GZ8A 2AEIH 5F8TA 3PV4A 1HXFH 4AOQA 1TPAE 4YOIA 1DPOA 3MQKC 1Q9BA 3F9EA 1NFXA 4UXHA 1J16A 4B76A 5A2MH 1Z8RA 1SGPI 3TJQA 4NA8A 2JH6D 2PKSC 1RFNA 2VH6A 5AVDA 4XBDA 1QB6A 5BRRE 1MUEB 4O3UA 2HLCA 3SJOA 5DG6A 2JOPA 1NY22 4P02A 3BTGE 4MQAA 2I6QA 1O3DA 1F5KU 2K1QA 1BDAA 1TPPA 2QAAA 3M3TA 3NUMA 3OTPA 1OP2A 1OPHB 2N52A 2NWNA 2WYJA 1YLDA 2YNBA 4WH8A 4CRDA 4AYYB 1QJ7B 3SU1A 2EQNA 1C1UH 1PTQA 1SR5C 2G5NA 4UEHH 4IN2A 3AK5A 2PKAB 1TBZH 2A7JA 2F9OA 4IS5A 5DP7A 2Y5GA 3RXSA 1PQAA 5J4QA 1L4DA 4DVAU 4X2YA 2VRWB 2ZTZA 1QGFA 1AN1E 2LB7A 1FX0B 5GIBA 3SV6A 3TITA 1LHFH 4Y10E 1Y5UT 1ZPZA 1WXRA 3BV9B 1YLCA 4UFEH 2Z9KA 4AMLA 1HYLA 8GCHG 1BRBE 5A09A 1F2SE 1KY9A 4SGBI 1UVOA 3T5FH 4JZDH 2HVYB 1DANH 3CNRA 5K7RA 2VH0A 3SQEE 1QBOA 1DLEA 2B8TA 5FUYA 1NO9H 5B6OA 2PTNA 1O3LA 1QBVH 1XBTA 1L1GA 3SU5A 4FU7A 1GJCB 1V2RT 1AI8H 4I31A 2ZWLH 2A7CA 1HBTH 2IPHA 1QNJA 1K21H 2M2AA 1YPHE 2BX3A 2G55A 2NU1E 4RI0A 1OVOA 5DKMA 2KMOA 1H9IE 1T31A 4K5ZA 3ZYEA 2ZGCA 2WYGA 3B4VC 1ETTH 2ZQ1A 2C93B 3KQCA 4JCVE 2KZ4A 1A0JA 3F6UH 5DP6A 1OSSA 2QIQA 1X74A 4PROA 4ABBA 1OWJA 2FXRA 3F0OA 3F3BA 4A92A 3FSYA 1A0HB 2GKTI 1O2UA 1IQKA 2NU0I 1E37B 5F6MA 2YQPA 3MNBA 1P3CA 2ZTXA 1SB1H 4X6MA 4WMDA 1A5IA 4D8NA 2QV1A 1GBDA 3GCNA 3STIA 2WPHS 4A7IB 2L8EA 4B6EA 5FL7D 1WAYB 2JZMA 1G2MA 1QL9A 1NRSH 1O32A 3F2FA 1Q3XA 2CMYA 1FLEE 1E36B 2BUSA 5CDFE 2GCTC 3A85A 4MPVA 1C2IA 1C2DA 4ZMAH 2BHGA 1TNGA 1UO6A 2ARPF 1C5ZB 1GMDG 4NIVA 1ZHPA 2NU4I 6CHAC 3GY7A 1C2JA 1HAYB 2L7XA 2F83A 2OLGA 4BXSA 1LHEH 3OXLA 1EFRD 2J38A 4R0IA 1C5MD 2Z3DA 3PV2A 1TQ0B 2GKVE 5T6DA 5F53A 2A4RA 5HGGA 1HXEH 3QO6A 2ZF0H 5EU8A 3Q00A 2V3MA 1OYVI 1J14A 5A8YA 2QE7D 3SORA 5FX6A 4Y76A 1SGDI 3RC6A 4NIWA 5C5OA 1JOUB 1TPSA 1UMAH 2K8IA 1DXWA 2BD8A 2I6SA 1O2HA 1RIWC 1ABIH 1C5VA 1H8DH 2KCOA 2O8LA 3SUEA 4ABIA 2XTTB 8GCHF 3PB1E 3TO6A 4A5TS 1THSH 3RXJA 1O2TA 2GP9B 3TK6A 1UUCA 4IMQA 1GBTA 5FPSA 2ODPA 1HAHH 1T4VH 4Z6AH 1HFDA 1KDQB 2VVCA 3U1JB 1BIOA 1E35B 1FXYA 1IY6A 2J5UA 3RU0A 3OU0A 8ESTE 2Y0MA 3P8FA 3HPTB 1GJ4H 3Q76A 5EPYA 2G00A 2RG3A 2CV3A 3RXFA 1YBWA 3RXUA 1ULKA 1O2ZA 3MH5A 1ZJDA 1AKSB 7LPRA 4CRAA 5DAEA 1OMTA 7GCHF 2ESTE 3MYWA 1V6DA 3P95A 2ZGXH 1ESBA 3M5OA 2VJ1A 1F7ZA 1O2XA 1GCTC 3F9GA 1GBEA 3GY6A 2FM2A 4JYVH 1TMBH 3GYLB 4IC6A 2KMRA 5L2ZH 4JK5A 3HATH 3LGWA 4AORA 1YCPH 1OWIA 2ZDNA 2P3TB 3HK6B 5DSFA 4WF8A 4NWKA 1BQYA 1O37A 3LGVA 1SVPA 5LPEA 4IC5A 1ZRBA 1ZR0A 1GHYH 1K22H 2CN0H 3TPIZ 2KCPA 3RU4D 1J9CH 2DE8A 1YY3A 4ZHMU 5AF9H 1CT2E 2ALPA 3KF2A 2PV9B 1CVWH 1HPTA 4U2WA 3OEED 1LR8A 5KEDA 4RT1A 2ZI2H 2BB4A 2A5IA 4YLQH 2BMGB 2Y5FA 2FOGA 2HRVA 1XUFA 3IWMA 1AB9B 3FP6E 1GJAB 4GUXA 4NCYA 4XFQA 1MABB 5JYIA 1B5GH 5HYOA 1SGNE 4K60A 4AFZA 4B2BA 3PLKA 1C5QA 1QA0A 2VINA 6ESTA 4MPIA 1AIXH 1GJ5H 1P09A 5LH8A 4K1EA 1TMUH 1KSNA 3VB7A 2Q6DA 3M5MA 3ESTA 2K0QA 1PPCE 4KKDA 3QAHA 1DWDH 1CA0C 4ABGA 1Y3XA 1EPTB 1PQ5A 1J8AA 1ELDE 5T6FA 2ROWA 1O39A 1MQ5A 1W3CA 1SFIA 2LNCA 3BF6H 1DDJA 2VWMA 1GDNA 2XC0A 1G32B 4Y71A 4CBOA 1FUJA 1IQEA 4ISHH 3I78A 1C4V2 1O2IA 2YMSB 1UVFA 1CT4E 2SGPE 2ANMH 1W7GH 4RT0A 1TBNA 1YYY1 1VGCB 1NC6A 1NFWA 3BEIB 2PGQB 1ZPBA 2QC2A 1P05A 4GLYA 1SHYA 1O2NA 2M5TA 1YLNA 3VGCC 1YU6C 1D9IA 1SPJA 1S20A 3P70B 4A24A 1MTNB 2CWFA 4K8YA 2XBXA 1WCZA 1UVSH 2GCHG 3GDVA 1EJMA 1A4WH 2ZFRH 2Y80A 1TONA 5L30H 3O8RA 4LK4A 4D76A 3S7KB 1TRNA 2G4TA 4NWLA 5C2ZA 3SU6A 4XD7D 2J4IA 1O35A 1AGJA 2F9NA 2ZCKP 1DITH 4K2YA 2FYQA 2BQWB 1D3DB 1YKTA 1QQ4A 2A5KA 2ALVA 2JYYA 4ZKOU 3SU2A 1QIXB 1H0ZA 2GV6A 2Z9JA 2OQUA 3BG4B 4NZLA 2B5TB 2FODA 4DIHH 3U8OH 1D6RA 1O2MA 1S6LA 2NU2I 2YNAA 2ANWA 1HAVA 3DCLA 2WPKS 2R2WU 4FUEA 1O31A 3P8NA 1IW4A 3ZZBA 4DT4A 4WXIA 1CGIE 1PYTC 4Y8XA 5KGOA 1O2KA 4Z1MD 4Y11E 1NT1A 2SGPI 1TRYA 3SV2H 2SNWA 1CE5A 2ORVA 4FUGA 4BNRA 4DY7B 4YOGA 1IQMA 3UFAA 2XBYA 1M8BA 3TNTA 1KYNA 5EQRA 4I8LA 3L6PA 3ZVFA 1M8CA 3U98H 1Z1IA 2OVOA 1OP0A 2ZIQH 1ETSH 2GMTC 2EY4C 1B7XB 5CE1A 1GBKA 5EJZA 1OWDA 1P2MA 4NA7A 3SBKA 2XOKD 2Z9LA 1V2JT 3ZVGA 5T6GA 3VB3A 2ZDLA 2WPLS 3IG6B 4K1SA 2P3UB 4IN1A 4CRCA 1GL1A 3NZIA 1UW7A 2ZDVH 1V2WT 3SN8A 1F5RA 1QRZA 4NFEA 1GI6A 1P10A 3LPRA 4M7GA 1TBRH 2BLOA 5FHTA 2PW8H 2XNDD 1C1OA 1V3XA 2JW6A 2ULLA 1GCDA 1LKAA 2Z7FE 1W0JD 1A5GH 4JZIA 1TGCA 1HRTH 3UREA 1UCYE 3ZZ5A 1DY8A 2HNTF 3MU5A 5DGJA 1QB1A 1UCYK 2BQ6B 1G3CA 3V3MA 4WP4A 1NN6A 1QY6A 2FOCA 3R5AA 2ZU3A 1YPJH 3R5DA 2GDEH 1CA8B 3QTLD 2VIQA 1H8IH 2CXVA 1WGTA 1EP5A 1AFQB 3T25A 1W14U 3EE7A 1FAXA 3V7TA 4I8KA 5E3PA 5FCKA 3FZDA 1CGJI 1GG6C 1EPTC 5HI7A 1K1MA 1EAUA 2VGCB 4X1RU 2ZGHA 3TLOA 3BSQA 4I86A 2J9NA 3PWCA 1XUIA 1TGSZ 2FDAA 4ABJA 4DIIH 1CT0I 2ENNA 1W0ZU 1SGQI 2PSXA 1ZYOA 4B71A 1ULMA 2FPZA 2PUXB 4BAQB 1FPCH 1RIWB 3SGBI 2NU3E 1O2YA 4JZ1A 4E7NA 1R0RI 3ZVBA 5C0UA 1D4PB 3AAUA 3DUXH 1SKYE 3OXFA 1GJ8B 2BLVA 1LHDH 1MKXH 1GMHG 1GI5A 5C1XA 2IJD1 4Y8YA 1TGSI 1SGCA 3QK1A 4O97A 1LPKB 4UDWH 3N99A 1C5LH 1D3TB 3RXOA 1NPMA 3TJNA 3KIDU 1D6WA 1O38A 2A31A 1GI8B 1GVLA 1P57B 4AG2A 2IJOB 3B23B 4H42U 1BTHH 1O2PA 1W7XH 3HKIB 2XRCA 1O5BB 3RXHA 2OD1A 2RA0A 1A0LA 1TNIA 3S69A 5I46H 4NFFA 2F4LA 1WUNH 4MLFB 2NU3I 4CBNA 1KDQA 1GHXH 1XUGA 3SGBE 4ISIH 5CMXH 5A8XA 1LVYA 3SGQE 3PDNA 3SNCA 1A7SA 3SHAH 2J87A 3GISB 3MWIU 3E59A 1FYBA 1ZTKA 5GPIB 4FUDA 2QF3A 1NFUA 3SV8A 3MHWU 4OGXA 3RXCA 4HG6A 2HPPH 1WOFA 3ZZ9A 1TGBA 4FKDA 1L1NA 1MQ6A 1VITG 2V1CC 5EXNA 1BJUA 2FS8A 1WBGB 3A8AA 2E5RA 3RXMA 2WVJA 3TU7H 2P8OB 2GTBA 1FJSA 3EA9A 2B9LA 3AW1A 3GCHB 3OY6U 1SBWA 4XSKU 1CT0E 2D26C 4ISNA 4YM9A 1OWEA 1S85A 4FU8A 4ABFA 4LZ1H 3KCGH 3LC5A 3UB0A 4E1PA 3R5BA 3D65E 1AO5A 2BZ6H 3ZZ7A 1ZSKA 1EJNA 5E3RA 2F91A 1O3JA 1LVMA 1ANBA 1JIRA 3ENSB 3F0PA 2ZGBH 4DCDA 3RU4E 2BLWA 1ELVA 2FMJA 4I33A 2FZZA 1MBMA 5A0BA 1CHOF 4WWYA 3BEFB 4WVPE 1O5FL 1VGCC 2KAIB 1SQAA 1C5YB 2H9HA 5C3NA 1GVZA 2Z94A 4TSFD 1HJAI 4FVBA 4THNH 2J9RA 1K1IA 1TURA 2RA3A 2KCXA 2NU1I 1V2UT 1GI1A 2VIDA 1P03A 1HDLA 1UTOA 1D3QB 4YXWD 2UWPA 5EXLA 3F2HA 4WXVA 1SGRI 1UHAA 1TUSA 2Z9GA 7WGAA 3UGIA 2HALA 4D9QA 1H1BA 5C1UA 3T28A 1P02A 1F0UA 4GCHG 1E34B 1MU8B 3GY8A 4E05H 3WWBA 3BG8A 1DT2A 3JZ1B 1VCPA 2GCTB 4OS6A 3BJIA 3UNSA 4SGBE 3NPSA 2QQCA 1INCA 1CBWC 1C1RA 3TVJB 1N6YA 1P04A 3QWPA 5J8CA 2DIPA 3TK5A 3TJVA 3DD2H 3A8DA 3GCHC 3A7WA 2AYWA 2JP0A 4ASUD 2FNFX 3ZZ3A 3VDUA 1HAXB 1Y8TA 1IAUA 2F9BH 2P3FH 4OGYA 1GDUA 4KELA 2OP9A 3SQHE 2BD3A 2VVVA 1JXPA 1G3BA 3FN8A 3O8BA 1NZQH 1BITA 4WMFA 1FY3A 2NU2E 1UK3A 4ZAEA 3MNCA 3UQVA 4NZQA 1UJ1A 1Z2IA 1HIAB 3Q77A 2ELIA 1O3GA 2UUKB 1KTTB 2TBSA 1VKYA 3A80A 3ZVDA 2N1AB 1RTKA 3CP7A 1ZGIA 3SNDA 2WGCA 2A0QB 4TPIZ 1GHAF 4Y0YE 2UVOA 1C9PA 3VGCB 2H5CA 2ZKSA 3BEUA 2JA4A 1A3BH 1AZ8A 3LJOA 2HGTH 2B0UC 1K7UA 2PQ8A 2ZHDA 2ZA5A 4AFSA 4O9VA 3EE0B 2LELA 4Q63A 2EEKA 1DFPA 3UGDA 2XCFA 3AW0A 3W94A 1ZTLA 2KFWA 1HAZB 2UUJB 1FDPA 2WPJS 1AU8A 4K69A 3EA7A 2WV4A 2AGIX 1QR3E 1GHWH 1RXPA 1C5RA 4FUHA 2OD3B 5GXPA 3PYHA 1UHBB 1A46H 4BAMB 3ODDA 2BQ7B 5PTPA 1VITH 2QXGA 2OXSA 3DT0H 4AB9A 1DWBH 2PGBB 3WWFA 1PJUA 9ESTA 1ZSJA 2W3IA 1CT4I 1ANDA 4OM9A 4CRGA 1PPGE 3EYDA 8LPRA 1E0FD 1SLUB 1W0YH 2F43B 1GBCA 1OMUA 4CH8B 1BHXF 1L2EA 1AKSA 3RU4T 4GAWA 2F9VA 1C5WB 1GBAA 2QXHA 1CSOE 2Q1JA 1HLTH 2XBWA 2ZDAH 3ZZDA 2ZCHP 1DUEA 1YPEH 4Q7YA 5A0AE 1S84A 1YPMH 5EOKA 1QTFA 3FFGA 4UE7H 2V0BA 1OS8A 4OS1A 3SW2B 3I29A 1A61H 3LONA 1UVTH 4GVUA 1SGNI 2GJGA 2F3CE 2OC0A 4TPYA 3D62A 1BBRK 3NK8A 5C67A 1PYTD 3A89A 4B74A 1TX7A 3DSGA 1OX1A 2H6MA 1GGDC 4TY7A 2BDYA 1YF4A 1TAWA 1QL7A 1C4Y2 3K2UA 3PLBA 2GV7A 3VB6A 4FOUC 2SGEI 2WZQA 2ZDKA 3GY2A 3QGNB 4U32A 5ESBA 1K2I1 2F9UA 2FO9A 2HPQH 2ANKH 4BOHA 4LZ4B 1SGYE 3KN2A 1YTPA 3U9AH 1H4WA 1SLWB 3QTVH 2TGAA 4UD9H 3GY4A 1W0KD 5C1YA 4E7RG 4FU9A 1AB9C 2OTVA 1OYTH 2XXLA 3STJA 3VB5A 1GBMA 1XX6A 1V2KT 4MPXA 4ABHA 1TALA 1X7AC 3F1SB 4XE4A 3UEJA 1G30B 1WV7H 3ZVCA 5LGOA 1EUFA 4Z0KA 5CHBA 3RXGA 1DICA 2X52A 1DWEH 3E1XB 4BAHB 5C94A 4B2AA 2SGDE 1BA8B 3C27B 1S81A 5SGAE 3QUMP 1HPGA 1B0EA 3BG4C 3A87A 2KMPA 1TIHA 3MI4A 1BUIA 2AMQA 5DPAA 2KX4A 1TNLA 5JBTA 3TNSA 2OC8A 2A4OA 1PCEA 1YCPM 1FARA 1TFXA 3TK9A 4I8GA 3V0XA 5EQSA 2C8XB 2QXJA 1LVOA 5EXMA 2BVRH 2ZPQA 5C0TA 1ELTA 2AGGX 1BHXB 2YMSD 3UR9A 1BTUA 5F03A 1SMFE 1GGDB 3LGIA 1ZTJA 3MU1A 3W95A 2XC4A 3LKWA 1W13U 1AVGH 4BTUB 2ZC9H 1O3HA 2ZHQH 3A7VA 1TABE 2C8ZB 4JK6A 1K1NA 3P6ZB 1HJAC 3H7OA 3KQ5A 1C1NA 3RXEA 3URCA 1CO7E 1CU1A 3RMOH 1ZSLA 5HXFA 2W26A 3TGJE 1NRNH 1KLIH 1ELBA 1GBFA 3PRDA 1TA6A 3M3VA 2BD9A 5JDUB 1Y1BA 3TGIE 2JH5D 1ZHMA 1FV9A 5CCMA 1C1WH 2BXTH 2ZHEH 2NU4E 4GSOA 3RM2H 1W10U 3ATWA 1S83A 1B0FA 2HVXA 1NBMD 1W12U 4X1PU 2V1CA 1TNKA 1W4RA 4RSPA 4XBCA 4U30A 3CENA 4FUFA 3DSOA 5L2YH 1XXDA 1HAOH 2EI7A 3QWCH 3BTFE 3WW7A 5FXLA 3GCTF 2CF8H 3OYPA 2VGCC 2DKVA 2CHAC 2SGQE 1Y59T 2STBE 2RDEA 1Y3VA 2UWOA 2Z3EA 2WV9A 2CF9H 1LQEA 3EGKH 3M37A 1YC0A 3N7EA 3ODFA 4QT8C 5HKKD 8KME2 2VBCA 5H4IB 4ZHAA 1IQLA 1ARBA 1FAKH 1O2QA 4ISLA 4YZUA 1L0ZA 1IOEA 1CE3A 1AFEH 1RGQA 3RXLA 5FUXA 4VGCB 4X8VH 4Y7BA 4TYDA 2LUYA 2C3SA 3SUDA 3U8TH 2AFQB 1QQUA 1ETRH 1K0HA 2BDAA 3K6ZA 3SO3A 1O2LA 1KXCA 1AUJA 2FOMB 4JYUH 2OUAA 4B6FA 1AD8H 1GG6B 2GKRI 1F92A 4ZXXH 1ARCA 5C20A 2N71A 3A7TA 3ATLA 2VU8E 3R5CA 5DP8A 1C5NH 1MAYA 4BTTB 3UIRA 1V2PT 2UUFB 5E0GA 1ZGVA 5CHAB 1O3NA 1NS3A 5TCAA 1AE8H 3FSXA 1K1LA 4NSVA 3U1IB 1DLKB 3RC4A 4A1XA 3T62A 1K28D 2GT8A 2VIWA 1O5AB 1OWKA 2VWNA 3ZIAD 1XKBC 1V2NT 4TWWA 2AIQA 4YT7H 4MNWA 1A1RA 1HCGA 1O2OA 3BTQE 3G01A 4KP0A 3UR6A 1MAXA 2D1JA 4X0WU 1C2KA 1GHZA 2PKSB 3RLYH 3DA9B 1EKBB 2AERH 1HGTH 3A82A 5EGMA 1N13A 1EZQA 2GZ9A 1GMDF 4NIYA 4VGCC 4K3JA 3QZRA 2VB0A 1CHOG 2HWLB 5ETXA 5EG4A 1GI7B 1MTNC 1O3CA 1V2QT 2G51A 2G52A 3NCLA 1KXDA 2ZDMA 2FTMA 1NUBA 3O8CA 1YPLH 1KXFA 1THPB 2Y6TA 1EAIA 1JRSA 1ANCA 2SFAA 1K9OE 3KQBA 4WH6A 2J94A 1P57A 2FLRH 1YWUA 5DN6D 5E8EH 1MZAA 3TH2H 3RP2A 4MDSA 4RKOB 2E73A 1UHBA 3FANA 5J4SA 2LP6A 4B2CA 3UTUH 2QF4A 5ABWA 3SI3H 3ITIA 1FZZA 3GOVB 1FNIA 2FOAA 3P8OA 5EQQA 1A2CH 4BAOB 2W0TA 2ODQA 2OU2A 3UOUA 3URDA 1O5CB 1C2GA 3FO8D 2FX4A 2XWAA 4FVDA 5AFYH 3A83A 5FX5A 1Y3WA 1O30A 2PTCE 5HQ8A 5ESTE 2BY7X 1FN6A 2JDID 5FBEA 4BANB 1Y3YA 3BIVH 2H9TH 1AUTC 2Y7XA 1O5DH 1K1JA 1D3PB 1SGTA 2ZECA 2ZZUH 1OP8A 1G3EA 5EIYA 3CS0A 3PV5A 1C5UA 1JRTA 1NRPH 3RUOA 3E8LA 3HK3B 2SGFE 2BM2A 1TX6A 3E2IA 1GHVH 1Z8GA 3PMBB 4ASHA 2BLQA 5F8ZA 3I77A 2KAIA 1TOMH 3V13A 3M7QA 4BXWA 2KCYA 3OEHD 5I25A 1C5SA 3SI4H 1Q2WA 1KIGH 3ZZ4A 1TPOA 3LGYA 1ZOMA 2ZFFH 1NXUA 1NFYA 1O2VA 4KGAA 1BZXE 1O3EA 4HGCA 5DP4A 1HAGE 1GJ7B 1EX3A 2AS9A 3JZ2B 3SU4A 3SJ8A 2JETC 3TH4H 3UNQA 1MJAA 4INLA 1NU9A 2QQ0A 2KMQA 2FS9A 1TLDA 2BDCA 5HM9A 2ZGJA 1MTSA 1XKAC 1BMNH 3KGPA 1LPGB 1P9SA 1IHSH 1G9IE 5LPRA 5A8ZA 2BYAX 4E1RA 1PPHE 4X8TH 2PHBA 4ISOA 4YT6H 1XX9A 1SC8U 1VJ9U 5EJ1A 4X2VA 1FONA 1XVMA 9LPRA 1UTLM 1SGYI 3LIWA 2SGAA 1U5KA 1RJXB 1UK4A 1BTXA 5K0HA 2BY5X 2W3KA 3RM0H 7GCHG 1XUKA 5IDKA 4IGDA 2UUYA 4YLUA 3GCOA 1J17T 5JB8S 4I8HA 3FVFB 1FAQA 1EXFA 3KHVA 4X1QU 2OZUA 1O0DH 1T8OA 1CGJE 4OS2A 1KBEA 5GNDA 3GICB 5E0HA 9WGAA 2AH4X 1P2QA 3RMNH 2XYAA 3MOCA 2F3CI 4ZKRU 2GZ7A 1SOTA 3ZZCA 1FI8A 1GBLA 2QYIA 4UFFH 3E3TA 2BXUH 2A4GA 5EODA 3F68H 2R3YA 1P2JA 1BMMH 1LTOA 5A0CA 2XCNA 1NM6A 2OC7A 3AAVA 1P06A 3OX7U 2UWLA 2BX4A 2VNTA 4Q4LA 3PMHB 5E2OA 3LU9B 3VB4A 2RIJA 2QN5T 3TOAA 3A7ZA 4AGJA 1GHAG 2GIVA 3UFFA 1QA7A 3TH3H 1V2OT 1DSTA 5GWZA 1L1JA 1P9ZA 3UUZA 2O8MA 2R2MB 3NKKA 2JJ1D 2BD7A 4A6LA 2QQDA 4MNXA 2AGEX 1Z1JA 5J8FA 2W7SA 1GCTB 4ESTE 4AZ2B 1UTQA 1Q31A 5LPFA 2OYAA 1PFXC 1PQ8A 5JFBA 3UPEA 1IY5A 1IQGA 3OE7D 5FUWA 3M7TA 1GBJA 3PO1B 2WPMS 2DE9A 4H4FA 1DS3I 1ACBE 1EAWA 2AHME 1UVPA 3OY5U 1T8NA 3FOAA 1P0SH 3U8RH 2PLXA 5GDSH 3SUGA 3TJOA 2W6ID 4GPGA 1TBOA 2H5DA 5EW2H 1V1HA 1M9UA 1FY7A 2FI3E 2P59A 2ZPSA 1Y3UA 4XDEA 1H9HE 1WU1A 1C1QA 1QRWA 2ZO3H 2ZEBA 2BY9X 3SNBA 1EPTA 1F5LA 3VEQB 4AN7A 4F4OC 3ZV9A 1C5OH 1C5XB 3NXPA 4F55A 2BY6X 1QRXA 2VIPA 1ZRKA 1PJPA 3RXIA 3A81A 3QTOH 2G5VA 2HOBA 4J1YA 4X6NA 1C9TA 1TNJA 5E0JA 1EASA 3FKSD 3Q3XA 1GPZA 1O3IA 2OINA 5IYTA 3UAIC 1GMHF 3NRLA 3ZZ6A 1IQJA 1C2HA 1X4SA 5IK2D 1MJ9A 4MNVA 1MKXK 1A5HA 1BBRE 1P2KA 3M7UA 1V1IA 1C2LA 1P11E 2GVIA 1AWHB 3N7DA 4UFDH 2OC1A 2BZAA 3D23A 2BVXH 1RS0A 2IN2A 2QA9E 5L6NH 3SOSA 3KY9A 5EW1H 2PWXA 6GCHG 1BRAA 1C1MA 1TMTH 2O8UA 4UFGH 3ZVAA 1WTHD 3ATKA 1TBRR 1ZLRA 3SZEA 2QY0B 3BTME 3SZNA 1P12E 2YMSC 1HAPH 1H8HD 2JIZD 1ESAA 3W1EA 2J98A 2VVUA 3MO6A 1HB0B 1O2RA 1GI4A 1SQOA 1ELFA 2QF0A 1TOCB 4JYTA 1P9GA 3U28C 5EX3A 3LH1A 1HDTH 3PTBA 4AG1A 2SGDI 1COWD 4CREA 1CHGA 2OQ5A 4MNYA 2ENZA 1OKXA 1O3MA 2STAE 2DUCA 5KECA 4ZKNU 5G4BA 3R0FA 1VR1H 1N1LA 3D49H 3UOPA 1EZUC 1DY9A 1GMCF 1OHHD 4J2YB 1SGPE 1GI0A 1EATA 4WJG2 1WYKA 1O2GH 1ZHRA 2XW9A 5DP3A 1BUSA 4K1TA 2FYRA 3HGNA 1YGCH 2WPDD 4CR5A 4Y0ZE 3MMGA 4FETA 2A32A 1WQSA 1CBWB 1MMJN 2KM0A 2QPOA 4LXBH 3SU3A 3KQDA 2PSYA 1P2NA 5JPMH 3VXFH 1KBFA 1IQNA 2JKHA 4B6DA 1MTWA 1XA6A 7KMEH 1O3PB 1TX8A 3BTKE 4I32A 4X2XA 3N7OA 4NGAH 2PFEA 2C8WB 4DOQA 3OAAD 2BDGA 2J98B 1O5GH 3LT3A 4IBLH 4ABDA 4AFQA 4I7YH 1SQTA 2Z3CA 4FUIA 3R3GB 5DK1A 3QX5H 1SL3A 3FZZA 1LKBA 1TB6H 4AB8A 2FESH 3F2GA 4AFUA 1MH0A 2BOKA 2VIOA 1GHBG 5GCHF 2BY8X 5CHAC 1SG8B 1DS2E 4A1VA 3RXDA 1QJ6B 2ZP0H 1NRRH 2GCHF 3FP8E 1KTSB 2OCVB 3M35A 2Q6GA 1W11U 1BMAA 1F0SA 3M3SA 2ZFQH 1BCUH 2TGPZ 5CCLA 1W2KH 3B8JA 1S0QA 1WTGH 4ZKSU 1H8ED 1XUHA 3HGPA 3KEEA 1P2OA 2JETB 1UTPA 2G4UA 4BAKB 4X8UH 3RLWH 1C5TA 1W3SA 3RXBA 4AC9A 1GWAA 1JIMA 1MZDA 4RKJB 3BTEE 5JB9S 3HH2C 1EB1H 3PWBA 3SV7A 1GVKB 1V2MT 3RXTA 3RXRA 2ZCLP 7ESTE 3ZV8A 3P8GA 1UVGA 5JBCS 1S6FA 1AZZA 1O2WA 1DVAH 2TPIZ 1GJ6A 1GI3A 2J2UA 3H5CB 2C8YB 1SGFA 1C4U2 1LMWB 1VCQA 4CHAB 3PLPA 1T8MA 1BTPA 2V7QD 1UCYH 3CXLA 2HNTC 1CHOI 2OBOA 4OVOA 1CQQA 1PTRA 2C4FH 1NROH 2P8OC 3VG8A 1AQ7A 1C1PA 3UNRA 2AIPA 3GCTG 3MO3A 1O34A 3OFND 5FPTA 4MPUA 1FY1A 3C1KA 4YESB 1O36A 1PPBH 1MTVA 3VPKA 4AGKA 2EC9H 4FXGH 2JH0D 3FC3A 3MNSA 5E2PA 2FOFA 1MJBA 1Z6EA 1SI5H 1ELAA 3PMAB 2THFB 1WTJA 1T32A 2L74A 2LEOA 1WGCA 1TOTA 2O8WA 4UXIA 4GCHF 3RXKA 5TJXA 3KNXA 2BD5A 1FN8A 3EQ0H 1LVBA 3P17H 3QDZB 3RMLH 3DHKH 3WY8A 2A2QH 2ZU1A 1BRCE 1OXGA 1OYQA 2NU0E 2EI6A 3K6YA 5BPEA 3MO9A 2BD4A 1H9LB 3QLPH 2W6JD 2ZQ2A 3RXQA 4ZHLU 4JZFH 1WSSH 2ZHWH 1MTUA 5FCRA 1O5EH 2ORWA 2HLDD 1Y1CA 2FI5E 1O3KA 1XM1A 2FWWA 2ZU5A 4GHTA 2ZNKH 1HNEE 1BMFD 4DW2U 2VIVA 3A84A 1MD8A 1NBME 3SNAA 1UTNA 1FQ3A 2V35A 4H6TA 2RFKC 1QCPA 1EB2A 2ANYA 1SGRE 4B1TA 1SQRA 1TBQH 1Y5BT 1MCTA 2BDHA 1DE7H 1BMOA 3EAJA 1EZSC 4K8BA 1TA2A 3E16B 3Q3KA 1P9UA 1ZMNA 2G8TA 1ULNA 3TOBA 2B7DH 3OTJE 1O3BA 4OS7A 2OBQA 4D9RA 2J34A 3LC3A 1HUTH 4OS5A 4MVNA 5AFZH 5HIYA 1LHCH 2YUUA 1YCPK 1HIAA 3TO7A 5FBIA 5TCCA 2SNVA 4CR9A 1TQ7B 2KR7A 1AN1I 3ATIA 4WMEA 2OY3A 1XUJA 1YP9A 2WINI 3KYFA 1TGTA 1AY6H 2CWHA 4KTUA 3A88A 1A3EH 1DX5M 3T29A 2TRMA 4ZCNA 1QFKH 1FIWA 3EDXB 5FAHA 3RXAA 4AYVB 3GS9A 3VXEH 3BIUH 5C5NA 2Y5HA 3S9AA 3UY9A 1L4ZA 1GJDB 1V2VT 2P16A 3BTDE 3KYGA 3H7TA 3QZQA 2P94A 2ILNA 2ZFSA 1UTMA 4HZHA 3L3TA 3QGJA 3M61U 1V2ST 1NRQH 2FTLE 3DSPA 3T2NA 3L33A 3SU0A 1KXBA 3MH6A 2N17A 2J95A 2W5EA 5HIZA 1Z7KA 1MU6B 5GJ4B 4Q7ZA 1PPZA 1QURH 4R8TB 1NTPA 3E6PH 4HI3A 2ERWA 1DWCH 4DT7B 1EOJA 1ESTA 4DJZB 1IQFA 3MFJA 2H1UA 2OTTX 1ELEE 4ZUHA 1EZXC 1V2TT 1C1TA 1GBHA 3Q3YA 1XMNB 3PTNA 3LGTA 1CA0B 5FPYA 4UONA 2WSSD 1KXAA 3E91A 2Z6BD 2PR3A 3PO1C 1ELCA 3V12A 3QN7A 3UEYA 3SJIA 3OVOA 3DFLA 2C90B 2V53A 1ABJH 1E1RD 4E06H 2CJSC 5EJLA 1PPEE 1DXPA 1GI2A 2QQEA 1SFQB 1G3DA 1OWHA 3VE5A 4AX9H 3KL6A 1T4UH 4RN6A 4B75A 1E79D 2CK3D 3RMMH 1RTLA 3BTWE 2RC4A 3RDZA 1DOJA 1SOZA 2M5XA 2SGEE 4D7FA 2TIOA 1DS2I 5C17A 3BTTE 1CT2I 4CH2B 5JBBS 1FIZA 4H6SB 3SNEA 1O3FA 2GX4A 1THRH 5T1VA 3UWJH 4NIXA 4F48B 1TNHA 1SLXB 2ASUB 1QZ8A 4INKA 1FPHH 5AHGH 4GI3C 1EJAA 2V3HH 1VZQH 1BTWA 4JZEH 3M5LA 1QL8A 1LCYA 2B0FA 2A4QA 3A8CA 1TE0A 3OXGA 3SHCH 2ZTYA 2WV5A 4F49A 4U01A 3MU8A 1HAIH 1OOKB 1SGIB 1TRMA 2FP7B 3S9BA 2TGDA 2D8WA 1LO6A 4ACBA 5EX0A 3ZZ8A 2V3OH 1CSOI 1Y8FA 1ZPCA 3A7XA 2DB6A 4UXJA 4MPWA 1NESE 3SEKC 4MTBA 4O3TA 4YO9A 1ID5H 1AHTH 1UTKA 1JMOH 2R0KA 4DG4A 1GBIA 4INHA 1FMGA 2J92A 4X6PA 1Y5AT 4CHAC 5JHWC 2Y7ZA 2GT7A 4ZH8A 1EQ9A 1KMHB 1TYNA 1N6XA 1IQIA 1BTZA 2WPIS 2PUQH 2P93A 4B73A 2YOLA 1F0TA 2WUBA 1HJ9A 2W7UA 1BRUP 2ZPRA 3LH3A 1DM4B 2GD4B 1RTFB 3P92A 5DJ7A 1AFQC 4X1SU 4NA9H 3ZYDA 3PM3A 4NG9H 3SJ9A 2JXDA 1GDQA 1GMCG 1CGII 1MT1A 4YOJA 3D00A 3FAOA 3O8DA 1PPFI 4NSYA 1GBBA 1BOQA 1DUAA 1ORFA 2QXIA 1HEVA 3IITA 1MD7A 2P95A 4WY3A 1HV7A 1KMAA 3S7HB 1O5FH 1VJAU 1LQDB 4KTSA 2FEQH 1FY4A 1YM0A 2GDDA 1BY2A 3GY5A 4X8SH 2HNTE 3FP7E 3BTHE 3T26A 1SGEE 3KQEA 4Q80A 5F8XA 5DP5A 1BB0B 1C2FA 1S0RA 4DURA 1ZJKA 3E0NB 3K9XB 1Z6JH 2OK5A 1QHRB 3U69H 1VDDA 4OS4A 3AASA 4X1NU 2XNIA 3LGUA 4ABEA 1P01A 2SGQI 4IMZA 4YTAA 1HJ8A 4XBBA 5E3QA 1TGNA 4Q7XA 1UVUH 1Z71A 3LDXH 5FUVA 1JBUH 1C1SA 1LHGH 3M36A 1E1QD 1O2JA 3T27A 2AMDA 1FY8E 2WHXA 1SGFG 2G81E 4P00A 2WCYA 2H2ZA 1Z8JB 2VWLA 4ACAA 2O8TA 1YPHC 4A1TA 3ELAH 1J15A 1AWFH 1VITF 4L9MA 2Q6FA 4FUBA 3B9FH 4Y8ZA 2IOTA 4Y79A 3PMJA 3GYMA 4FUCA 3LJJA 2BOHB 3F9FA 1C5PA 1T7CA 2XWBI 1SLVB 2ZG0H 2QCYA 1MCVA 1C1VH 1P3EA 2KCAA 1K1OA 1GI9B 3M5NA 1QJ1B 2ZFPH 4CRBA 2ODDA 3A8BA 1O3OA 1S6HA 2JJ2D 1G36A 2L6OA 1SGEI 4DGJA 2FI4E 2QGRA 5HMAA 1BJVA 1BTYA 1MKWH 1SHHB
chains in the Genus database with same CATH topology
2R0LA 3AVZA 3VDPA 4MG3A 3ZVEA 4KTCA 1CGHA 6LPRA 1KLTA 2FX6A 1EP6A 1RRKA 3DFJA 1S82A 1AVWA 1HAVB 1PPFE 1IHTH 2VWOA 3RC5A 2D2DA 3A86A 2BTCE 3GY3A 1GJBB 4SGAE 6GCHF 3TJUA 3MH4A 2ODYB 1V2LT 4CRFA 1AVXA 6CHAB 2FIRH 2A7HA 3SGAE 2BVSH 2XC5A 2GKVA 4JCNA 3MTYA 1C2MA 3HKJB 3S0NA 2B8OH 4D7GA 1O3AA 3RXPA 1G37A 1YPGH 3GOXA 1ZMJA 2CGAA 1KLJH 4XOJA 2V6NA 1IQHA 1ZMLA 4HGUA 2Y81A 3RXVA 2P6AC 3MU4A 1RD3B 1GJ9B 3ZZAA 1K1PA 5DP9A 3F9HA 1LR9A 4TWYA 2R3UA 1DSUA 4FUJA 2A2XH 1W8BH 2UZ3A 4ABAA 2A20A 1ANEA 2EI8A 1EAXA 2H9EH 3SGQI 2ZU2A 4LOYH 2A1DB 3TGKE 4HTCH 1C2EA 1VCWA 1YPKH 3GDUA 4X2WA 3BN9A 1QBNA 1N8OB 2BDBA 3NWUA 1G2LA 1EOLA 5EPNA 3SUFA 2ZHFH 2GVFA 4Y7AA 1GHBF 1JWTA 2BDIA 1Z7KB 3PROA 2FOHA 2ZU4A 3MEKA 3MH7A 2WUCA 1NU7B 2Y82A 1TBQR 2K9HA 1KXEA 1F0RA 4I8JA 2BD2A 1FY5A 2FOBA 2LPRA 4X6OA 1PQ7A 3A7YA 2SGFI 3UWIA 1ELGA 2R9PA 1O33A 3SJKA 1O5EL 5HM2A 2GMTB 2CHAB 1LR7A 2CJIA 3TIUA 3OL0A 1QB9A 4BTIB 1RFHA 4O03A 2AMPA 3ATMA 1SSXA 3K65B 3MNXA 3VFEA 5DO4H 1BMLA 2O9QA 3CS7A 1ZZZA 1SGDE 1XXFA 1LDTT 1Z8IB 2RCEA 4ZROA 3UGLA 3LOXA 1WQVH 1SGQE 1TWXB 2A5AA 1P2IA 3OSYA 2FLBH 4GHQA 4JMYA 4TY6A 2TGTA 1P8VC 1MKWK 3E0PB 3MU0A 3S9CA 1HJAB 1BBRH 1E38B 2ZFTA 1GL0E 3UQOA 1TIOA 1BT7A 1O2SA 1XVOA 1MBQA 2GGVB 5T3HA 2RDLA 4ZXYH 1AMHA 1UK2A 2FOEA 2PKAA 5GCHG 1T8LA 4IW4E 1LPZB 1UTJA 4Q2KA 2Z9IA 5JBAS 3EA8A 2EA3A 3E90B 4HFPB 3GDSA 3SV9A 1R79A 1S5SA 1AE5A 2A45B 1U6QA 2JA1A 2F9PA 1N8OC 2XBVA 4Y6DA 2GZ8A 2AEIH 5F8TA 3PV4A 1HXFH 4AOQA 1TPAE 4YOIA 1DPOA 3F9EA 1NFXA 4UXHA 1J16A 4B76A 5A2MH 1Z8RA 1SGPI 3TJQA 4NA8A 2JH6D 2PKSC 1RFNA 2VH6A 5AVDA 4XBDA 1QB6A 5BRRE 1MUEB 4O3UA 2HLCA 3SJOA 5DG6A 2JOPA 1NY22 3BTGE 4MQAA 2I6QA 1O3DA 1F5KU 2K1QA 1BDAA 1TPPA 2QAAA 3M3TA 3NUMA 1OP2A 1OPHB 2N52A 2NWNA 2WYJA 1YLDA 2YNBA 4WH8A 4CRDA 4AYYB 1QJ7B 3SU1A 1C1UH 1PTQA 1SR5C 2G5NA 4UEHH 4IN2A 2PKAB 1TBZH 2A7JA 2F9OA 4IS5A 5DP7A 2Y5GA 3RXSA 1PQAA 5J4QA 1L4DA 4DVAU 4X2YA 2VRWB 2ZTZA 1QGFA 1AN1E 5GIBA 3SV6A 3TITA 1LHFH 4Y10E 1Y5UT 1ZPZA 3BV9B 1YLCA 4UFEH 2Z9KA 1HYLA 8GCHG 1BRBE 5A09A 1F2SE 1KY9A 4SGBI 1UVOA 3T5FH 4JZDH 1DANH 5K7RA 2VH0A 3SQEE 1QBOA 1DLEA 2B8TA 5FUYA 1NO9H 5B6OA 2PTNA 1O3LA 1QBVH 1XBTA 1L1GA 3SU5A 4FU7A 1GJCB 1V2RT 1AI8H 4I31A 2ZWLH 2A7CA 1HBTH 2IPHA 1QNJA 1K21H 1YPHE 2BX3A 2G55A 2NU1E 1OVOA 5DKMA 2KMOA 1H9IE 1T31A 4K5ZA 3ZYEA 2ZGCA 2WYGA 3B4VC 1ETTH 2ZQ1A 2C93B 3KQCA 4JCVE 1A0JA 3F6UH 5DP6A 1OSSA 2QIQA 1X74A 4PROA 4ABBA 1OWJA 2FXRA 4A92A 1A0HB 2GKTI 1O2UA 1IQKA 2NU0I 1E37B 5F6MA 2YQPA 3MNBA 1P3CA 2ZTXA 1SB1H 4X6MA 4WMDA 1A5IA 4D8NA 2QV1A 1GBDA 3GCNA 3STIA 2WPHS 4A7IB 2L8EA 1WAYB 2JZMA 1G2MA 1QL9A 1NRSH 1O32A 1Q3XA 2CMYA 1FLEE 1E36B 2BUSA 2GCTC 3A85A 4MPVA 1C2IA 1C2DA 4ZMAH 2BHGA 1TNGA 1UO6A 2ARPF 1C5ZB 1GMDG 4NIVA 1ZHPA 2NU4I 6CHAC 3GY7A 1C2JA 1HAYB 2L7XA 2F83A 2OLGA 4BXSA 1LHEH 3OXLA 2J38A 4R0IA 1C5MD 2Z3DA 1TQ0B 2GKVE 5T6DA 2A4RA 5HGGA 1HXEH 3QO6A 2ZF0H 5EU8A 3Q00A 1OYVI 1J14A 5A8YA 3SORA 5FX6A 4Y76A 1SGDI 3RC6A 4NIWA 5C5OA 1JOUB 1TPSA 1UMAH 1DXWA 2BD8A 2I6SA 1O2HA 1RIWC 1ABIH 1C5VA 1H8DH 2O8LA 3SUEA 4ABIA 2XTTB 8GCHF 3PB1E 4A5TS 1THSH 3RXJA 1O2TA 2GP9B 3TK6A 1UUCA 4IMQA 1GBTA 5FPSA 2ODPA 1HAHH 1T4VH 4Z6AH 1HFDA 1KDQB 2VVCA 3U1JB 1BIOA 1E35B 1FXYA 1IY6A 3RU0A 3OU0A 8ESTE 3P8FA 3HPTB 1GJ4H 3Q76A 5EPYA 2G00A 2RG3A 2CV3A 3RXFA 1YBWA 3RXUA 1O2ZA 3MH5A 1ZJDA 1AKSB 7LPRA 4CRAA 5DAEA 1OMTA 7GCHF 2ESTE 3MYWA 1V6DA 3P95A 2ZGXH 1ESBA 3M5OA 2VJ1A 1F7ZA 1O2XA 1GCTC 3F9GA 1GBEA 3GY6A 2FM2A 4JYVH 1TMBH 3GYLB 4IC6A 2KMRA 5L2ZH 4JK5A 3HATH 3LGWA 4AORA 1YCPH 1OWIA 2ZDNA 2P3TB 3HK6B 4WF8A 4NWKA 1BQYA 1O37A 3LGVA 1SVPA 5LPEA 4IC5A 1ZRBA 1ZR0A 1GHYH 1K22H 2CN0H 3TPIZ 3RU4D 1J9CH 2DE8A 4ZHMU 5AF9H 1CT2E 2ALPA 3KF2A 2PV9B 1CVWH 1HPTA 4U2WA 1LR8A 2ZI2H 2BB4A 2A5IA 4YLQH 2BMGB 2Y5FA 2FOGA 2HRVA 1XUFA 3IWMA 1AB9B 3FP6E 1GJAB 4GUXA 4NCYA 4XFQA 5JYIA 1B5GH 5HYOA 1SGNE 4K60A 4AFZA 4B2BA 3PLKA 1C5QA 1QA0A 2VINA 6ESTA 1AIXH 1GJ5H 1P09A 5LH8A 4K1EA 1TMUH 1KSNA 3VB7A 2Q6DA 3M5MA 3ESTA 1PPCE 4KKDA 1DWDH 1CA0C 4ABGA 1Y3XA 1EPTB 1PQ5A 1J8AA 1ELDE 5T6FA 2ROWA 1O39A 1MQ5A 1W3CA 1SFIA 2LNCA 3BF6H 1DDJA 2VWMA 1GDNA 2XC0A 1G32B 4Y71A 4CBOA 1FUJA 1IQEA 4ISHH 3I78A 1C4V2 1O2IA 1UVFA 1CT4E 2SGPE 2ANMH 1W7GH 1TBNA 1YYY1 1VGCB 1NC6A 1NFWA 3BEIB 2PGQB 1ZPBA 2QC2A 1P05A 4GLYA 1SHYA 1O2NA 2M5TA 3VGCC 1YU6C 1D9IA 1SPJA 3P70B 4A24A 1MTNB 4K8YA 2XBXA 1WCZA 1UVSH 2GCHG 3GDVA 1EJMA 1A4WH 2ZFRH 2Y80A 1TONA 5L30H 3O8RA 4LK4A 4D76A 3S7KB 1TRNA 2G4TA 4NWLA 5C2ZA 3SU6A 2J4IA 1O35A 1AGJA 2F9NA 2ZCKP 1DITH 4K2YA 2FYQA 2BQWB 1D3DB 1YKTA 1QQ4A 2A5KA 2ALVA 2JYYA 4ZKOU 3SU2A 1QIXB 1H0ZA 2GV6A 2Z9JA 2OQUA 3BG4B 4NZLA 2B5TB 2FODA 4DIHH 3U8OH 1D6RA 1O2MA 2NU2I 2YNAA 2ANWA 1HAVA 2WPKS 2R2WU 4FUEA 1O31A 3P8NA 1IW4A 3ZZBA 4WXIA 1CGIE 1PYTC 4Y8XA 1O2KA 4Y11E 1NT1A 2SGPI 1TRYA 3SV2H 2SNWA 1CE5A 2ORVA 4FUGA 4BNRA 4DY7B 4YOGA 1IQMA 3UFAA 2XBYA 1M8BA 3TNTA 1KYNA 5EQRA 4I8LA 3L6PA 3ZVFA 1M8CA 3U98H 1Z1IA 2OVOA 1OP0A 2ZIQH 1ETSH 2GMTC 1B7XB 5CE1A 1GBKA 1OWDA 1P2MA 4NA7A 3SBKA 3ZVGA 2Z9LA 1V2JT 5T6GA 3VB3A 2ZDLA 2WPLS 3IG6B 4K1SA 2P3UB 4IN1A 4CRCA 1GL1A 3NZIA 2ZDVH 1V2WT 3SN8A 1F5RA 1QRZA 4NFEA 1GI6A 1P10A 3LPRA 4M7GA 1TBRH 2BLOA 5FHTA 2PW8H 1C1OA 1V3XA 2JW6A 2ULLA 1GCDA 1LKAA 2Z7FE 1A5GH 4JZIA 1TGCA 1HRTH 3UREA 1UCYE 3ZZ5A 1DY8<