2XRCA

Human complement factor i
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
548
structure length
461
Chain Sequence
EDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAMDAERRRIKSLLPKLSCGVDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGQWGEVKLISNCSKFYGNRFYEKEMECAGTYSGGPLVCMDANNVTYVWGVVSWPEFPGVYTKVANYFDWISYHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN COMPLEMENT FACTOR I
publication title Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
pubmed doi rcsb
molecule tags Immune system
total genus 92
structure length 461
sequence length 548
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.45: Complement factor I.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00089 Trypsin Trypsin
A PF00530 SRCR Scavenger receptor cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xrcA04
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 2xrcA03
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2xrcA02
2VWMA 2G52A 4J2YB 3FP6E 1EB1H 1C5VA 1V2NT 4X6OA 4A92A 5GCHF 1M8CA 1IY5A 2ZF0H 3PMHB 1ESBA 2SNWA 3ATWA 3GCTG 1AB9B 2CGAA 2ZHWH 2RDLA 1GWAA 1A5HA 1RIWB 1MTSA 2ZC9H 3F9HA 1FY3A 2AEIH 2VGCC 1TFXA 1JOUB 2BD3A 4MNVA 4FUEA 2BZ6H 2V0BA 2ZU1A 3MH4A 1FI8A 1O2KA 4B2AA 2AMQA 1CGJE 1SSXA 2QXJA 1E38B 1A0LA 4X8SH 3NXPA 2OYAA 4AYVB 1GGDB 2V53A 1ETSH 2H9EH 2GV6A 1DX5M 1EKBB 3HH2C 1GVZA 1XUKA 2BDGA 2THFB 3MO6A 3RXCA 2AMDA 3ZVGA 1IQFA 2F9PA 4FUGA 4JYVH 1ANBA 1NRSH 3PMAB 1Y1BA 1KMAA 4ZXYH 1HAVB 1A46H 3RXOA 4D7FA 3M5LA 4VGCB 3TH3H 1NT1A 3MNBA 1UVGA 1K9OE 1UVFA 2EEKA 3MHWU 4YOIA 2QGRA 2FYRA 3VGCC 1BTHH 3QZRA 2BLOA 1JIMA 1IW4A 1ZLRA 2BD4A 4FUDA 4KP0A 3RXUA 3ODFA 4YT7H 1MTNB 3A7TA 4WXIA 1UCYK 3SJ9A 1D6WA 1RTLA 3P8GA 2D26C 1A5GH 1OVOA 4JZ1A 1DOJA 5B6OA 2VH0A 1GBIA 1OWDA 1OWIA 3V7TA 6GCHG 1O2ZA 1O3DA 1TNIA 8LPRA 5DAEA 3H7OA 3F9GA 1ETTH 1YBWA 1Z7KA 2VVCA 1FPCH 2PGQB 4MG3A 1WU1A 5TCCA 1CSOE 3I77A 4K1EA 5E8EH 3UNSA 2VIWA 1GMDG 2P93A 5CHAC 1XX9A 5ESTE 5DP8A 1TNHA 1ARBA 1IQEA 1J15A 1EZQA 1GDUA 2TPIZ 1CT4I 1ZSKA 2PKSC 3ITIA 2KMOA 4H6SB 2QC2A 4UONA 2H5DA 4FUBA 1UMAH 4HGCA 1AUTC 1BJUA 1D3QB 5IYTA 1K21H 1PYTD 1SGNI 4X2WA 4Q80A 1NO9H 4OS7A 4AB9A 1EQ9A 1SGCA 3SNBA 4Y11E 1NU7B 1K1MA 2ZGHA 4KTSA 2XC4A 4ZUHA 1SLXB 3RU4T 2IJOB 2H9HA 3SUGA 1HAZB 1Z6EA 1SGEI 2NU1E 1CE5A 2J94A 2G4UA 4CHAC 3RXFA 1SR5C 1DM4B 3A85A 3QDZB 1AE8H 1FPHH 3ZZ9A 2ODPA 3U8RH 4I7YH 2ZCLP 1SG8B 1TOMH 1FAKH 1CQQA 2J92A 1SOZA 2ARPF 2F9BH 2BY9X 5JBAS 2C3SA 3SV9A 1HFDA 1IHSH 3D23A 3IITA 1W0ZU 2A1DB 1AN1E 2ODQA 3QO6A 1UHBB 1TBQH 2VVUA 1FN8A 1LCYA 4X2VA 1WBGB 3ATLA 2W7SA 2F3CI 1W8BH 2FTLE 1L0ZA 2JOPA 3UOUA 1FDPA 1GI3A 1P05A 3LC3A 2STAE 3C27B 2Y7XA 4WMEA 1TGNA 4ZAEA 2QAAA 1D9IA 4INLA 4IBLH 1CHOF 1L1NA 1GJDB 2SGEE 3A86A 2RG3A 3S7HB 1YPJH 1BTPA 4B71A 1PPHE 2Y81A 5A8YA 5DO4H 2WPKS 3RU4D 4X6NA 1LR7A 1Z1IA 1P2JA 2A32A 2CJIA 4NA8A 1S0RA 1DWEH 3K2UA 3PLPA 1TBRR 4MVNA 1L4ZA 2PKAA 1CT2I 3A87A 5LPEA 1PPFE 2SGQE 2WUBA 2UUFB 4IN1A 1C2IA 1EP6A 3HKJB 1ZR0A 2EA3A 3SORA 2QA9E 2XRCA 1LMWB 3EA8A 1W2KH 3MU4A 2ZFTA 1Y5UT 2JA4A 5J4SA 3A8AA 1O2MA 1G3DA 3LU9B 4YO9A 4DGJA 1B0EA 1MD8A 2V3OH 1VR1H 2N71A 1UVSH 2B8OH 4AG1A 1O5EL 1OP8A 2UWLA 1TPOA 1EAXA 1CBWC 1TGSZ 3TNSA 1TX8A 1XUFA 4X1QU 1LVBA 1N8OC 3MOCA 3T27A 3KN2A 3VGCB 2FI5E 3AAVA 3GISB 1SOTA 2HLCA 1V2WT 1DS3I 1ZMLA 3T5FH 3ESTA 3K9XB 3PV4A 1C2JA 2OC8A 1QJ1B 1BMOA 2Z3CA 2XYAA 5JPMH 1GBHA 2FS9A 3NUMA 4GI3C 1KXDA 1O37A 1BUIA 1BCUH 1F5LA 3A8BA 5EXNA 5F6MA 1DS2I 1NFXA 2SGDI 4OS4A 5DP5A 1LHEH 2ASUB 1V2QT 1SFIA 1P10A 3PTBA 1UTMA 1LO6A 5EW1H 1C1VH 1MAYA 2PSXA 1IOEA 4LOYH 1FY1A 2NU3I 1D6RA 1T4UH 4YESB 2F91A 2P3TB 3BEFB 2J34A 1KLJH 4BXSA 2Z3DA 5HGGA 4HFPB 1TPPA 3RC6A 1BRUP 1DVAH 3FAOA 1K28D 2PKSB 1C9TA 3S69A 2GZ9A 2JYYA 1C2FA 3P6ZB 1C5MD 4RKJB 1V2UT 2VINA 1P2KA 3BEUA 2HOBA 1F5KU 1KXEA 1FLEE 1DXPA 4AFQA 1A3EH 1TMUH 3EQ0H 1EAIA 2SFAA 2FLRH 1J16A 2XTTB 3VFEA 2WYGA 2ANYA 1NFUA 1TIOA 4HGUA 1VGCC 2VIOA 2SNVA 5DGJA 3SN8A 3B23B 1LKBA 4R0IA 4CR9A 1GBFA 3A82A 1QRWA 1TWXB 1VCPA 1ELAA 4CRGA 3DUXH 2ZG0H 1O5FL 1W3CA 4D7GA 1W7XH 1HPGA 4NSYA 1SGDI 1GMHG 1ETRH 1ZHRA 1GCDA 1W12U 3E1XB 1E36B 1ELDE 1QJ7B 4GPGA 3SU1A 2ZWLH 3RXEA 5EG4A 3MH6A 1G32B 3ATIA 4Y10E 4UE7H 2OQUA 2RA3A 3RXSA 4TPIZ 2ZHFH 1TNLA 2G5NA 1O3GA 1A0JA 1ZJDA 1PQ8A 1PPZA 3PLBA 3A7YA 1MQ5A 4Y71A 2PUQH 4MQAA 4GHQA 1TLDA 2CN0H 4IMQA 2G8TA 4AGJA 1DPOA 5LGOA 3IG6B 4XBDA 4UFDH 2XCNA 4Y79A 1AMHA 1GMCF 1C4Y2 5L2YH 3SUEA 2KAIA 2ZFFH 3Q3KA 4Y8ZA 1C5QA 2C4FH 2OVOA 2C8WB 1NM6A 2OBOA 2XWBI 3ZV9A 3FFGA 2OY3A 1DITH 1YYY1 3MH5A 2A31A 4CBNA 1PPBH 1ZYOA 1GHAF 4X6MA 2FM2A 1DY9A 5EPYA 1D3TB 1TALA 2R0LA 1HNEE 4B76A 4Y0ZE 1ELBA 1QB1A 5T6FA 3VPKA 4X0WU 1MKXH 1CGJI 2FP7B 2F83A 1TURA 1AHTH 2A45B 1K1LA 1M9UA 2SGPE 3SNAA 2CHAB 1OMTA 5A09A 2BXUH 1P57A 3Q3XA 1THRH 1KIGH 4KTCA 1TGSI 4Q7XA 4A5TS 1IQLA 2FOHA 5JHWC 1YLCA 2FIRH 3TJNA 1BITA 1N8OB 2WPMS 2QXIA 1MBQA 2GX4A 3RXRA 3AASA 4NIYA 4ZHLU 4H4FA 2F9NA 3RXDA 1P9UA 1D3PB 1BBRE 1MKWH 4NWKA 2UUYA 1KTTB 5JBTA 3SHAH 2ZU2A 1IQIA 1GBDA 1ZGIA 3OU0A 1HAPH 3S7KB 3TJVA 4LXBH 1HJAC 5BPEA 2W7UA 2ZPRA 3ENSB 3FP7E 3MNCA 1F0UA 3PO1C 4CRDA 1GHBF 3ZZAA 4A7IB 2BZAA 2BLWA 1EP5A 1C2GA 3N7OA 1ORFA 1YPHC 3KEEA 3TH4H 4DT7B 1C1NA 1UK3A 2CXVA 5DK1A 2QYIA 3L6PA 4O97A 3BG4C 3A88A 1O2IA 1ANCA 2B5TB 1HGTH 3M7UA 3PROA 4ZROA 2A7CA 3RM2H 1HAHH 2W5EA 3BTHE 1TMTH 3A81A 3SBKA 1MT1A 2G00A 4DW2U 3U8OH 2WUCA 4U01A 4Y8YA 3Q00A 2ZP0H 1BIOA 1UTLM 3ELAH 2BY8X 1ELEE 1W7GH 3E3TA 4NZLA 1XUGA 2C93B 3T26A 2Q1JA 4HI3A 1PCEA 4AORA 2EI7A 1EZXC 1KY9A 1CE3A 3U1IB 4DOQA 1N6XA 2TGDA 5FHTA 2Z3EA 1JXPA 3RC5A 3U98H 4D8NA 1O2OA 2TGPZ 2PW8H 4ESTE 4I8LA 1IY6A 1GHZA 1QB6A 1QTFA 2QCYA 2NU1I 3VEQB 1SI5H 1TIHA 4Y7AA 2WYJA 5FCRA 6CHAC 2Y5GA 1L4DA 2WPHS 3G01A 4OGXA 1NTPA 1ELTA 1GI2A 4O9VA 5E2OA 3SQHE 1O2WA 1TX7A 4X1NU 1C4V2 5H4IB 4XBCA 1HV7A 1U6QA 4ISHH 4SGAE 3T29A 2M5XA 2PSYA 1AU8A 2AS9A 3SJ8A 1AN1I 1YPMH 1QRXA 2ERWA 1EOLA 5HM9A 1SGQE 1O0DH 1O3OA 2K1QA 5AFYH 4D9QA 1HPTA 1Z6JH 2OCVB 3GYMA 1YTPA 1PQAA 2HNTC 2FI3E 1NRNH 3BTGE 5C5NA 2Z7FE 2XBVA 2ZDAH 1TUSA 1UK4A 1FAXA 4JZEH 1TONA 1J17T 1RFNA 1WQVH 3OVOA 2SGEI 1C2EA 1ZZZA 1P9SA 1O3EA 2BUSA 1TA2A 1GBLA 1C5TA 2AMPA 1PPGE 1YM0A 5TCAA 4ABAA 3SU3A 3ZVEA 1H9HE 4ZH8A 1QFKH 1P2IA 2ZCHP 1TA6A 1FJSA 2SGQI 1F0TA 1XVOA 2D8WA 1E0FD 3GY4A 1C2KA 1WSSH 2ZFSA 1MKXK 1S84A 5A0CA 1K1IA 2AGEX 1TNGA 1C5WB 2EI8A 2ZFPH 1ZJKA 1FIWA 2UWPA 4DIIH 3O8BA 1C2DA 1AFQC 4MPXA 3GCTF 2JETC 1TNJA 1WQSA 3LKWA 4O3TA 5ABWA 1SPJA 4XFQA 1QRZA 1UUCA 3GCNA 1XUJA 1PQ7A 4Y0YE 5JB8S 2FO9A 3E8LA 1O2HA 1UCYE 3U69H 2QQDA 2V6NA 1O2JA 2O8LA 3KQDA 2ZCKP 3VB5A 3QN7A 2TBSA 4AOQA 5AVDA 2R2WU 4BAOB 1C9PA 2G55A 1O5FH 3GY2A 3PWBA 2A5AA 3CP7A 3FZDA 3PO1B 3DT0H 3SU2A 3KCGH 1K1OA 1O5AB 1MTWA 5AFZH 1OYVI 1QBVH 5GWZA 1ELFA 2BHGA 4GUXA 1NN6A 2OP9A 4O3UA 3M37A 1CA8B 3BG4B 1AWFH 1A1RA 1GPZA 1BRAA 3SGBE 5L6NH 1QBNA 1QNJA 1TRYA 1DE7H 3GY6A 2BLQA 3GDUA 1TB6H 4ISLA 3VB3A 2HALA 2UUJB 3V12A 1T8NA 2P16A 5GPIB 4X8TH 4E7RG 3LC5A 1LVOA 3V3MA 3BTME 4WMDA 5C2ZA 2FOMB 1G2MA 2ALVA 1A4WH 2JH6D 5C20A 2W3IA 1N6YA 5FPSA 5TJXA 1C5YB 1GI5A 3D65E 6GCHF 2OQ5A 2P95A 2ZTYA 4D9RA 1ZMNA 1P03A 3GY3A 2BVXH 1O2VA 1C1RA 2ZFQH 4OS6A 1HIAA 3RC4A 1L1GA 1O3KA 2NU0E 5AF9H 2GCTC 1GMDF 1DLEA 3A8CA 3B9FH 2ZDLA 2NWNA 3A7ZA 1IQHA 3LONA 1OYTH 4XE4A 1OOKB 3ATKA 3SQEE 4I32A 3TITA 1SL3A 3KIDU 5JBCS 2O8WA 1W0YH 4UFFH 1L1JA 3MO9A 1WAYB 1GG6B 1UTKA 5HYOA 3BTDE 3H5CB 1CGII 2GDEH 1KXBA 5A0BA 2FOGA 2ZHQH 3E0NB 1GJ7B 1OWKA 1NRQH 3QK1A 4ZHMU 1W10U 2WPJS 4CH8B 2AGGX 1OYQA 2QIQA 5IDKA 4JZIA 4IGDA 1FYBA 1VITH 4NG9H 3BIUH 1UO6A 3RMNH 3RXMA 1MU6B 3RXPA 2A4RA 1V3XA 1BA8B 3UY9A 2QQCA 3UNQA 4A1TA 1J14A 2UUKB 4ABIA 1P57B 2VIVA 1F7ZA 2Z9GA 3O8DA 1YCPK 2JH5D 1YPHE 3OY6U 4XBBA 2OC1A 1XMNB 2XCFA 1ANDA 5E0GA 2J2UA 3RUOA 4OGYA 1YKTA 3UREA 5A8ZA 1OP2A 1C1SA 1Q31A 2FDAA 2ZHDA 5EOKA 3SU5A 1A0HB 1P2MA 2Y82A 4CH2B 3B8JA 4WY3A 1TPSA 4GSOA 4B2CA 1GL0E 1OKXA 1O2RA 1HAYB 2VB0A 1CO7E 2QV1A 5EU8A 2G81E 3P70B 2ZQ1A 1ELCA 4ZMAH 2GDDA 1BMNH 2B9LA 1C5SA 1KXAA 1O32A 4K60A 1TE0A 1XUHA 1F0SA 2VGCB 2BVRH 3MNXA 5GDSH 1CA0C 3SU6A 4CRFA 1SGRE 3SZNA 1GJ9B 1AFQB 1EPTA 1FY8E 1HBTH 1PJUA 1C5UA 2IN2A 3ZZ6A 5FBIA 5DP4A 3VXFH 2OC0A 1C2HA 1WOFA 1T4VH 1Y3YA 1BOQA 2WV4A 2ZPQA 3VB4A 1KDQB 1O3HA 2J4IA 1SGYI 4BXWA 1MD7A 2BB4A 4E06H 3BTQE 3LDXH 4ISNA 4OS2A 1IAUA 1FIZA 5EODA 3RXLA 9ESTA 1MTUA 2FLBH 3SUFA 3SU4A 1AKSA 1NS3A 3RXHA 3P8NA 4GCHG 4ABBA 3T2NA 1O3BA 3A89A 1GL1A 1ZOMA 2FOAA 4YZUA 3B4VC 1OPHB 3ZYEA 1G3BA 5DP7A 3M35A 2HNTE 1FY4A 1GI7B 1V6DA 2DUCA 2YNAA 2HWLB 1PPCE 1O3IA 3R0FA 2ZI2H 2FS8A 2OC7A 1SGFA 2OD3B 3ZZBA 2GTBA 5DP3A 2BD7A 2SGAA 1C1TA 3DFLA 5GXPA 3F68H 1QHRB 3EGKH 1UVOA 1Y1CA 2KMRA 2GKVE 1SLWB 1ARCA 2XXLA 5C1YA 2ALPA 1SQAA 3ZYDA 4Z0KA 4IC6A 4WMFA 5CHAB 2TGAA 1T31A 4SGBE 3TK5A 1FZZA 4IC5A 3S9CA 2J9NA 1G2LA 1ID5H 1AUJA 5GIBA 3LH1A 3HPTB 3BTKE 2GCTB 2CMYA 3TVJB 4BAMB 5FCKA 4RSPA 1BBRH 1C2LA 1C5NH 3LJJA 3MU8A 3E0PB 1EX3A 1OXGA 3KQEA 5C67A 1O2LA 7LPRA 3TJOA 1WUNH 1EASA 3R3GB 2P3FH 3SEKC 2BLVA 1DY8A 3A7XA 2N17A 2AFQB 2Q6DA 5AHGH 3KF2A 2V35A 3T28A 2TGTA 1ZHPA 1LPGB 2R2MB 1HAVA 1Y5BT 4CHAB 5F8TA 3PYHA 4IN2A 2ULLA 4FU8A 1NPMA 1SGQI 1QA0A 4BANB 1NRPH 3CS0A 1EUFA 2H5CA 1A7SA 1D4PB 1WYKA 3RP2A 5K0HA 1GHWH 2BDAA 3H7TA 2AYWA 8ESTE 9LPRA 2OTTX 3T62A 1MCVA 4IS5A 3URDA 2GD4B 3K65B 1SGIB 1ELVA 3KQCA 1GMHF 1OWEA 2FODA 4B1TA 1EPTC 3LGVA 1GHYH 3TK9A 1O2PA 1XUIA 1FV9A 2ZTXA 2ZDKA 4ABGA 1C1QA 2FOBA 2BMGB 2FI4E 5ETXA 2ZU4A 1F92A 3ZZ3A 4ZKOU 1QA7A 1LQEA 1BB0B 2GMTC 1V2MT 5ESBA 4ABFA 1GCTC 4K69A 1SGEE 1O31A 1GJ4H 2OINA 1KSNA 1A5IA 1ZHMA 3E91A 1H4WA 1TGTA 1TYNA 4MPVA 1HB0B 4GHTA 1TAWA 4NFFA 2LEOA 4NGAH 1Y3UA 3SI3H 1DLKB 1CA0B 4ABHA 1BTZA 3C1KA 4B73A 5L30H 3BV9B 4IW4E 4DG4A 2VIDA 2AIPA 3BTTE 3FVFB 4MPWA 2A4QA 1T8LA 5E0HA 3RLYH 1P0SH 1GBTA 2A2XH 1GVLA 3ZZ8A 1EOJA 3KQBA 3STJA 1B5GH 1C1UH 4Q2KA 3M5NA 2OXSA 2GKRI 2BD8A 1GBKA 3UFAA 1IQKA 2ZEBA 1S85A 3BIVH 3TLOA 2IPHA 1H9LB 3S9BA 2EC9H 1PYTC 1Z7KB 4FUIA 1YF4A 1EB2A 1CBWB 3E6PH 1IQJA 1MU8B 1KLTA 2BY7X 2ZDNA 4CRBA 2HRVA 3UR9A 1PPEE 2NU2E 2UWOA 3BG8A 1H1BA 3BSQA 1FNIA 4Y8XA 1SGPE 1AD8H 3TNTA 3KL6A 1AB9C 3SUDA 3F1SB 2FEQH 1GBCA 3EAJA 5EGMA 5EQQA 1ACBE 2PTCE 2PUXB 3PWCA 4ISIH 1K2I1 2W3KA 2B0FA 1UHBA 3MMGA 3I78A 1M8BA 3SNCA 1KXCA 3SGBI 1GDQA 3L33A 5EQSA 1Q2WA 3WY8A 1YP9A 2HPPH 4WH6A 3TGIE 5DP6A 4NIWA 2WPIS 3SI4H 1K1JA 1F5RA 1GGDC 1BMLA 2JKHA 1O36A 2NU4E 5JYIA 4AX9H 3RMLH 2HPQH 4NA7A 3TGKE 2TIOA 4F49A 1EJAA 1JMOH 2A2QH 4NZQA 1TX6A 1JBUH 3LOXA 2RA0A 4UFGH 1TBQR 1CSOI 2FXRA 2OTVA 3A83A 1F0RA 4LK4A 2FMJA 1SMFE 1P2OA 1YCPM 2PLXA 1THSH 1DWDH 3GDVA 2OLGA 1FY5A 4VGCC 5FX6A 5HMAA 1AZ8A 1NU9A 1Y3XA 2I6QA 1CT0E 4WXVA 1WV7H 1LHDH 1HAOH 2J95A 1WTGH 1C5LH 2QY0B 2XC0A 1HRTH 1VCWA 1NUBA 1BY2A 5GJ4B 2WV5A 1MTNC 1ZGVA 2HGTH 3JZ2B 4INHA 1ZPBA 1ESTA 1BRBE 3BTEE 3RMMH 3RXGA 3QUMP 1W13U 3URCA 1AVWA 3MU1A 3HATH 1VGCB 3GY8A 3MI4A 1ELGA 3AW0A 1QB9A 4FVBA 5K7RA 1GI0A 4LZ1H 3ZZ4A 2ZTZA 2BY6X 2GKTI 2ZU3A 4I31A 1O3CA 1TBRH 5PTPA 1Z1JA 3BTWE 4ZKSU 1TQ7B 5DJ7A 2XBWA 3P92A 4ISOA 2PFEA 2ZGJA 2P59A 2AGIX 5E0JA 4DCDA 2R9PA 1IQGA 1Z8GA 4I8JA 1HJ9A 3GICB 5C1XA 1O3NA 2ANWA 3AAUA 1UTJA 2M5TA 2VU8E 1GBMA 5EW2H 1Z8RA 2PGBB 3HGNA 4TWYA 4YM9A 1DXWA 3PMBB 2ZGXH 2PKAB 2DE9A 8GCHG 3D49H 1JRTA 4Q7YA 1TNKA 1ZRBA 3RXQA 2N52A 5C5OA 1P8VC 1LPZB 2ZGBH 4X6PA 1SLUB 1Y3WA 4JMYA 1GCTB 3SV7A 3LGYA 1AQ7A 4A1XA 4AN7A 3VB6A 1PQ5A 1OSSA 4JZFH 2ILNA 1TQ0B 1YU6C 1B0FA 1IQNA 1VJAU 2ZU5A 1J8AA 1V2VT 2C90B 1O35A 5HM2A 3LGIA 4NSVA 2Z9IA 3MU0A 2FOEA 1O3PB 5FX5A 1S83A 3ZZCA 1ZSLA 3UQVA 1LPKB 4K1TA 1QQUA 2ZA5A 1GJ5H 1KXFA 1PPFI 5EQRA 1E37B 5T6DA 2A4GA 3M3VA 1ZPZA 1DFPA 1X7AC 2CF9H 2H1UA 2W26A 2H6MA 1O5CB 1XKBC 3ODDA 3TGJE 4A6LA 3UNRA 1YLDA 1HXFH 5GCHG 2Y5HA 2LNCA 3P95A 3LT3A 1P01A 2C8ZB 1C2MA 1SC8U 4I8HA 1QCPA 1GI8B 3NWUA 5EXMA 3GYLB 4K8YA 1AI8H 1O2NA 5F8ZA 1O3LA 1OWJA 5L2ZH 2BD5A 1EJMA 4MPUA 3ZVFA 2DE8A 4FUFA 2GCHG 3MH7A 5T6GA 4FXGH 3STIA 1SGTA 1MKWK 1DT2A 1C4U2 3GCHC 2AERH 1YPKH 1LVYA 1MQ6A 1QY6A 2GV7A 1UVUH 2BOKA 1HJAB 2GCHF 3UWIA 3M61U 4BAKB 5A0AE 2YOLA 4DIHH 1BTXA 3QTLD 1NFYA 2G4TA 4DVAU 2ZIQH 2PR3A 1BUSA 1EAWA 1UTOA 3GY5A 2KCXA 4FUHA 3GOVB 1JIRA 3EA9A 3TK6A 4NIVA 4THNH 4A1VA 4SGBI 1BTWA 4YLQH 1GJAB 2XNIA 4LZ4B 2ZDVH 2SGFE 1CU1A 3BF6H 1P02A 1A61H 2ZPSA 4Y6DA 3LGWA 1O39A 5EXLA 4QT8C 3QLPH 1G36A 5JB9S 1ABJH 2WPLS 3DD2H 5BRRE 3TIUA 5LPFA 3Q76A 1G3CA 1AY6H 3LH3A 3QX5H 3RXTA 2BXTH 4GLYA 1J9CH 3UUZA 2A5IA 2EI6A 4X8VH 3UQOA 1AO5A 4MNXA 4XSKU 1WCZA 1AE5A 3S0NA 1Q3XA 1ANEA 3MO3A 1P04A 1DUAA 2XBYA 5FXLA 1DSTA 5FAHA 4HTCH 3HK3B 2AIQA 3SOSA 1O30A 2PWXA 1O5DH 3UR6A 4B2BA 1T32A 1LVMA 3RMOH 1MH0A 3GDSA 1Z71A 1QR3E 1RRKA 3GY7A 1INCA 2LPRA 1S81A 6CHAB 1MZDA 2BY5X 1R0RI 2BQ6B 2I6SA 1K1NA 2ODYB 2O8UA 2CF8H 2KAIB 4X2YA 3RXAA 2BDIA 1C5PA 2GZ7A 1OWHA 2XC5A 1AGJA 2F9OA 4Z6AH 1BTYA 2ANMH 1HAXB 1K1PA 5LPRA 2STBE 3DHKH 1EATA 3K6YA 2A4OA 2O9QA 1C1WH 2BD9A 4OS1A 4DJZB 4RKOB 3EDXB 2G5VA 1FMGA 4IMZA 5T3HA 1GI4A 3PM3A 2VWLA 3SJOA 4UD9H 2Y7ZA 4BTTB 2OBQA 4NA9H 1EXFA 1BMAA 2Z9LA 4DY7B 1MMJN 3S9AA 1LR8A 2VH6A 1O2GH 4WWYA 4MTBA 4MDSA 3SV8A 2ZNKH 1EZUC 1S6FA 2BDYA 1NZQH 1S82A 1QIXB 2FWWA 1NESE 1V2JT 2FX6A 5FPYA 1BJVA 1SHHB 3A7VA 1KLIH 3T25A 3ZVBA 3UIRA 3V0XA 4AZ2B 3SU0A 1HXEH 1TGBA 1CHGA 1UTPA 1ZMJA 1QL8A 3RLWH 2ANKH 4CR5A 1SFQB 2B7DH 1YPEH 3M36A 4KTUA 3SO3A 1XXFA 3VB7A 1H0ZA 3SGQE 3VXEH 1TPAE 1ZTKA 2JH0D 2ZECA 3E16B 1CHOG 3RU4E 4XDEA 2SGPI 2BD2A 1O3JA 4JK5A 2OUAA 4WH8A 2GGVB 1LHGH 1P12E 1QURH 3NK8A 5JBBS 3UWJH 3F6UH 3I29A 4UEHH 4YTAA 2JETB 3EE0B 1HAIH 4YT6H 1S0QA 3MNSA 4R8TB 3ZV8A 1LTOA 1BTUA 3P8FA 2NU2I 5A2MH 1IHTH 2FESH 4H42U 2BTCE 1SGPI 3QGNB 1P3CA 2VJ1A 5FBEA 2FZZA 2JZMA 2P94A 5CMXH 1SQTA 3GCHB 4ABEA 3LIWA 1GBJA 2P8OC 5HXFA 4X1PU 3D62A 3MWIU 1V2KT 7ESTE 3A7WA 3U9AH 2Y80A 2VIPA 2BX3A 4AFSA 1SB1H 1W11U 2HVXA 1W14U 2JXDA 1BDAA 1AVGH 1ESAA 2NU4I 3O8RA 1AVXA 2F9VA 2AH4X 4K3JA 4TY6A 1V2RT 3Q3YA 3QZQA 3P17H 2CHAC 1RGQA 1DUEA 1HLTH 2IOTA 1H9IE 1C1MA 1NROH 3MU5A 3TJUA 4OS5A 2QF3A 1ZPCA 4UDWH 1C5ZB 4UFEH 3RXKA 4AGKA 1O3AA 8KME2 2ESTE 4AB8A 1O2XA 2O8TA 4GCHF 4K2YA 4K5ZA 4U2WA 1L2EA 2Z9JA 1CT0I 1O38A 1P3EA 6ESTA 3M5MA 1GHVH 2P3UB 2WINI 4NFEA 3M7TA 1A2CH 1MAXA 1P2QA 1Y59T 3F9EA 1DWCH 1THPB 3BN9A 2VWNA 2KMQA 1G30B 3NZIA 1BHXB 3OTJE 4B75A 1UK2A 3JZ1B 4KELA 3LGUA 4TY7A 2ZZUH 4WVPE 1Z8IB 2BDHA 1AFEH 2F9UA 2PV9B 1GDNA 2BX4A 3DFJA 4BTIB 1GVKB 4INKA 3F9FA 3UPEA 1YPLH 4WJG2 1JWTA 2QXHA 3SNDA 2G51A 4CRAA 3QTOH 1O2SA 4I33A 1XXDA 4E7NA 1BZXE 1P06A 3ZVCA 1O5BB 1OS8A 1GJCB 4BAHB 5DKMA 7GCHG 1ZTJA 1MTVA 1QL7A 3A84A 3ATMA 3M3SA 1CVWH 1XVMA 1AIXH 1SGFG 1PFXC 5EPNA 1GHXH 3BTFE 4Y7BA 2BDBA 5LH8A 4BNRA 3LPRA 7GCHF 5C3NA 3UOPA 1OMUA 1VZQH 3NPSA 1N1LA 4X1RU 4YLUA 1GBEA 1VJ9U 1ZRKA 2KMPA 5F8XA 3P8OA 1OP0A 3HK6B 1ZTLA 1BT7A 1H8DH 3ZVDA 4JYTA 1BMMH 1CT4E 5A8XA 1HAGE 4FUJA 1HDLA 1P09A 1SQOA 1V2LT 3TPIZ 1GI6A 1MCTA 2WCYA 5I25A 1O33A 1SGNE 2Z94A 1HUTH 3W95A 2A7HA 3KGPA 4E05H 4KKDA 4M7GA 1Y3VA 3LJOA 2JP0A 3E90B 3MYWA 4X1SU 1CGIE 3AVZA 4D76A 1Z8JB 1CHOI 1S5SA 4BOHA 1GBAA 3OX7U 4I8KA 3Q77A 1G9IE 3SJIA 4BTUB 4NCYA 4B74A 3CS7A 3FZZA 2ZFRH 2BQWB 1AWHB 1GMCG 2GT8A 3EA7A 3ZZ7A 4JCNA 3ZZ5A 1ABIH 2QF0A 1RJXB 2GZ8A 5E2PA 2VVVA 1LHFH 1EZSC 3M3TA 3ZVAA 3V13A 2ZGCA 1C5OH 3NKKA 1GJ6A 2GVFA 1SHYA 3TH2H 4O03A 1XKAC 1Y5AT 1MUEB 2R3YA 4X2XA 1GHAG 1RS0A 2FPZA 1O34A 5DP9A 2F3CE 4I8GA 1LKAA 2Q6FA 3UTUH 3HGPA 1V2PT 4F4OC 1HYLA 1C5RA 2CV3A 1K22H 2XBXA 3ZZDA 1UVPA 4NIXA 4MLFB 5SGAE 1Y8TA 4HZHA 1GJBB 2P8OB 1WTHD 1NY22 3SGAE 3SV6A 2A0QB 1T8MA 4U30A 2ZHEH 1O5GH 4Y76A 3L3TA 5CE1A 1V2ST 3RDZA 1MBMA 3SHCH 4YOJA 5G4BA 1YPGH 4FU7A 1D3DB 2D1JA 1C5XB 4AFUA 3SV2H 1RIWC 4DURA 1HIAB 4RN6A 4MNWA 5DPAA 1CT2E 1FUJA 2GKVA 2BDCA 1AZZA 4OVOA 4ZKRU 3IWMA 1SVPA 3SW2B 2SGFI 1CGHA 2PTNA 1KYNA 1LHCH 1NFWA 5JDUB 1SGYE 1KTSB 1S6HA 3DA9B 1HDTH 1FN6A 1QBOA 1YC0A 2Z9KA 4FVDA 2ZQ2A 1RXPA 4WF8A 3RXIA 1GHBG 3M5OA 1JRSA 3M7QA 1QQ4A 4ZHAA 4ABDA 5C1UA 1QJ6B 1H8IH 3QGJA 4K1SA 4U32A 2C8XB 2VIQA 1SBWA 4ABJA 1UVTH 2BQ7B 1SLVB 3LGTA 4K8BA 1GI9B 4GVUA 2R0KA 2HNTF 4PROA 1PJPA 2FX4A 3O8CA 3U8TH 1XM1A 1RD3B 4CBOA 1TMBH 1BQYA 1UTQA 2NU0I 3W94A 5F03A 1IQMA 1OX1A 4ZKNU 3BEIB 4FUCA 3TU7H 2H9TH 3RXJA 1UCYH 3QTVH 2ZO3H 1G37A 4JYUH 1BBRK 2BOHB 4JK6A 2GP9B 3RXVA 3U1JB 1V2TT 2Y5FA 1DANH 1T8OA 1KDQA 2P6AC 2J38A 1DS2E 1GJ8B 2A5KA 2QN5T 3A8DA 2SGDE 3EYDA 4YOGA 1G3EA 5J4QA 1C1OA 4AG2A 2Y6TA 2BVSH 1QGFA 5FPTA 3RM0H 4JZDH 1VITG 2NU3E 3NCLA 4Q7ZA 2XW9A 4TPYA 1E34B 1HCGA 1O2YA 3FP8E 1VCQA 1DWBH 4MNYA 1FONA 1FXYA 4TYDA 3FANA 2RCEA 1TOCB 2VNTA 1MZAA 4TWWA 1VITF 2O8MA 1EAUA 3OY5U 4X8UH 4XOJA 1HJAI 1FQ3A 1F2SE 3PMJA 5DG6A 3PTNA 2H2ZA 1EJNA 3OYPA 3PLKA 4AFZA 1BRCE 1EPTB 4H6TA 1DSUA 3HKIB 1T7CA 2Z6BD 1DICA 3GCOA 1RTFB 2D2DA 1N13A 1RTKA 1TRNA 1TBZH 2BM2A 1LDTT 3AW1A 4ZXXH 3A80A 3MFJA 2Q6GA 1TRMA 2GMTB 1GG6C 7KMEH 8GCHF 2QXGA 3CENA 2FYQA 1O5EH 4AYYB 3MTYA 3TJQA 2C8YB 2A7JA 2XWAA 3SJKA 4BAQB 3SGQI 2VWOA 2YNBA 4CREA 1UJ1A 2FOFA 1P2NA 6LPRA 3SNEA 2FOCA 2B0UC 1O3FA 1SGDE 1AKSB 4ASHA 1SGRI 3K6ZA 1HJ8A 2V3HH 1C1PA 3KNXA 2GT7A 3QWCH 1B7XB 1O2UA 1GBBA 1O2QA 1P11E 1TABE 3PB1E 1ZSJA 1YCPH 2R3UA 1LQDB 3RXBA 1GI1A 4CRCA 5JFBA 1DDJA 2BYAX 1O3MA 1YGCH 2TRMA 1UTNA 3OSYA 1E35B 5I46H 3KHVA 2PHBA 4J1YA 4KGAA 2ZDMA 4FU9A 1A3BH 1O2TA 2FTMA 1NRRH 2ZKSA 1TGCA 1BHXF 1V2OT 1LR9A 4GAWA 4NWLA 1QL9A 1NC6A
chains in the Genus database with same CATH superfamily
2VWMA 2G52A 4J2YB 3FP6E 1EB1H 1C5VA 1V2NT 4X6OA 4A92A 5GCHF 1M8CA 1IY5A 2ZF0H 3PMHB 1ESBA 2SNWA 3ATWA 3GCTG 4ZCNA 1AB9B 2CGAA 2ZHWH 2RDLA 4B6FA 1GWAA 1A5HA 1RIWB 1MTSA 2ZC9H 3F9HA 1FY3A 2AEIH 2VGCC 5KGOA 5CHBA 1TFXA 1JOUB 2BD3A 4MNVA 4FUEA 2BZ6H 2V0BA 2ZU1A 3MH4A 1FI8A 1O2KA 4B2AA 2AMQA 1CGJE 1SSXA 2QXJA 1E38B 1A0LA 4X8SH 3NXPA 2OYAA 4AYVB 1GGDB 2V53A 1ETSH 2H9EH 2GV6A 1DX5M 2RDEA 1EKBB 3HH2C 1GVZA 1XUKA 2BDGA 2THFB 3MO6A 3RXCA 2AMDA 3ZVGA 1IQFA 2F9PA 4FUGA 4JYVH 1ANBA 1NRSH 3PMAB 1Y1BA 1KMAA 4ZXYH 1SKYE 1HAVB 1A46H 3RXOA 4D7FA 3M5LA 4VGCB 3TH3H 1NT1A 3MNBA 1UVGA 1K9OE 1UVFA 2EEKA 3MHWU 4YOIA 2QGRA 2FYRA 3VGCC 1BTHH 3QZRA 5EJ1A 2BLOA 1JIMA 1IW4A 1ZLRA 2BD4A 4FUDA 4KP0A 3RXUA 3ODFA 4YT7H 1MTNB 3A7TA 4WXIA 1UCYK 3SJ9A 1D6WA 1RTLA 3P8GA 2D26C 2QQEA 1A5GH 1OVOA 4JZ1A 1DOJA 5B6OA 2VH0A 1GBIA 1OWDA 1OWIA 3V7TA 6GCHG 1O2ZA 1O3DA 1TNIA 8LPRA 5DAEA 3H7OA 3F9GA 1ETTH 3UEYA 1YBWA 1Z7KA 2VVCA 3WW7A 1FPCH 2PGQB 4MG3A 1Z2IA 1WU1A 5TCCA 2WVJA 1CSOE 3I77A 4K1EA 5DSFA 5E8EH 3UNSA 2VIWA 1GMDG 2P93A 5CHAC 1XX9A 3TO9A 5ESTE 5DP8A 1TNHA 1ARBA 1IQEA 1J15A 1EZQA 1GDUA 3N99A 2TPIZ 2K0QA 1CT4I 1ZSKA 2PKSC 3ITIA 2KMOA 4H6SB 2QC2A 4UONA 2H5DA 4FUBA 1UMAH 4HGCA 1AUTC 1BJUA 1D3QB 5IYTA 1K21H 1PYTD 1SGNI 4X2WA 4Q80A 1NO9H 4OS7A 4AB9A 1EQ9A 1SGCA 3SNBA 1BMFD 4Y11E 1NU7B 2F43B 1K1MA 2ZGHA 4KTSA 2XC4A 4ZUHA 1SLXB 3RU4T 2IJOB 2H9HA 3SUGA 1HAZB 1Z6EA 2WV9A 2NU1E 1SGEI 1CE5A 2J94A 5J8FA 2G4UA 4CHAC 3RXFA 1SR5C 1DM4B 3A85A 3N7DA 3H09A 3QDZB 2E73A 1AE8H 1FPHH 3ZZ9A 2ODPA 3U8RH 4I7YH 2ZCLP 1SG8B 1TOMH 1FAKH 1CQQA 2J92A 4F55A 1SOZA 2ARPF 2F9BH 2BY9X 5JBAS 1TOTA 2C3SA 3SV9A 1HFDA 1IHSH 3D23A 3IITA 1W0ZU 2A1DB 1AN1E 2J98A 2ODQA 3QO6A 1UHBB 1TBQH 2VVUA 1FN8A 1LCYA 4X2VA 1WBGB 3ATLA 2W7SA 2F3CI 1W8BH 2FTLE 1L0ZA 2JOPA 3UOUA 3UOEA 2HLDD 1FDPA 1GI3A 1P05A 3LC3A 2STAE 3C27B 2Y7XA 4WMEA 1TGNA 4ZAEA 2QAAA 1D9IA 4INLA 4IBLH 1CHOF 1L1NA 1GJDB 2SGEE 3A86A 1QZ8A 2RG3A 3S7HB 1YPJH 1BTPA 4B71A 1PPHE 2Y81A 5A8YA 5DO4H 2WPKS 3RU4D 4X6NA 1LR7A 1Z1IA 1P2JA 2A32A 2CJIA 4NA8A 1S0RA 1DWEH 4DNCA 3K2UA 3SZEA 3DSPA 3PLPA 1TBRR 4MVNA 1L4ZA 2PKAA 1CT2I 2KX4A 3A87A 5LPEA 1PPFE 3WWBA 2SGQE 2WUBA 2UUFB 4IN1A 1C2IA 1EP6A 3HKJB 1ZR0A 2EA3A 3SORA 2QA9E 2XRCA 1LMWB 3EA8A 1COWD 1W2KH 1RFHA 3MU4A 2ZFTA 1Y5UT 2JA4A 5J4SA 3A8AA 1O2MA 1G3DA 4P02A 2KCYA 3LU9B 4YO9A 4DGJA 1B0EA 1MD8A 2V3OH 1VR1H 2N71A 1UVSH 2B8OH 4AG1A 1O5EL 1OP8A 2UWLA 1TPOA 1EAXA 1CBWC 1TGSZ 3TNSA 1TX8A 1XUFA 3EE7A 3W1EA 4X1QU 1LVBA 1N8OC 3MOCA 3T27A 3KN2A 3VGCB 4Q4LA 2FI5E 2WPDD 3AAVA 3GISB 1XA6A 1SOTA 2HLCA 5FUYA 1V2WT 1DS3I 1ZMLA 2DKVA 3T5FH 2L74A 3ESTA 3K9XB 3PV4A 1C2JA 2OC8A 2VBCA 1QJ1B 1BMOA 2Z3CA 2XYAA 5JPMH 5EJLA 1GBHA 1UW7A 2FS9A 3NUMA 4GI3C 1KXDA 1O37A 1BUIA 1BCUH 1F5LA 3A8BA 5EXNA 5F6MA 1DS2I 1NFXA 2SGDI 1E1RD 4OS4A 5DP5A 1LHEH 2ASUB 3OXGA 1V2QT 1SFIA 1P10A 3PTBA 1UTMA 1LO6A 5EW1H 1C1VH 1MAYA 2PSXA 1IOEA 4LOYH 3CNRA 1FY1A 2NU3I 1D6RA 1T4UH 4YESB 2F91A 2P3TB 3BEFB 2J34A 1KLJH 2WSSD 4BXSA 2Z3DA 5HGGA 4HFPB 4I86A 2K8IA 1TPPA 3RC6A 1BRUP 1DVAH 3FAOA 2HVYB 1K28D 2PKSB 1C9TA 3S69A 5CCMA 2GZ9A 2JYYA 1C2FA 3P6ZB 1C5MD 4RKJB 5EIYA 1V2UT 2J5UA 2VINA 1P2KA 3BEUA 2HOBA 1F5KU 1KXEA 3FOAA 1FLEE 1DXPA 4AFQA 1A3EH 1TMUH 3EQ0H 1EAIA 2SFAA 2FLRH 1J16A 2XTTB 3VFEA 2WYGA 2ANYA 3PRDA 2JJ2D 1NFUA 1TIOA 4HGUA 1VGCC 2VIOA 2AHME 2SNVA 5DGJA 3SN8A 3B23B 1LKBA 4R0IA 4CR9A 1GBFA 3A82A 1QRWA 1TWXB 1VCPA 1ELAA 4CRGA 3DUXH 1XBTA 2ZG0H 1O5FL 1W3CA 4D7GA 1W7XH 5C17A 1HPGA 4NSYA 1SGDI 1GMHG 1ETRH 1ZHRA 1YWUA 1GCDA 1W12U 3E1XB 1E36B 2ELIA 1ELDE 1QJ7B 4GPGA 3SU1A 2ZWLH 3RXEA 5EG4A 3MH6A 1G32B 3ATIA 4Y10E 4UE7H 2OQUA 2RA3A 3RXSA 4TPIZ 2ZHFH 1TNLA 2G5NA 1O3GA 3DSOA 1A0JA 1ZJDA 1PQ8A 1PPZA 3PLBA 3A7YA 1MQ5A 4Y71A 2PUQH 4MQAA 4GHQA 1TLDA 2CN0H 4IMQA 2G8TA 4AGJA 2JIZD 1DPOA 5LGOA 3IG6B 3OTPA 4XBDA 4UFDH 3WWFA 2XCNA 4Y79A 3R5DA 1AMHA 1GMCF 1C4Y2 5L2YH 3SUEA 2KAIA 2ZFFH 2DIPA 3Q3KA 4Y8ZA 5KECA 1K0HA 1C5QA 2C4FH 2VRWB 2OVOA 2C8WB 1NM6A 2OBOA 2XWBI 3ZV9A 3FFGA 4JCVE 2OY3A 1DITH 1YYY1 3FKSD 3MH5A 2A31A 4CBNA 1PPBH 1ZYOA 1GHAF 4X6MA 2FM2A 1DY9A 5EPYA 1D3TB 1TALA 2R0LA 1HNEE 4B76A 4Y0ZE 1ELBA 1QB1A 5T6FA 3VPKA 4X0WU 1MKXH 1CGJI 2FP7B 2F83A 1TURA 1YY3A 1AHTH 1P9GA 2A45B 1K1LA 1M9UA 2SGPE 3SNAA 2CHAB 5FUVA 1OMTA 5F53A 5A09A 2BXUH 1P57A 3GOXA 2CK3D 3Q3XA 4E1RA 1THRH 1KIGH 4KTCA 3FN8A 1TGSI 4Q7XA 4A5TS 1IQLA 2FOHA 5JHWC 1YLCA 2FIRH 3NRLA 3TJNA 1BITA 1N8OB 2L7XA 2WPMS 2KM0A 2QXIA 1MBQA 2GX4A 3RXRA 3OFND 3AASA 4NIYA 4ZHLU 4H4FA 2F9NA 3RXDA 1P9UA 3PRBA 1D3PB 1BBRE 1MKWH 4NWKA 2UUYA 1KTTB 5JBTA 3SHAH 2ZU2A 1IQIA 1GBDA 1ZGIA 3OU0A 1HAPH 3S7KB 3TJVA 4LXBH 1HJAC 5BPEA 2W7UA 2ZPRA 3ENSB 3FP7E 4Z1MD 3MNCA 1F0UA 3PO1C 4CRDA 1GHBF 3ZZAA 3RU0A 4A7IB 2BZAA 5C0UA 2DB6A 2BLWA 1EP5A 1C2GA 3N7OA 1ORFA 1YPHC 3KEEA 3TH4H 4DT7B 1C1NA 1UK3A 2CXVA 5DK1A 2QYIA 3L6PA 4O97A 3BG4C 3A88A 1O2IA 1ANCA 2B5TB 1HGTH 2CWGA 3M7UA 3PROA 2IJD1 4ZROA 2A7CA 3RM2H 1HAHH 2W5EA 3BTHE 1TMTH 3A81A 3SBKA 1MT1A 2G00A 4DW2U 3U8OH 2WUCA 4U01A 4Y8YA 1V1IA 3Q00A 2ZP0H 1BIOA 1UTLM 2QPOA 3ELAH 2BY8X 1ELEE 1KBFA 2YMSB 1W7GH 3E3TA 2PQ8A 4NZLA 1XUGA 2C93B 3T26A 2Q1JA 4HI3A 1PCEA 1U5KA 4AORA 2EI7A 1EZXC 1KY9A 1CE3A 3U1IB 4DOQA 2FNFX 1N6XA 2TGDA 5FHTA 2Z3EA 1JXPA 3RC5A 3U98H 4D8NA 1O2OA 2TGPZ 3UEJA 2PW8H 4ESTE 4I8LA 1IY6A 1GHZA 1QB6A 1QTFA 2QCYA 2NU1I 3VEQB 1SI5H 1TIHA 4Y7AA 2WYJA 5FCRA 6CHAC 2Y5GA 1L4DA 2WPHS 3G01A 4OGXA 1NTPA 1ELTA 1GI2A 4O9VA 5E2OA 3SQHE 1O2WA 1TX7A 4X1NU 1C4V2 5H4IB 4XBCA 4B6EA 1HV7A 1U6QA 4ISHH 4SGAE 3T29A 2JDID 1XX6A 2M5XA 2PSYA 1AU8A 2AS9A 1OHHD 3SJ8A 1AN1I 1YPMH 1QRXA 2ERWA 1EOLA 5HM9A 1UHAA 1SGQE 1O0DH 4ACAA 1O3OA 2K1QA 5AFYH 4D9QA 2OU2A 1HPTA 1Z6JH 2OCVB 3GYMA 1YTPA 1PQAA 2HNTC 2FI3E 1NRNH 3BTGE 5C5NA 2Z7FE 2XBVA 2ZDAH 1TUSA 1UK4A 1FAXA 4JZEH 1TONA 1J17T 1RFNA 1WQVH 3OVOA 1K7VA 2SGEI 1C2EA 1ZZZA 2M2AA 1P9SA 1O3EA 2BUSA 3VG8A 1TA2A 1GBLA 1C5TA 2AMPA 1PPGE 1YM0A 5TCAA 4ABAA 1WDIA 3SU3A 3ZVEA 1H9HE 4ZH8A 1QFKH 1P2IA 2ZCHP 1TA6A 2OZUA 1FJSA 2SGQI 1F0TA 1XVOA 2D8WA 1E0FD 3GY4A 1C2KA 1WSSH 2ZFSA 1MKXK 1S84A 5A0CA 1K1IA 2AGEX 1TNGA 2KCPA 1C5WB 2EI8A 2ZFPH 1ZJKA 1FIWA 2UWPA 4DIIH 3O8BA 1C2DA 4UXIA 1AFQC 4MPXA 3GCTF 2JETC 1K7TA 1TNJA 1WQSA 3LKWA 2V1CA 4O3TA 5ABWA 1SPJA 4XFQA 1QRZA 1UUCA 3GCNA 1XUJA 2YMSD 2KR7A 1PQ7A 4Y0YE 5JB8S 2FO9A 3E8LA 4XD7D 1O2HA 1UCYE 3U69H 3QAHA 2QQDA 2V6NA 1KBEA 1O2JA 2O8LA 3KQDA 2ZCKP 3VB5A 3QN7A 2TBSA 4AOQA 5AVDA 2R2WU 4BAOB 1C9PA 2G55A 1O5FH 3GY2A 3PWBA 2A5AA 3CP7A 3FZDA 3PO1B 3DT0H 9WGAA 2JA1A 3SU2A 3KCGH 1K1OA 1O5AB 1MTWA 5AFZH 1OYVI 1QBVH 5GWZA 1ELFA 2BHGA 4GUXA 1NN6A 5E3PA 2XOKD 1WXRA 2OP9A 4O3UA 3M37A 1R79A 1CA8B 3BG4B 1AWFH 1A1RA 1GPZA 1BRAA 3FSYA 3SGBE 5L6NH 1QBNA 1QNJA 1TRYA 1DE7H 3GY6A 2BLQA 3GDUA 1TB6H 4ISLA 3VB3A 2HALA 2UUJB 2CWHA 2JW6A 3V12A 1T8NA 2P16A 5GPIB 1E79D 4X8TH 3UB0A 4E7RG 3KYGA 3LC5A 1LVOA 3V3MA 3BTME 4WMDA 5C2ZA 2FOMB 1G2MA 2ALVA 1A4WH 2JH6D 5C20A 2W3IA 1N6YA 5FPSA 5TJXA 1C5YB 1GI5A 3OL0A 3D65E 6GCHF 2OQ5A 2P95A 2ZTYA 4D9RA 1ZMNA 1P03A 3GY3A 2BVXH 2RIJA 7WGAA 1O2VA 1WGCA 1C1RA 2ZFQH 4OS6A 1HIAA 3RC4A 1L1GA 1O3KA 2NU0E 5AF9H 2GCTC 1GMDF 1DLEA 3A8CA 3B9FH 3DCLA 2ZDLA 2NWNA 4ASUD 3A7ZA 1IQHA 3LONA 1OYTH 2ORWA 2W6ID 4XE4A 1OOKB 3ATKA 3SQEE 2KFWA 4I32A 3TITA 1SL3A 3KIDU 5JBCS 2O8WA 1W0YH 4UFFH 1L1JA 3MO9A 1WAYB 1GG6B 1UTKA 5HYOA 3BTDE 2LB7A 3H5CB 2QE7D 2GDEH 1CGII 1KXBA 5A0BA 2FOGA 2ZHQH 3VDUA 3E0NB 1GJ7B 1OWKA 1NRQH 3QK1A 4ZHMU 1W10U 2WPJS 4CH8B 1FY7A 2AGGX 1OYQA 2QIQA 5IDKA 4JZIA 4IGDA 3F2GA 1FYBA 1VITH 4NG9H 3BIUH 1UO6A 3RMNH 3RXMA 1MU6B 3RXPA 2A4RA 1V3XA 3N7EA 3OXFA 1BA8B 3UY9A 2QQCA 3UNQA 4A1TA 1J14A 2UUKB 4ABIA 1P57B 2XNDD 2VIVA 1F7ZA 2Z9GA 3O8DA 1MJ9A 1YCPK 2JH5D 1YPHE 3OY6U 4XBBA 2OC1A 1XMNB 2XCFA 1ANDA 5E0GA 2J2UA 3RUOA 4OGYA 1YKTA 3UREA 5A8ZA 2V1CC 1OP2A 1C1SA 1Q31A 2FDAA 2ZHDA 5EOKA 3SU5A 1A0HB 1P2MA 2Y82A 4CH2B 3B8JA 4WY3A 1TPSA 4GSOA 1VKYA 4B2CA 1GL0E 5C94A 1OKXA 2KCOA 1O2RA 1HAYB 2VB0A 1CO7E 2QV1A 5EU8A 2G81E 3P70B 2ZQ1A 1ELCA 4ZMAH 2GDDA 1ULKA 1BMNH 2W0TA 2B9LA 1C5SA 1KXAA 1O32A 4K60A 1TE0A 1XUHA 5CDFE 1F0SA 2VGCB 2BVRH 3MNXA 5GDSH 1CA0C 3SU6A 4CRFA 2X3TA 1SGRE 3SZNA 1GJ9B 1AFQB 1EPTA 1FY8E 1HBTH 5T1VA 2L8EA 1PJUA 1C5UA 2IN2A 3ZZ6A 5FBIA 5DP4A 1EFRD 3VXFH 2OC0A 1C2HA 1WOFA 1T4VH 1Y3YA 1BOQA 2WV4A 2ZPQA 3VB4A 1KDQB 1O3HA 2J4IA 1SGYI 4WP4A 4BXWA 1MD7A 2BB4A 4E06H 1FAQA 3BTQE 3LDXH 4ISNA 4OS2A 5J8CA 1IAUA 1FIZA 5EODA 3RXLA 9ESTA 1MTUA 2FLBH 3SUFA 3SU4A 1AKSA 1NS3A 3RXHA 5EX3A 3P8NA 4GCHG 4ABBA 3MQKC 3T2NA 1O3BA 3A89A 1GL1A 1ZOMA 2FOAA 3CXLA 4YZUA 3B4VC 1OPHB 3ZYEA 1G3BA 5DP7A 3M35A 2HNTE 1FY4A 1GI7B 1V6DA 2DUCA 2YNAA 2HWLB 1PPCE 1O3IA 3R0FA 2ZI2H 2FS8A 2OC7A 1SGFA 5HI7A 2OD3B 3ZZBA 2QQ0A 2GTBA 5DP3A 3TOAA 2BD7A 2SGAA 1C1TA 3DFLA 5GXPA 3F68H 1QHRB 1SQRA 3EGKH 1UVOA 1Y1CA 2KMRA 2GKVE 1SLWB 1ARCA 2XXLA 5C1YA 4RT0A 2ALPA 1SQAA 3ZYDA 4Z0KA 4IC6A 4WMFA 5CHAB 2TGAA 1T31A 4SGBE 3TK5A 1FZZA 5HQ8A 4IC5A 3S9CA 2J9NA 1G2LA 1ID5H 1AUJA 5GIBA 3LH1A 3HPTB 3F3BA 3BTKE 2GCTB 2CMYA 3TVJB 4BAMB 5FCKA 2ODDA 4RSPA 1BBRH 1C2LA 1C5NH 3TO6A 3LJJA 3MU8A 3E0PB 1EX3A 1OXGA 3KQEA 5C67A 1O2LA 2CWFA 7LPRA 3TJOA 1WUNH 1EASA 3R3GB 2IPQX 2P3FH 3SEKC 2BLVA 1DY8A 3A7XA 2N17A 2AFQB 2Q6DA 5AHGH 3KF2A 2V35A 4HG6A 2E5RA 3T28A 2TGTA 1ZHPA 2J9RA 1LPGB 5DN6D 2R2MB 1HAVA 1Y5BT 3KQ5A 4CHAB 5F8TA 1ULNA 3PYHA 4IN2A 2ULLA 4FU8A 1NPMA 2W6JD 1SGQI 1QA0A 4MPIA 4BANB 1NRPH 3CS0A 1EUFA 2H5CA 1A7SA 1D4PB 1WYKA 3RP2A 3OE7D 5K0HA 1GHWH 2BDAA 3H7TA 2AYWA 8ESTE 9LPRA 2OTTX 3T62A 1MCVA 4IS5A 3URDA 2GD4B 3K65B 1TBOA 1SGIB 1ELVA 3KQCA 1GMHF 1OWEA 2FODA 4B1TA 1EPTC 3LGVA 1GHYH 3TK9A 1O2PA 1XUIA 1FV9A 2ZTXA 2ZDKA 4ABGA 1C1QA 2FOBA 2BMGB 2FI4E 5ETXA 2ZU4A 1F92A 3ZZ3A 4ZKOU 1QA7A 1LQEA 1BB0B 2GMTC 1V2MT 5ESBA 4ABFA 1GCTC 4K69A 1SGEE 1O31A 1GJ4H 2OINA 1KSNA 1A5IA 1ZHMA 3E91A 1H4WA 1TGTA 1TYNA 4MPVA 1HB0B 4GHTA 1TAWA 4NFFA 2LEOA 4NGAH 1Y3UA 3SI3H 1DLKB 1FX0B 2JJ1D 1CA0B 4ABHA 1BTZA 3C1KA 4B73A 2YQPA 5L30H 3BV9B 4IW4E 4DG4A 2VIDA 2AIPA 3BTTE 3FVFB 4MPWA 2A4QA 1T8LA 5E0HA 3RLYH 1P0SH 1WGTA 1GBTA 2A2XH 1GVLA 3ZZ8A 1EOJA 3KQBA 3STJA 1B5GH 1C1UH 4Q2KA 2ROWA 3M5NA 2OXSA 2GKRI 2BD8A 1GBKA 3UFAA 2LUYA 1IQKA 2ZEBA 1S85A 3BIVH 3TLOA 2UVOA 2IPHA 4ACBA 1H9LB 3S9BA 2EC9H 1PYTC 1Z7KB 4FUIA 1YF4A 1EB2A 2ORVA 1CBWB 3E6PH 1IQJA 1MU8B 1KLTA 2BY7X 2ZDNA 4CRBA 2HRVA 3UR9A 1PPEE 4DT4A 2NU2E 2OD1A 2UWOA 3BG8A 1X74A 1H1BA 3BSQA 1VDDA 1FNIA 4Y8XA 1X4SA 1SGPE 1AD8H 3TNTA 3KL6A 1AB9C 3SUDA 3F1SB 2FEQH 1GBCA 3EAJA 5EGMA 5EQQA 1ACBE 2PTCE 2PUXB 3PWCA 4ISIH 1K2I1 2W3KA 2B0FA 1NBME 1UHBA 3I78A 3MMGA 1M8BA 3SNCA 1KXCA 3SGBI 1GDQA 3L33A 5EQSA 1Q2WA 3WY8A 1YP9A 2HPPH 4WH6A 4XRNA 3TGIE 5DP6A 4NIWA 2WPIS 3SI4H 1K1JA 1F5RA 1GGDC 1BMLA 2JKHA 1O36A 2NU4E 2K9HA 5E3RA 5JYIA 4AX9H 3RMLH 2HPQH 4NA7A 3TGKE 2TIOA 4F49A 1EJAA 1JMOH 2A2QH 1MJAA 4NZQA 1TX6A 1JBUH 3LOXA 2RA0A 4UFGH 1TBQR 1CSOI 2FXRA 1NBMD 2OTVA 3A83A 1F0RA 4LK4A 2FMJA 1SMFE 1P2OA 1YCPM 2PLXA 1THSH 1DWDH 3GDVA 2OLGA 1FY5A 4VGCC 5FX6A 5HMAA 1AZ8A 1NU9A 1Y3XA 2I6QA 3FSXA 1CT0E 4WXVA 1WV7H 1LHDH 1HAOH 2J95A 1WTGH 1C5LH 2QY0B 2XC0A 1HRTH 3TOBA 1VCWA 1NUBA 1BY2A 5GJ4B 2WV5A 5HKKD 1MTNC 1ZGVA 4OM9A 3OXLA 2HGTH 3JZ2B 2J98B 4INHA 1ZPBA 1ESTA 1BRBE 3BTEE 3RMMH 3RXGA 3QUMP 1W13U 3URCA 1AVWA 3MU1A 3HATH 1VGCB 2ENZA 3GY8A 3MI4A 1ELGA 3AW0A 1QB9A 4FVBA 5K7RA 1GI0A 1V1HA 4LZ1H 3ZZ4A 2ZTZA 2BY6X 2GKTI 2ZU3A 1S6LA 4I31A 1O3CA 1TBRH 5PTPA 1Z1JA 3BTWE 4ZKSU 1TQ7B 5DJ7A 2XBWA 3P92A 4ISOA 2PFEA 2ZGJA 2P59A 2AGIX 5E0JA 4DCDA 3E59A 2R9PA 1IQGA 1Z8GA 1MABB 1HJ9A 4I8JA 3GICB 5C1XA 1O3NA 2ANWA 3AAUA 1UTJA 2M5TA 2VU8E 1GBMA 5EW2H 1Z8RA 2PGBB 3HGNA 2WZQA 4TWYA 4YM9A 1DXWA 3PMBB 2ZGXH 2PKAB 2DE9A 8GCHG 3D49H 1JRTA 4Q7YA 1TNKA 1ZRBA 3RXQA 5CCLA 2N52A 5C5OA 5FUXA 1P8VC 1LPZB 2ZGBH 4X6PA 1SLUB 1Y3WA 4JMYA 1GCTB 3SV7A 3LGYA 1AQ7A 4A1XA 4AN7A 3VB6A 1HEVA 1PQ5A 1OSSA 4JZFH 2ILNA 1TQ0B 1YU6C 1B0FA 1IQNA 1VJAU 2ZU5A 1J8AA 1V2VT 2C90B 1O35A 5HM2A 3LGIA 4NSVA 2WHXA 2Z9IA 3MU0A 5EX0A 2FOEA 1O3PB 5FX5A 1S83A 3ZZCA 1ZSLA 3UQVA 1LPKB 4K1TA 1QQUA 2ZA5A 1GJ5H 1KXFA 1PPFI 5EQRA 1E37B 5T6DA 1Y8FA 2A4GA 3M3VA 1ZPZA 1DFPA 1X7AC 2CF9H 2H1UA 2W26A 2H6MA 1O5CB 1XKBC 3ODDA 3TGJE 4A6LA 3UNRA 1YLDA 1W4RA 1HXFH 5GCHG 2Y5HA 2LNCA 3P95A 3LT3A 1P01A 2C8ZB 1C2MA 1SC8U 4I8HA 1QCPA 1GI8B 3NWUA 5EXMA 3GYLB 4K8YA 1AI8H 1O2NA 5F8ZA 1O3LA 1OWJA 5L2ZH 2BD5A 1EJMA 4MPUA 3ZVFA 2DE8A 4FUFA 2GCHG 3MH7A 5T6GA 4FXGH 3STIA 1SGTA 1MKWK 1DT2A 1C4U2 3GCHC 2AERH 1YPKH 1LVYA 1MQ6A 1QY6A 2GV7A 1UVUH 2BOKA 1HJAB 2GCHF 3UWIA 3M61U 4BAKB 5A0AE 2YOLA 4DIHH 1BTXA 5HIZA 3QTLD 1NFYA 2G4TA 4DVAU 2ZIQH 2PR3A 1BUSA 1EAWA 1UTOA 1K7UA 4FETA 3GY5A 2KCXA 4FUHA 3GOVB 1JIRA 3EA9A 3TK6A 4NIVA 4THNH 4A1VA 4SGBI 1BTWA 4YLQH 1GJAB 2XNIA 4LZ4B 2ZDVH 2SGFE 1CU1A 3BF6H 1P02A 1A61H 2ZPSA 4Y6DA 4RI0A 3LGWA 1O39A 5EXLA 4QT8C 3QLPH 1G36A 5JB9S 1ABJH 2WPLS 2CJSC 3DD2H 5BRRE 3TIUA 5LPFA 3Q76A 1G3CA 1AY6H 3LH3A 2OK5A 3QX5H 3RXTA 2BXTH 4GLYA 1J9CH 3UUZA 2A5IA 2EI6A 4X8VH 3UQOA 1AO5A 4MNXA 4XSKU 1WCZA 1AE5A 3S0NA 1Q3XA 1ANEA 3MO3A 1P04A 1DUAA 2XBYA 5FXLA 1DSTA 5FAHA 4HTCH 4L9MA 3HK3B 2AIQA 3SOSA 1O30A 2PWXA 1O5DH 3UR6A 3ZIAD 4B2BA 1ULMA 1T32A 1LVMA 3RMOH 1MH0A 3GDSA 1Z71A 1QR3E 1RRKA 3GY7A 1MJBA 1INCA 2LPRA 1S81A 6CHAB 1MZDA 2BY5X 3D00A 1R0RI 2BQ6B 2I6SA 1K1NA 2ODYB 2O8UA 2CF8H 2KAIB 4X2YA 3RXAA 2BDIA 1C5PA 2GZ7A 1OWHA 2XC5A 1AGJA 2F9OA 4Z6AH 1BTYA 2ANMH 2GJGA 1HAXB 1K1PA 5LPRA 2STBE 3DHKH 1EATA 3K6YA 4Q63A 2A4OA 2O9QA 1C1WH 2BD9A 4OS1A 4DJZB 3PDNA 2EY4C 4RKOB 3EDXB 2G5VA 3SYJA 1FMGA 2QF4A 4IMZA 5T3HA 1E1QD 1GI4A 3PM3A 2VWLA 3SJOA 1PTQA 4UD9H 2Y7ZA 4BTTB 2OBQA 4NA9H 1EXFA 5E3QA 1BMAA 2Z9LA 4DY7B 1MMJN 3S9AA 1LR8A 2VH6A 1TBNA 1O2GH 4WWYA 4MTBA 4MDSA 3SV8A 2ZNKH 1EZUC 1S6FA 2BDYA 1NZQH 1S82A 1QIXB 2FWWA 1NESE 1V2JT 2FX6A 5FPYA 5C0TA 1BJVA 1SHHB 3E2IA 3A7VA 4TSFD 1KLIH 3T25A 3ZVBA 3UIRA 3V0XA 4AZ2B 3SU0A 2WGCA 1HXEH 1TGBA 1CHGA 1UTPA 1ZMJA 1QL8A 3RLWH 2ANKH 4CR5A 1SFQB 2B7DH 1YPEH 3M36A 4KTUA 3SO3A 1XXFA 3VB7A 1H0ZA 3SGQE 3VXEH 1TPAE 3UFFA 1ZTKA 2JH0D 2ZECA 3E16B 1CHOG 3RU4E 4XDEA 2SGPI 2B8TA 2BD2A 1O3JA 4JK5A 2OUAA 4WH8A 2GGVB 1LHGH 1P12E 1QURH 3NK8A 5JBBS 3F0PA 3UWJH 3F6UH 3I29A 4UEHH 4YTAA 3VDPA 2JETB 3EE0B 3F0OA 2ENNA 1HAIH 3F2FA 2GVIA 4YT6H 1S0QA 3MNSA 4R8TB 3UGIA 3ZV8A 1LTOA 1BTUA 3P8FA 2NU2I 5A2MH 1IHTH 2FESH 2KCAA 4H42U 4TT3D 2BTCE 1SGPI 3QGNB 1P3CA 2LELA 2VJ1A 2FZZA 5FBEA 2JZMA 2P94A 5CMXH 1SQTA 3GCHB 4ABEA 3LIWA 1GBJA 2P8OC 5HXFA 4X1PU 3D62A 3MWIU 1V2KT 7ESTE 3A7WA 3U9AH 2Y80A 2VIPA 2BX3A 4AFSA 1SB1H 1W11U 2HVXA 1W14U 2JXDA 1BDAA 1AVGH 1ESAA 2NU4I 3O8RA 2F9VA 1AVXA 2AH4X 4K3JA 4TY6A 1V2RT 5HIYA 3OAAD 3Q3YA 3QZQA 3P17H 5IK2D 2CHAC 1RGQA 1DUEA 1HLTH 2IOTA 1H9IE 3R5CA 1C1MA 1NROH 2J97A 3MU5A 3TJUA 4OS5A 2YUUA 2QF3A 4RT1A 1ZPCA 4UDWH 1C5ZB 4UFEH 3RXKA 4AGKA 1O3AA 8KME2 3F2HA 2ESTE 5GNDA 4AB8A 4UXJA 1O2XA 2KZ4A 2O8TA 4GCHF 4K2YA 4K5ZA 4U2WA 1L2EA 2Z9JA 1CT0I 1O38A 1P3EA 6ESTA 3M5MA 1GHVH 1FARA 2P3UB 2WINI 4NFEA 3M7TA 1A2CH 1MAXA 1P2QA 1Y59T 3F9EA 1DWCH 1THPB 3BN9A 2VWNA 2KMQA 1G30B 3NZIA 1BHXB 3OTJE 4B75A 1UK2A 3JZ1B 4KELA 2RFKC 3R5AA 3LGUA 1NXUA 4TY7A 2ZZUH 4WVPE 1Z8IB 2BDHA 1AFEH 2F9UA 2PV9B 1GDNA 2BX4A 3DFJA 4BTIB 1GVKB 4INKA 3F9FA 3UPEA 1YPLH 4WJG2 2V7QD 3GS9A 1JWTA 2QXHA 3SNDA 2G51A 4CRAA 3QTOH 1O2SA 4I33A 1XXDA 4E7NA 1BZXE 1P06A 3ZVCA 1O5BB 1OS8A 1GJCB 3U28C 4FOUC 4BAHB 3OEHD 5DKMA 7GCHG 1ZTJA 1MTVA 1QL7A 3A84A 3ATMA 3M3SA 1CVWH 1XVMA 4UXHA 1AIXH 1SGFG 1PFXC 5EPNA 1GHXH 3BTFE 4Y7BA 2BDBA 5LH8A 4BNRA 3LPRA 7GCHF 2YMSC 3UOPA 5C3NA 1OMUA 1VZQH 4AC9A 4M9FA 3NPSA 1N1LA 4X1RU 4YLUA 1GBEA 1VJ9U 1ZRKA 1W3SA 2KMPA 5F8XA 3P8OA 1OP0A 3HK6B 1H8HD 1ZTLA 1BT7A 1H8DH 3ZVDA 4JYTA 2QF5A 4YXWD 1BMMH 1CT4E 5A8XA 3FO8D 1HAGE 4FUJA 1HDLA 1P09A 1SQOA 1V2LT 3TPIZ 3VE5A 1GI6A 1MCTA 3UGLA 2WCYA 5I25A 1O33A 1SGNE 2Z94A 1HUTH 3W95A 2A7HA 3KGPA 4E05H 4KKDA 5EJZA 4M7GA 1Y3VA 3LJOA 2JP0A 1W0JD 3E90B 3MYWA 4X1SU 1CGIE 3AVZA 4D76A 1Z8JB 1CHOI 1S5SA 4BOHA 1GBAA 3OX7U 4I8KA 3Q77A 1G9IE 3SJIA 4BTUB 4NCYA 4B74A 3CS7A 2X52A 3FZZA 2ZFRH 2BQWB 1AWHB 1GMCG 2GT8A 3EA7A 3ZZ7A 4JCNA 3ZZ5A 1ABIH 2QF0A 1RJXB 2GZ8A 5E2PA 2VVVA 1LHFH 1EZSC 3M3TA 3UGDA 3ZVAA 3V13A 2ZGCA 1C5OH 3NKKA 1GJ6A 2GVFA 1SHYA 3TH2H 4O03A 1XKAC 1Y5AT 1MUEB 2R3YA 4X2XA 1GHAG 1RS0A 2FPZA 1O34A 2LP6A 5DP9A 2F3CE 4I8GA 1LKAA 2Q6FA 3UTUH 3HGPA 1V2PT 4F4OC 1HYLA 1C5RA 2CV3A 2PP6A 1K22H 2XBXA 3ZZDA 1UVPA 4NIXA 4MLFB 5SGAE 1Y8TA 4HZHA 1GJBB 2P8OB 1WTHD 2F4LA 1NY22 3SGAE 3SV6A 2A0QB 1T8MA 4U30A 2ZHEH 1O5GH 4Y76A 3L3TA 5CE1A 1V2ST 3RDZA 1MBMA 3SHCH 3PV2A 4YOJA 5G4BA 1YPGH 4FU7A 1D3DB 3KYFA 2D1JA 3PV5A 1C5XB 4AFUA 4P00A 3SV2H 1PTRA 1RIWC 4DURA 1HIAB 4RN6A 4MNWA 5DPAA 1CT2E 1FUJA 2GKVA 2Y0MA 2BDCA 1AZZA 4OVOA 4ZKRU 3IWMA 1SVPA 3SW2B 2SGFI 1CGHA 2PTNA 1KYNA 1LHCH 1NFWA 5JDUB 1SGYE 1KTSB 1S6HA 3DA9B 1HDTH 1FN6A 1QBOA 1YC0A 2Z9KA 4FVDA 2ZQ2A 1RXPA 4WF8A 3RXIA 1Q9BA 4AMLA 1GHBG 3M5OA 1JRSA 3M7QA 3TO7A 1QQ4A 4ZHAA 4ABDA 5C1UA 1QJ6B 1H8IH 3QGJA 4K1SA 4U32A 1H8ED 2C8XB 2VIQA 1SBWA 4ABJA 1UVTH 2BQ7B 1SLVB 3LGTA 4K8BA 3UAIC 1GI9B 4GVUA 2R0KA 2HNTF 4PROA 1PJPA 2FX4A 3O8CA 3U8TH 1XM1A 1RD3B 4CBOA 2L6OA 1TMBH 1BQYA 1UTQA 4E1PA 2NU0I 3W94A 4A24A 5F03A 1IQMA 1OX1A 4ZKNU 5KEDA 3MEKA 3R5BA 3BEIB 4B6DA 4FUCA 3TU7H 2H9TH 3RXJA 1UCYH 1S20A 3QTVH 2ZO3H 1G37A 4JYUH 1BBRK 2BOHB 4JK6A 2GP9B 3RXVA 3BJIA 3U1JB 1V2TT 2Y5FA 1DANH 1T8OA 1KDQA 2P6AC 2J38A 2A20A 1DS2E 1GJ8B 2A5KA 2QN5T 3A8DA 2SGDE 3EYDA 4YOGA 1G3EA 5J4QA 2N1AB 1C1OA 4AG2A 3AK5A 2Y6TA 2BVSH 3OEED 1QGFA 5FPTA 3RM0H 4JZDH 1VITG 2NU3E 3NCLA 4Q7ZA 2XW9A 4TPYA 1E34B 1HCGA 5FUWA 1O2YA 3FP8E 1VCQA 1DWBH 4MNYA 1FONA 1FXYA 4TYDA 3FANA 4F48B 2RCEA 1TOCB 2VNTA 2EQNA 1MZAA 4TWWA 1VITF 2O8MA 1EAUA 3OY5U 4X8UH 4XOJA 1HJAI 1FQ3A 1F2SE 3PMJA 5DG6A 3PTNA 2H2ZA 1EJNA 3OYPA 3PLKA 3FC3A 2GIVA 1P9ZA 4AFZA 1BRCE 1EPTB 4H6TA 1DSUA 3HKIB 1T7CA 2Z6BD 1DICA 3GCOA 1RTFB 2D2DA 1N13A 5FL7D 1RTKA 3KY9A 1TRNA 1TBZH 2BM2A 1LDTT 3QWPA 3AW1A 4ZXXH 3A80A 3MFJA 2Q6GA 1YLNA 1TRMA 2GMTB 1GG6C 7KMEH 8GCHF 2RC4A 2QXGA 3CENA 2FYQA 1O5EH 4AYYB 2V3MA 1WTJA 2UZ3A 3MTYA 3TJQA 2C8YB 2A7JA 2XWAA 3SJKA 4BAQB 3SGQI 2VWOA 2YNBA 4CREA 1UJ1A 2FOFA 1P2NA 6LPRA 3SNEA 2FOCA 2B0UC 1O3FA 1SGDE 1AKSB 4ASHA 1SGRI 1KMHB 3K6ZA 1HJ8A 2V3HH 5B6LA 1C1PA 3KNXA 2GT7A 3QWCH 1B7XB 1O2UA 1GBBA 1O2QA 1P11E 1TABE 3PB1E 1ZSJA 1YCPH 2R3UA 1LQDB 3RXBA 1GI1A 4CRCA 5JFBA 1W0KD 1DDJA 2BYAX 1O3MA 1YGCH 2TRMA 1UTNA 3OSYA 1E35B 5I46H 3KHVA 2PHBA 4J1YA 4KGAA 4FKDA 2ZDMA 2J87A 4FU9A 1WKXA 1A3BH 1O2TA 3DSGA 2FTMA 1NRRH 2ZKSA 1TGCA 1BHXF 1V2OT 1LR9A 4GAWA 4NWLA 1QL9A 1NC6A
chains in the Genus database with same CATH topology
2VWMA 2G52A 4J2YB 3FP6E 1EB1H 1C5VA 1V2NT 4X6OA 4A92A 5GCHF 1M8CA 1IY5A 2ZF0H 3PMHB 1ESBA 2SNWA 3ATWA 3GCTG 1AB9B 2CGAA 2ZHWH 2RDLA 1GWAA 1A5HA 1RIWB 1MTSA 2ZC9H 3F9HA 1FY3A 2AEIH 2VGCC 1TFXA 1JOUB 2BD3A 4MNVA 4FUEA 2BZ6H 2V0BA 2ZU1A 3MH4A 1FI8A 1O2KA 4B2AA 2AMQA 1CGJE 1SSXA 2QXJA 1E38B 1A0LA 4X8SH 3NXPA 2OYAA 4AYVB 1GGDB 2V53A 1ETSH 2H9EH 2GV6A 1DX5M 1EKBB 3HH2C 1GVZA 1XUKA 2BDGA 2THFB 3MO6A 3RXCA 2AMDA 3ZVGA 1IQFA 2F9PA 4FUGA 4JYVH 1ANBA 1NRSH 3PMAB 1Y1BA 1KMAA 4ZXYH 1HAVB 1A46H 3RXOA 4D7FA 3M5LA 4VGCB 3TH3H 1NT1A 3MNBA 1UVGA 1K9OE 1UVFA 2EEKA 3MHWU 4YOIA 2QGRA 2FYRA 3VGCC 1BTHH 3QZRA 2BLOA 1JIMA 1IW4A 1ZLRA 2BD4A 4FUDA 4KP0A 3RXUA 3ODFA 4YT7H 1MTNB 3A7TA 4WXIA 1UCYK 3SJ9A 1D6WA 1RTLA 3P8GA 2D26C 2QQEA 1A5GH 1OVOA 4JZ1A 1DOJA 5B6OA 2VH0A 1GBIA 1OWDA 1OWIA 3V7TA 6GCHG 1O2ZA 1O3DA 1TNIA 8LPRA 5DAEA 3H7OA 3F9GA 1ETTH 3UEYA 1YBWA 1Z7KA 2VVCA 1FPCH 2PGQB 4MG3A 1WU1A 5TCCA 2WVJA 1CSOE 3I77A 4K1EA 5E8EH 3UNSA 2VIWA 1GMDG 2P93A 5CHAC 1XX9A 5ESTE 5DP8A 1TNHA 1ARBA 1IQEA 1J15A 1EZQA 1GDUA 2TPIZ 1CT4I 1ZSKA 2PKSC 3ITIA 2KMOA 4H6SB 2QC2A 4UONA 2H5DA 4FUBA 1UMAH 4HGCA 1AUTC 1BJUA 1D3QB 5IYTA 1K21H 1PYTD 1SGNI 4X2WA 4Q80A 1NO9H 4OS7A 4AB9A 1EQ9A 1SGCA 3SNBA 4Y11E 1NU7B 1K1MA 2ZGHA 4KTSA 2XC4A 4ZUHA 1SLXB 3RU4T 2IJOB 2H9HA 3SUGA 1HAZB 1Z6EA 1SGEI 2NU1E 1CE5A 2J94A 2G4UA 4CHAC 3RXFA 1SR5C 1DM4B 3A85A 3QDZB 2E73A 1AE8H 1FPHH 3ZZ9A 2ODPA 3U8RH 4I7YH 2ZCLP 1SG8B 1TOMH 1FAKH 1CQQA 2J92A 1SOZA 2ARPF 2F9BH 2BY9X 5JBAS 1TOTA 2C3SA 3SV9A 1HFDA 1IHSH 3D23A 3IITA 1W0ZU 2A1DB 1AN1E 2ODQA 3QO6A 1UHBB 1TBQH 2VVUA 1FN8A 1LCYA 4X2VA 1WBGB 3ATLA 2W7SA 2F3CI 1W8BH 2FTLE 1L0ZA 2JOPA 3UOUA 1FDPA 1GI3A 1P05A 3LC3A 2STAE 3C27B 2Y7XA 4WMEA 1TGNA 4ZAEA 2QAAA 1D9IA 4INLA 4IBLH 1CHOF 1L1NA 1GJDB 2SGEE 3A86A 2RG3A 3S7HB 1YPJH 1BTPA 4B71A 1PPHE 2Y81A 5A8YA 5DO4H 2WPKS 3RU4D 4X6NA 1LR7A 1Z1IA 1P2JA 2A32A 2CJIA 4NA8A 1S0RA 1DWEH 3K2UA 3PLPA 1TBRR 4MVNA 1L4ZA 2PKAA 1CT2I 3A87A 5LPEA 1PPFE 2SGQE 2WUBA 2UUFB 4IN1A 1C2IA 1EP6A 3HKJB 1ZR0A 2EA3A 3SORA 2QA9E 2XRCA 1LMWB 3EA8A 1W2KH 1RFHA 3MU4A 2ZFTA 1Y5UT 2JA4A 5J4SA 3A8AA 1O2MA 1G3DA 3LU9B 4YO9A 4DGJA 1B0EA 1MD8A 2V3OH 1VR1H 2N71A 1UVSH 2B8OH 4AG1A 1O5EL 1OP8A 2UWLA 1TPOA 1EAXA 1CBWC 1TGSZ 3TNSA 1TX8A 1XUFA 4X1QU 1LVBA 1N8OC 3MOCA 3T27A 3KN2A 3VGCB 2FI5E 1XA6A 3AAVA 3GISB 1SOTA 2HLCA 5FUYA 1V2WT 1DS3I 1ZMLA 3T5FH 3ESTA 3K9XB 3PV4A 1C2JA 2OC8A 1QJ1B 1BMOA 2Z3CA 2XYAA 5JPMH 1GBHA 2FS9A 3NUMA 4GI3C 1KXDA 1O37A 1BUIA 1BCUH 1F5LA 3A8BA 5EXNA 5F6MA 1DS2I 1NFXA 2SGDI 4OS4A 5DP5A 1LHEH 2ASUB 3OXGA 1V2QT 1SFIA 1P10A 3PTBA 1UTMA 1LO6A 5EW1H 1C1VH 1MAYA 2PSXA 1IOEA 4LOYH 1FY1A 2NU3I 1D6RA 1T4UH 4YESB 2F91A 2P3TB 3BEFB 2J34A 1KLJH 4BXSA 2Z3DA 5HGGA 4HFPB 1TPPA 3RC6A 1BRUP 1DVAH 3FAOA 1K28D 2PKSB 1C9TA 3S69A 5CCMA 2GZ9A 2JYYA 1C2FA 3P6ZB 1C5MD 4RKJB 1V2UT 2VINA 1P2KA 3BEUA 2HOBA 1F5KU 1KXEA 1FLEE 1DXPA 4AFQA 1A3EH 1TMUH 3EQ0H 1EAIA 2SFAA 2FLRH 1J16A 2XTTB 3VFEA 2WYGA 2ANYA 1NFUA 1TIOA 4HGUA 1VGCC 2VIOA 2SNVA 5DGJA 3SN8A 3B23B 1LKBA 4R0IA 4CR9A 1GBFA 3A82A 1QRWA 1TWXB 1VCPA 1ELAA 4CRGA 3DUXH 1XBTA 2ZG0H 1O5FL 1W3CA 4D7GA 1W7XH 1HPGA 4NSYA 1SGDI 1GMHG 1ETRH 1ZHRA 1GCDA 1W12U 3E1XB 1E36B 2ELIA 1ELDE 1QJ7B 4GPGA 3SU1A 2ZWLH 3RXEA 5EG4A 3MH6A 1G32B 3ATIA 4Y10E 4UE7H 2OQUA 2RA3A 3RXSA 4TPIZ 2ZHFH 1TNLA 2G5NA 1O3GA 1A0JA 1ZJDA 1PQ8A 1PPZA 3PLBA 3A7YA 1MQ5A 4Y71A 2PUQH 4MQAA 4GHQA 1TLDA 2CN0H 4IMQA 2G8TA 4AGJA 1DPOA 5LGOA 3IG6B 4XBDA 4UFDH 2XCNA 4Y79A 1AMHA 1GMCF 1C4Y2 5L2YH 3SUEA 2KAIA 2ZFFH 2DIPA 3Q3KA 4Y8ZA 1C5QA 2C4FH 2VRWB 2OVOA 2C8WB 1NM6A 2OBOA 2XWBI 3ZV9A 3FFGA 4JCVE 2OY3A 1DITH 1YYY1 3MH5A 2A31A 4CBNA 1PPBH 1ZYOA 1GHAF 4X6MA 2FM2A 1DY9A 5EPYA 1D3TB 1TALA 2R0LA 1HNEE 4B76A 4Y0ZE 1ELBA 1QB1A 5T6FA 3VPKA 4X0WU 1MKXH 1CGJI 2FP7B 2F83A 1TURA 1AHTH 2A45B 1K1LA 1M9UA 2SGPE 3SNAA 2CHAB 5FUVA 1OMTA 5A09A 2BXUH 1P57A 3GOXA 3Q3XA 4E1RA 1THRH 1KIGH 4KTCA 1TGSI 4Q7XA 4A5TS 1IQLA 2FOHA 5JHWC 1YLCA 2FIRH 3TJNA 1BITA 1N8OB 2L7XA 2WPMS 2QXIA 1MBQA 2GX4A 3RXRA 3AASA 4NIYA 4ZHLU 4H4FA 2F9NA 3RXDA 1P9UA 1D3PB 1BBRE 1MKWH 4NWKA 2UUYA 1KTTB 5JBTA 3SHAH 2ZU2A 1IQIA 1GBDA 1ZGIA 3OU0A 1HAPH 3S7KB 3TJVA 4LXBH 1HJAC 5BPEA 2W7UA 2ZPRA 3ENSB 3FP7E 3MNCA 1F0UA 3PO1C 4CRDA 1GHBF 3ZZAA 3RU0A 4A7IB 2BZAA 2DB6A 2BLWA 1EP5A 1C2GA 3N7OA 1ORFA 1YPHC 3KEEA 3TH4H 4DT7B 1C1NA 1UK3A 2CXVA 5DK1A 2QYIA 3L6PA 4O97A 3BG4C 3A88A 1O2IA 1ANCA 2B5TB 1HGTH 3M7UA 3PROA 4ZROA 2A7CA 3RM2H 1HAHH 2W5EA 3BTHE 1TMTH 3A81A 3SBKA 1MT1A 2G00A 4DW2U 3U8OH 2WUCA 4U01A 4Y8YA 1V1IA 3Q00A 2ZP0H 1BIOA 1UTLM 2QPOA 3ELAH 2BY8X 1ELEE 1KBFA 1W7GH 3E3TA 4NZLA 1XUGA 2C93B 3T26A 2Q1JA 4HI3A 1PCEA 1U5KA 4AORA 2EI7A 1EZXC 1KY9A 1CE3A 3U1IB 4DOQA 2FNFX 1N6XA 2TGDA 5FHTA 2Z3EA 1JXPA 3RC5A 3U98H 4D8NA 1O2OA 2TGPZ 3UEJA 2PW8H 4ESTE 4I8LA 1IY6A 1GHZA 1QB6A 1QTFA 2QCYA 2NU1I 3VEQB 1SI5H 1TIHA 4Y7AA 2WYJA 5FCRA 6CHAC 2Y5GA 1L4DA 2WPHS 3G01A 4OGXA 1NTPA 1ELTA 1GI2A 4O9VA 5E2OA 3SQHE 1O2WA 1TX7A 4X1NU 1C4V2 5H4IB 4XBCA 1HV7A 1U6QA 4ISHH 4SGAE 3T29A 1XX6A 2M5XA 2PSYA 1AU8A 2AS9A 3SJ8A 1AN1I 1YPMH 1QRXA 2ERWA 1EOLA 5HM9A 1SGQE 1O0DH 1O3OA 2K1QA 5AFYH 4D9QA 1HPTA 1Z6JH 2OCVB 3GYMA 1YTPA 1PQAA 2HNTC 2FI3E 1NRNH 3BTGE 5C5NA 2Z7FE 2XBVA 2ZDAH 1TUSA 1UK4A 1FAXA 4JZEH 1TONA 1J17T 1RFNA