2XRCA

Human complement factor i
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
548
structure length
461
Chain Sequence
b'EDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAMDAERRRIKSLLPKLSCGVDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGQWGEVKLISNCSKFYGNRFYEKEMECAGTYSGGPLVCMDANNVTYVWGVVSWPEFPGVYTKVANYFDWISYHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN COMPLEMENT FACTOR I
publication title Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
pubmed doi rcsb
molecule tags Immune system
total genus 92
structure length 461
sequence length 548
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.45: Complement factor I.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00089 Trypsin Trypsin
A PF00530 SRCR Scavenger receptor cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xrcA04
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 2xrcA03
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2xrcA02
1EKBB 5A09A 1LVYA 1UTOA 1CO7E 3BV9B 2ZHQH 4ZKSU 2A5IA 2JETB 2ZTZA 2R0KA 1MT1A 1GMHF 4FUHA 5E0JA 4IBLH 1ARCA 1M8CA 1O30A 2V6NA 2ZPSA 4O9VA 4WVPE 1S0RA 1THSH 1HAYB 2AYWA 1RFNA 3M3TA 3VEQB 3B8JA 3DHKH 1EXFA 4BAHB 1OYVI 1EB2A 1E35B 1EZUC 1GJDB 1ANEA 4GHQA 1PPFI 4K2YA 4JK6A 1RRKA 1RIWC 2PFEA 1O2IA 1DOJA 1S82A 2B0UC 1FUJA 2J2UA 3U8OH 3M3VA 1TAWA 1SMFE 1GJ9B 5JBBS 1TPAE 3ATLA 3ZZBA 1XUJA 4Y71A 2AGIX 2XTTB 1YPEH 1EAIA 2TGAA 1C9TA 1BIOA 3LKWA 2QAAA 2QA9E 2ZEBA 2SGEI 4FU7A 3UWJH 2ARPF 2FYRA 3SO3A 1WAYB 4K60A 5IYTA 4I8HA 5EPNA 3U8RH 2M5TA 1AFQB 3HGNA 1C1VH 2G52A 1NRSH 1SR5C 3GYMA 1EP5A 1U6QA 1AU8A 3KCGH 5FPSA 1UJ1A 3BEFB 3QTLD 1X7AC 1CHOF 5CHAB 2M5XA 3B4VC 1WV7H 2CJIA 1MQ6A 1MKWH 1K1LA 3RDZA 1ZOMA 3SNDA 1XUGA 2DUCA 5FX6A 3SU2A 4YO9A 1O3AA 7GCHG 4CHAB 1A0HB 3S7HB 2ASUB 3SU1A 1UTLM 2F9UA 4B74A 1K1OA 3MH5A 5B6OA 1EB1H 3IITA 1RTKA 3QGJA 1HAOH 1A2CH 2ZFSA 4I8GA 2WYGA 1BQYA 1ZPZA 2PTNA 1O36A 1QL7A 2Y5GA 4YESB 1C2IA 3TNTA 1IQKA 4A1XA 1HAGE 1ABJH 2J4IA 2VIWA 1C5MD 1SOZA 4AZ2B 2IN2A 2ANYA 1QURH 1O5AB 1V2KT 2FI3E 4IC6A 8ESTE 3AW1A 4ZXXH 1GBKA 3RP2A 3ELAH 1BTZA 1EAXA 5HGGA 1MTSA 4KP0A 3S9BA 5JHWC 1OWDA 1TX8A 3QK1A 1CGJI 2EA3A 1ZRBA 1FQ3A 2OC7A 2O8UA 1P2JA 3FFGA 2YOLA 5GCHG 4X6PA 1DUEA 3ZZ4A 2Y81A 1ESTA 2WPIS 3O8RA 1A0JA 4D76A 2ZHDA 2ZHEH 5FX5A 2Z9IA 2BTCE 1MU8B 1D3DB 2HNTC 3A7ZA 1MD7A 1C1MA 1TWXB 3NPSA 1CT4E 3A8BA 1TMTH 3PWBA 1RIWB 3A88A 1ZJKA 1KXBA 5C3NA 2FO9A 1LVMA 1BB0B 2ZKSA 4LZ4B 3TH3H 2BX4A 3A89A 2BQWB 2BDGA 1F0RA 2OCVB 2ZU1A 3MFJA 3A8AA 4UFEH 2A5KA 5E8EH 1D6WA 1O2QA 1OX1A 1UCYE 3RXIA 4AOQA 1P04A 1SL3A 4NSYA 3ZZ7A 3D65E 1NU9A 3DA9B 3UNSA 3LJJA 3RMMH 1R0RI 5T6FA 3ZVCA 1H8IH 1EJNA 4Y8XA 3SBKA 1S0QA 3VFEA 3OX7U 1O37A 4ZKRU 4CBNA 1TQ7B 4Y7AA 1DPOA 3PB1E 1PPGE 1C5TA 4PROA 4JZFH 1GI1A 1IAUA 1G36A 1PPCE 2GT8A 1P2IA 1T8LA 2Z3CA 3SEKC 1PJUA 1JWTA 1O3PB 1P09A 3GYLB 2Y82A 4Y10E 6CHAC 1N8OC 1TE0A 4RN6A 1O31A 3V0XA 1GBCA 2B7DH 3E0PB 5JPMH 4X2VA 1AB9C 2BUSA 4DGJA 2DE8A 1GHAG 1WOFA 4SGBE 1QQ4A 4X1SU 1KLTA 3T28A 1KDQA 1WYKA 2VJ1A 5AFZH 5DP7A 1NTPA 1OYTH 4YTAA 1A4WH 4DT7B 1HCGA 3UOPA 1YBWA 1ESAA 4X1QU 2XC5A 4X2WA 5JBTA 4FUFA 1GBBA 1MKWK 1O5FH 1Y3XA 4JK5A 2HPPH 1QJ7B 1C1QA 4TWWA 1NT1A 1K1PA 3V13A 3QZRA 1IQJA 1GBAA 2A2QH 3RXAA 4OS4A 1DANH 3TJNA 1BBRK 3P6ZB 3RMOH 3FP6E 1E34B 2A7CA 1OSSA 3TJQA 4O3UA 1THPB 3ATIA 1OXGA 4AGJA 2WPHS 3MI4A 3M35A 2H9TH 3RXPA 3SJ9A 3MH7A 1O5GH 3MWIU 1AZZA 2HVXA 3LGVA 2W26A 3S7KB 1OMTA 1W13U 4LZ1H 1QJ1B 1ZJDA 2FXRA 4I8LA 1PPBH 2OD3B 2H9EH 2OTTX 1GI3A 2FLBH 1GMCG 1Z8GA 1FYBA 4FVDA 1A1RA 1RD3B 2CN0H 1H9LB 2C8ZB 3RXDA 5FPTA 1O39A 2SNWA 1FMGA 1O2KA 2WPMS 2XC0A 5G4BA 4TWYA 2F3CI 1GHYH 3SJKA 1KTSB 1QFKH 1NM6A 1OP0A 4HI3A 1CBWC 2ZP0H 2NU2E 4ZKNU 1ESBA 5C1XA 1MUEB 5A0BA 1TA2A 1CSOI 2BZAA 4NGAH 1MBQA 2PW8H 1ZSJA 5I25A 3VB6A 1GDQA 1NROH 1PQ5A 2GV7A 1QY6A 7GCHF 2BLWA 1YPHC 2OQ5A 2TBSA 3Q3KA 3I78A 4NZLA 3TU7H 1K22H 2ESTE 1CGHA 2YNAA 4BXSA 4FUIA 3SW2B 1HBTH 4B2AA 1VR1H 1C2KA 2GZ8A 4FXGH 1O3JA 1E36B 3U1IB 2C8YB 1SFQB 1DLEA 5LH8A 2ZIQH 4BAOB 3MH4A 1LR8A 2EC9H 1HGTH 1Q3XA 3NZIA 3VB5A 2AS9A 2BY5X 2KMQA 4IC5A 2CV3A 3BTWE 5ETXA 1EJMA 3ZZ3A 6CHAB 1N8OB 2J95A 3SV2H 3AW0A 1MQ5A 2PKAA 1CE5A 3P8GA 2W3KA 1CHOI 2RG3A 1AB9B 3L3TA 3TNSA 2FTLE 2QCYA 1YCPH 3MU5A 4YT7H 4OS1A 2SNVA 4IN1A 2GCTC 1P2MA 1YP9A 1DE7H 1PPEE 4J2YB 4YT6H 1TIHA 4DOQA 1LKBA 1EJAA 5GJ4B 4XFQA 4O97A 4Y8YA 1HNEE 1C2MA 1P2KA 1OWJA 2SGFE 2KMPA 1NESE 1IOEA 2PLXA 2OUAA 1LVBA 1EASA 1UTNA 3MOCA 1ELAA 1Y3UA 3ZYEA 1TRYA 3TGIE 2GDEH 4B71A 2XWAA 4DCDA 5IDKA 3O8BA 1CHOG 3URDA 1VCWA 1GMDG 5DO4H 5LPRA 4AORA 2VINA 2NU4I 1O3IA 3UIRA 4XE4A 4ABGA 3F68H 3T62A 1HIAA 1ZZZA 4TY6A 2QQCA 1GJAB 5JB8S 1TIOA 2UUJB 1DXPA 1O3NA 2TGPZ 1Y5BT 4CRAA 2CHAC 1OMUA 1LO6A 1EUFA 3A85A 2J34A 3BG4C 3LDXH 3SU5A 5AFYH 4ZH8A 3SU4A 1UTPA 4DW2U 4BNRA 2JETC 3URCA 2ZZUH 4ABDA 5F6MA 3ZZ6A 1O2NA 1CBWB 3LOXA 5C20A 1NFXA 1L4ZA 5DP4A 1K9OE 1YM0A 4WXIA 4YLQH 1VJAU 4UDWH 1V6DA 4BTUB 1GHAF 2BHGA 4B1TA 1QB6A 3H5CB 1Y1BA 1BHXF 1TNIA 5EQRA 2FM2A 2I6SA 3BTME 1NO9H 2SGQE 1YPGH 2VVCA 2FIRH 2FEQH 2J38A 4NZQA 1SBWA 1A46H 3BIVH 4MLFB 5GPIB 5C1YA 4FVBA 3A82A 3TPIZ 1GBIA 1G32B 2AIQA 4YOIA 4NIVA 3U1JB 2F83A 3WY8A 5DAEA 4JCNA 1FPCH 3E90B 4AYYB 4ISNA 1H8DH 4IMZA 2BLVA 4B76A 1OKXA 2QC2A 1AFQC 3GDVA 3SQHE 2XNIA 4AFQA 1O32A 2BLOA 1EZQA 5ABWA 1QCPA 2GZ7A 3E91A 5E2OA 1BJUA 2JH5D 3Q77A 1NRRH 3ODDA 3BTHE 2A1DB 9LPRA 3VXFH 2A32A 2NU3E 4ZXYH 2EI7A 1ELCA 2AMDA 1V2LT 1HB0B 1NRPH 4WMFA 3GICB 3FP8E 1WU1A 1BBRE 3EQ0H 4X8SH 2Y7XA 1RJXB 1ANBA 1FDPA 1GI2A 1NZQH 2SGDI 1P57B 1GBTA 4ABJA 1GMCF 2BDHA 1SGFG 1CQQA 1UUCA 4INLA 1MZAA 1CGII 1EX3A 1O2LA 1DITH 2R0LA 3KF2A 1NRNH 4X8UH 1AN1I 1SGRI 2J9NA 1N6XA 3GCOA 1BHXB 2IJOB 1FAXA 1WTGH 1ZMJA 2HALA 7KMEH 2PGBB 1FPHH 3DFLA 2B9LA 1S85A 1PYTC 3M5OA 5SGAE 2THFB 2FMJA 3KNXA 5TJXA 3UR9A 1O3MA 3P8NA 3SGBI 4MNWA 4Z0KA 2ZECA 5E0GA 5FHTA 4ESTE 1MKXK 4I32A 3HATH 1C1TA 3T29A 3H7OA 3Q3XA 5DG6A 1SFIA 3HKIB 1GJ7B 5J4QA 3ZZDA 3NXPA 1TGCA 1O3FA 3B23B 1BMMH 2AMPA 1UVOA 2Z3DA 4JZIA 3SU3A 1DXWA 3M37A 2BYAX 1VITF 1CT2E 3RC6A 1RGQA 2R2MB 1JIMA 2EEKA 2OTVA 4Y7BA 2FOHA 1C9PA 2CHAB 4K8YA 1GJCB 3BG4B 1P03A 1Y3VA 1YF4A 5EW2H 1HFDA 4NSVA 4MPVA 4MPUA 1EPTA 1IW4A 2UWPA 1BTWA 3EDXB 3NKKA 1SQTA 4RKOB 2VIDA 2OC8A 2QXGA 3RC4A 1S81A 1NUBA 3GCHC 1GG6C 2A4QA 1BTXA 3SUDA 1UTJA 1SLVB 1ELGA 2W3IA 3EA9A 3RXMA 1KIGH 1LHDH 2VWOA 5A0CA 5K7RA 1NC6A 1KDQB 2WV4A 3RLWH 3A7WA 5EU8A 2Y80A 1C5SA 2VVUA 1YPJH 4BTTB 2QIQA 2QY0B 4VGCC 1ETRH 3KHVA 2UUYA 2ZDKA 1O2OA 1AIXH 4AG2A 3HK3B 3K9XB 3QTVH 3VPKA 4MQAA 3GDSA 4QT8C 1GL0E 1QA7A 1HRTH 1SGQI 5A0AE 1UTKA 2TIOA 3CENA 2AERH 1CT0E 1DFPA 4ZUHA 1TALA 2OLGA 1QA0A 1DWEH 1RTFB 3A86A 2HNTE 4A6LA 4X8VH 2GKVA 1TMUH 1G30B 4LK4A 3RXFA 4K5ZA 3SNAA 2Z9LA 4A5TS 5F03A 1MMJN 1KSNA 4ABFA 1SGEE 3SUGA 5LPEA 3PMHB 1C2GA 4NA7A 1GMDF 2OINA 1KXEA 2AIPA 4GHTA 1C5LH 1SGDE 3BIUH 2KCXA 1NRQH 1QGFA 2ZU4A 1KMAA 2G4UA 3UY9A 3AASA 1D6RA 5FPYA 1AMHA 2PWXA 3MH6A 4GUXA 1GHWH 2VVVA 3STIA 1UVTH 1KY9A 5A2MH 3SU6A 2CF8H 3N7OA 1BBRH 1O34A 1MTVA 1D3QB 1EQ9A 1L0ZA 4ZROA 2Q6DA 1IQGA 2BVXH 1K1IA 1PQ7A 3ZZ9A 1FY4A 1HAVB 3D23A 2Y7ZA 3T2NA 2XXLA 3O8CA 1EP6A 4B75A 1O5EL 3EE0B 1JIRA 3FAOA 4MNXA 5JB9S 4Q7YA 1W2KH 1XUHA 3L33A 3K6ZA 1O2WA 4BAKB 2ZHWH 1NPMA 2RA0A 3RU4T 2TGDA 4JMYA 1QQUA 2A31A 5HM2A 3PM3A 3SZNA 3ZZ8A 4UFDH 1NFUA 1Z8IB 1S6FA 1DVAH 1BRUP 1DY8A 2JKHA 5EOKA 2ZPQA 1GBEA 2FZZA 1OWIA 2P95A 4DURA 2BD5A 4BTIB 1FNIA 1PPFE 1V2WT 2ZFRH 2BVRH 4OS7A 3K6YA 4NFFA 1SSXA 1F0UA 1V2OT 2ALPA 1J14A 3EYDA 3SORA 8LPRA 4DVAU 3A87A 1GBLA 2FOMB 2FOAA 1GJ4H 4TPYA 2H2ZA 3S9AA 4X6MA 1P57A 3KQCA 3GCHB 5A8YA 2PGQB 5L2ZH 3OY6U 5GIBA 2WCYA 1GG6B 3G01A 1O3DA 2SGEE 3RMLH 2PKAB 3SJIA 1O33A 3A80A 3SHAH 1JMOH 4ZMAH 4WF8A 5BPEA 1TGSI 1Z1JA 3ENSB 2P16A 4I8KA 2O8MA 2Y5HA 3VXEH 1BRBE 4LOYH 4R8TB 3VB3A 2XBXA 1K1JA 1UK2A 1DUAA 4A92A 4VGCB 3OVOA 3KL6A 1XUIA 2QYIA 1KXAA 2A5AA 1QB9A 3RXUA 2LPRA 2XYAA 4Z6AH 4CH8B 2GVFA 3B9FH 1UVFA 1WTHD 1GJBB 1Z71A 2RA3A 2R3YA 4AX9H 4NCYA 7ESTE 3SV6A 4Y0YE 1GDNA 2AGGX 1A61H 1K1NA 3F9EA 3MNCA 3TVJB 2JA4A 2TPIZ 3SUFA 5FBEA 3M36A 3BN9A 1W12U 1L4DA 4UONA 5BRRE 1M8BA 1MAXA 4D7FA 4XBBA 1SGNI 1P2OA 4FUEA 1EZSC 2FS9A 1HIAB 2H9HA 1YPHE 4NA9H 2J94A 2HOBA 2PTCE 1P8VC 4MDSA 1DY9A 1LCYA 1E37B 1TNKA 1MTUA 5HXFA 5AF9H 1AFEH 1V2ST 2BOHB 4AN7A 3RXBA 1HAHH 2BXUH 5JBCS 1ELEE 4ISHH 1ACBE 2PUQH 4TYDA 4X2YA 5EQQA 1EPTC 1ZTJA 1HV7A 1QL9A 1XKAC 2Z9JA 1C5PA 1S84A 3RXKA 4AGKA 3P92A 3GISB 4OS6A 4RSPA 2WPLS 2G00A 2PSXA 1TRMA 3SN8A 4X1RU 4GI3C 3MO6A 1P0SH 3S9CA 4DY7B 1T4UH 3PMAB 3GDUA 1S6HA 1NU7B 1O0DH 1BZXE 3T25A 3MYWA 1IQNA 1T7CA 2ANWA 1V2QT 3RXVA 1GI7B 1ZHPA 4M7GA 4IW4E 2Z6BD 1OPHB 3MU4A 1C5VA 1GBMA 1W7XH 2BZ6H 3PTNA 1TOCB 1EAWA 2UWOA 1FY3A 3HGPA 2FX6A 1TOMH 1IHSH 2OP9A 2Z9KA 3C27B 3CP7A 1G3EA 1DS2I 5TCCA 4F4OC 3E1XB 4HTCH 1BTHH 1D9IA 4X8TH 2UWLA 1O3CA 3ZVBA 3TJVA 2O8TA 1ZGIA 3U8TH 1J17T 4OGXA 5J4SA 3E6PH 2QQDA 1TGTA 3I77A 1XMNB 2FWWA 3V12A 1K28D 2FOCA 3OTJE 1F5RA 1AUJA 1J16A 1Z6EA 1HAVA 2ZPRA 1C1PA 2TRMA 4Q7XA 3SJ8A 3M61U 1V3XA 3EGKH 3E16B 4RKJB 1O5BB 4R0IA 1HXEH 1O5FL 1INCA 1AHTH 3BTFE 1LPGB 3LJOA 5EGMA 1TQ0B 5GDSH 1QB1A 4Y6DA 1H0ZA 3BSQA 3L6PA 3LU9B 1YTPA 2N52A 3P17H 3QO6A 1VCPA 5EW1H 1C2EA 1OOKB 1GVKB 2PV9B 3PLBA 1VITG 3SNCA 1O2HA 3LONA 4B2BA 3A7XA 1BJVA 1Y3YA 2V3HH 1ZTLA 4Y8ZA 3QDZB 2WPJS 1QTFA 5EXNA 1ANDA 1GGDC 3RC5A 1IY5A 4Y76A 5E2PA 1F5LA 1SLWB 3F9GA 5DGJA 3EA8A 2R9PA 2JH6D 4FUGA 5FAHA 2OBOA 3F9FA 2QXJA 4X6OA 4H6TA 4HGUA 1C1OA 1A7SA 4I33A 1C1WH 4ZHMU 3U9AH 1O2UA 3MU8A 2O8WA 2ODPA 1BY2A 1CE3A 1O5DH 2BY7X 2R3UA 4JZDH 1ORFA 4U2WA 1B0FA 3TK6A 1LMWB 1MZDA 1ELVA 1G3DA 1EPTB 1V2UT 1V2MT 3M5MA 3LC5A 1HAPH 1QNJA 3LT3A 2PSYA 2ZA5A 3GY2A 1UTQA 3GY3A 4WH6A 3ZV8A 1MKXH 3GCNA 2BD4A 1SVPA 1Y5AT 3BTKE 2VIOA 3BG8A 4DIHH 1SLUB 1BCUH 4INKA 3PLKA 4AB8A 1PPZA 1O2GH 3DD2H 4K1SA 5ESTE 1TA6A 5L2YH 2FX4A 2B0FA 1G2MA 3RMNH 1OWHA 1GHBG 3P8OA 4OGYA 1OWEA 1GDUA 1K21H 2QN5T 3BTTE 3ATWA 3A7TA 1FY8E 3MU1A 4TY7A 3RXTA 4AYVB 2NU0I 3RLYH 1O2SA 4BANB 1FIZA 1TFXA 1GPZA 2F3CE 3TK9A 1ZTKA 3HK6B 2BDBA 2ZU2A 3S69A 4FUBA 2SFAA 2WYJA 3VGCC 1SHHB 2LNCA 3GY5A 1IY6A 1FN8A 1ZHRA 3ITIA 1CSOE 2ZFTA 4I31A 2AEIH 5T6GA 4MNVA 1AI8H 1F5KU 3PLPA 2G5NA 1DSUA 3QX5H 1A3BH 1ELTA 1T31A 3M7TA 1LPZB 3NK8A 4Y79A 1IQLA 2FP7B 1GBJA 3RXSA 3FZDA 4U01A 1G3BA 1TNGA 4FU9A 3PWCA 4CRBA 2BB4A 2OVOA 2IOTA 1EATA 3ZVDA 2VIVA 1A0LA 1GI0A 1QR3E 3ATKA 5JDUB 3SGQI 1UHBA 2VGCC 2A4OA 1GVZA 1C5RA 1PFXC 5JBAS 2SGPI 3F9HA 1SGFA 4XBDA 1IQFA 3SNEA 2WV5A 1AWFH 1SGPI 1N1LA 2CMYA 2ZQ1A 1SGTA 1GBDA 1VZQH 4B2CA 1TNLA 3DFJA 1O2VA 4IN2A 2V3OH 1AVWA 1SGYI 1BMLA 5T3HA 1GBFA 2Z3EA 2BDCA 3V3MA 2EI6A 2NU1I 3RXLA 2ZNKH 1F0TA 3BF6H 2ZGBH 4CR9A 5TCAA 2QF3A 4WMEA 1SG8B 3QLPH 1KLIH 1LHGH 3SHCH 2GDDA 2W5EA 1Y5UT 3FZZA 2Z9GA 2QV1A 1C5QA 1GGDB 1T32A 1W11U 3MMGA 2OXSA 4K3JA 4BAMB 2KMRA 1AZ8A 2AGEX 1HJAI 1A3EH 1WSSH 2H6MA 8GCHF 4UE7H 2N17A 2B5TB 2BVSH 5L30H 2QF0A 3RXQA 1O3BA 2G51A 3W95A 4DJZB 3M7UA 1QRZA 2ZG0H 2XC4A 3M5LA 5DPAA 3P70B 2W7SA 2ZGJA 4ISIH 1TABE 3FVFB 1GHVH 1WQSA 2JYYA 4JZ1A 2SGAA 4ISLA 4K1TA 1D3TB 4U32A 5C5NA 3PMBB 3LGUA 3GY6A 3PO1B 4JYUH 1O35A 2BD7A 2NU4E 2VWLA 3E8LA 1Q2WA 1P3EA 1RS0A 2Z94A 3BEUA 3D62A 5K0HA 1C5UA 1UCYK 3BTQE 1DS3I 1PCEA 1O2ZA 1BMAA 3SV9A 2ZGHA 2ZDVH 1K1MA 2ZHFH 3DT0H 4FUJA 3T5FH 4INHA 1GJ8B 4H6SB 1W7GH 2GT7A 1UTMA 4MPXA 2ZTXA 1VITH 2ZU5A 4OVOA 1AE8H 3W94A 4A1VA 5EODA 3TH2H 2N71A 4LXBH 4HGCA 2BD3A 3QN7A 3RXGA 3VGCB 1QL8A 1WCZA 4IGDA 4MPWA 2VNTA 3A8DA 2P59A 3QUMP 1YLDA 2ZDNA 1VJ9U 1BRCE 1GJ6A 1JOUB 4MVNA 3MTYA 1H9HE 5FBIA 1NFYA 3A8CA 1QJ6B 1UMAH 2Q6FA 1F2SE 1DLKB 1HXFH 1GJ5H 2A4RA 1V2RT 2BDIA 1MCVA 1J15A 1P05A 4NA8A 2KAIA 2FI4E 2XWBI 4HFPB 1ZGVA 3LGWA 6GCHG 4X1NU 4GLYA 2VGCB 2FYQA 2A2XH 1TLDA 1O3HA 1E38B 1MD8A 4ABIA 2F9NA 1GHXH 1T8OA 3JZ1B 5DP6A 1FY1A 1XKBC 3ZVEA 1LDTT 1TBQH 2QGRA 1GCDA 4GCHG 3UTUH 3QZQA 2P3UB 1TPPA 2Q6GA 4FU8A 1G37A 3R3GB 4CRCA 1QRWA 1B5GH 1ZSLA 1FZZA 2RCEA 1DSTA 5ESBA 1V2JT 2STAE 2WINI 5JYIA 1HUTH 3ZVFA 3UNRA 1GWAA 4J1YA 2AFQB 3K2UA 5HM9A 1ABIH 2JH0D 3K65B 1YC0A 1P11E 4CR5A 1EOJA 5AHGH 3RM2H 2A0QB 4UFFH 1TBZH 2HLCA 1G2LA 3PMJA 2SGDE 4JYTA 1SQAA 3TITA 1UO6A 4ZKOU 1MH0A 1O3OA 2ZFFH 5FXLA 4KGAA 1CGIE 4BOHA 1O5EH 2JXDA 2XBWA 5F8XA 2PKSB 1AN1E 1HPGA 1GHBF 1SGRE 3R0FA 4YZUA 1XVOA 1GBHA 2BLQA 2F91A 4MG3A 2P3TB 1O3LA 1YU6C 5AVDA 1C5NH 4D8NA 1BUIA 1HLTH 1MTNB 4CREA 3SGBE 2BY8X 1TBRR 2VIQA 5DP9A 2ALVA 4WXVA 4E06H 1CT4I 3OYPA 1KTTB 4AFUA 2ZDMA 2B8OH 3T26A 3LH3A 5FCRA 1LHCH 4IMQA 1MBMA 3SJOA 4XOJA 2G55A 1BTYA 3TJUA 2JZMA 1P12E 2OC1A 1NN6A 3AAVA 2C8WB 2C90B 2ANMH 2XBVA 1ZRKA 3TLOA 1YYY1 4ABBA 1Z7KA 3RU4E 3SNBA 3BTDE 2G4TA 1O2PA 3QWCH 5DKMA 3HKJB 1O3KA 1KLJH 2OBQA 1V2VT 3MHWU 1JBUH 4CH2B 1SOTA 1UVGA 1HJAC 2XW9A 1P06A 4Y11E 1HAXB 3CS0A 1F0SA 4ZAEA 5C2ZA 1J8AA 2P93A 1CA8B 5A8XA 3NUMA 1H4WA 1QBVH 1TMBH 2W7UA 3RXJA 2H5DA 5C5OA 4GSOA 3HH2C 6ESTA 1HPTA 1C2JA 2G5VA 3TH4H 2GV6A 1MTWA 1LVOA 3BTEE 4SGBI 1G3CA 3ATMA 2A7HA 2WPKS 1PPHE 4X1PU 3FP7E 4AB9A 5PTPA 2GTBA 1C4U2 1S5SA 3LC3A 1IQIA 3MO9A 4XDEA 3SGAE 3SOSA 1SGQE 1LPKB 2XRCA 1RTLA 2VWNA 2BX3A 2D2DA 1TGBA 1TX7A 1ZSKA 2FTMA 2XCNA 4AFZA 2PHBA 3A84A 4I8JA 3ZZCA 1FY5A 5E0HA 3SI4H 2D1JA 4X6NA 1TBQR 1O38A 2C3SA 2ILNA 1TB6H 1F92A 1QRXA 5HYOA 2D8WA 4YOGA 3M3SA 4O3TA 3RXHA 2ZI2H 1YPMH 4ABHA 1NY22 3KQDA 1D3PB 1AGJA 1KXFA 4KTCA 3P8FA 2OYAA 2JOPA 2F9PA 1OWKA 2ZGCA 1AE5A 1P9SA 3A7YA 2BY9X 1LTOA 2GKVE 1F7ZA 3KQBA 1MU6B 2STBE 1W0YH 2GZ9A 1LQDB 3KEEA 4B73A 1MAYA 1HJ9A 3KQEA 1YPKH 4NIWA 1WQVH 2BQ7B 1DT2A 3GY7A 3E3TA 4ZHLU 1H9IE 3H7TA 3MNSA 1UK3A 3UNQA 1NS3A 4TPIZ 3MNBA 1SQOA 1ZHMA 1YCPM 6LPRA 1O2MA 3SV7A 1TONA 4ZHAA 1C1UH 1TRNA 1P02A 4BXWA 1PJPA 2FOGA 1BOQA 1A5HA 2BXTH 2FLRH 3RUOA 2UUKB 1C1SA 1XUKA 3GCTG 3A7VA 2NU2I 1T8MA 1IQMA 4KELA 2F9BH 4Q80A 4H4FA 5DK1A 4CRDA 2VH0A 3LH1A 4K69A 4GPGA 4E7NA 1ARBA 2GCHG 4YLUA 1EAUA 1LHFH 2VH6A 5DJ7A 1WBGB 4AFSA 1UHBB 2HWLB 2BD9A 2A4GA 1DWDH 2FI5E 2ZO3H 6GCHF 1W0ZU 5F8ZA 4MNYA 2NWNA 1CGJE 1SLXB 5H4IB 1ID5H 2K1QA 4A1TA 1GCTC 2HNTF 4GCHF 2V35A 4NIYA 3ZVAA 1AKSB 8GCHG 4ABAA 1AQ7A 1BTPA 1C5OH 3T27A 2G8TA 3C1KA 5EXLA 4NG9H 2FOEA 1HJAB 3Q3YA 1ZPCA 1EOLA 1BMNH 2XCFA 2ZCLP 3ZZ5A 1CU1A 3PTBA 1FAKH 3A83A 2FOBA 2C93B 5LGOA 3NWUA 1P9UA 1AVXA 5DP3A 1ZYOA 1QIXB 1Z6JH 9ESTA 1C2LA 4CRGA 2P8OC 4X2XA 1QBOA 1O2YA 2Q1JA 1O3GA 1BRAA 2RDLA 2VU8E 1HDTH 1TPOA 1CHGA 3PYHA 3ZV9A 1AD8H 1TPSA 3UREA 1XXFA 1B0EA 3PROA 3EA7A 5GXPA 3ZVGA 2CGAA 3RXCA 1SGCA 1O3EA 2CXVA 2OQUA 3EAJA 1ELBA 3V7TA 3S0NA 1Z1IA 1OVOA 2ZFQH 1DWCH 3UQOA 1RXPA 1Y3WA 1XXDA 1O2RA 1SB1H 2I6QA 3GOVB 3UUZA 2H1UA 1JXPA 1OYQA 2VIPA 1GI5A 2ZWLH 3SQEE 7LPRA 2SGFI 1L2EA 1LQEA 1GI6A 2BDYA 5FCKA 1SGNE 2GGVB 1IQHA 1GL1A 3AAUA 3M5NA 1XUFA 3UR6A 3NCLA 1THRH 5L6NH 5EG4A 4CBOA 1ETSH 1C2HA 1C2FA 1O5CB 2AH4X 1BITA 3RM0H 1FLEE 1AVGH 1PYTD 2DE9A 4UEHH 1FN6A 1AUTC 2PUXB 2D26C 3DUXH 2BMGB 3UWIA 2O9QA 1O2TA 2A45B 3SUEA 1BMOA 3O8DA 5DP8A 1W10U 2BDAA 4FUCA 2GMTC 4FUDA 1C4V2 4K1EA 5T6DA 2C8XB 1AO5A 2C4FH 1Z8JB 1PQ8A 1OP2A 2EI8A 3Q76A 1UCYH 4OS5A 4MTBA 2AMQA 3A81A 1GI9B 1YPLH 2PR3A 3LGTA 4XSKU 1DDJA 1H1BA 1IHTH 1TNJA 3UQVA 1FV9A 1Y8TA 3IG6B 2Z7FE 3KGPA 5LPFA 1VCQA 2BD2A 2XBYA 1K2I1 1DM4B 3MO3A 4WMDA 4A7IB 1C5ZB 3RXRA 2GKRI 1DWBH 1GMHG 3LGIA 4NFEA 4WJG2 5C67A 1TX6A 2G81E 2KAIB 1L1JA 1FJSA 3PO1C 1TYNA 3ZYDA 1ZR0A 5HMAA 5CE1A 2A7JA 2UUFB 1DS2E 3TIUA 2SGQI 4D9RA 1DX5M 4JYVH 2BQ6B 3TK5A 1CA0C 4E7RG 2Y6TA 1Y1CA 2QXIA 1L1GA 1GCTB 1LR9A 1ZMLA 2F9OA 3CS7A 1KXDA 4SGAE 1ETTH 1GI8B 1UVSH 3I29A 1Y59T 1G9IE 1O2XA 1XVMA 2F9VA 1GHZA 4WWYA 4DG4A 3FANA 5GCHF 3TGKE 2J92A 2KMOA 1JRSA 3UFAA 1M9UA 1VGCC 1C5WB 4WY3A 1LKAA 4UFGH 2QXHA 2JP0A 1MCTA 2VWMA 1P10A 3JZ2B 8KME2 1JRTA 3LPRA 4GAWA 1W8BH 1ELDE 2P8OB 4KKDA 2BY6X 3KN2A 4X0WU 4UD9H 2NU3I 1AY6H 4JZEH 3BTGE 4Q7ZA 1YKTA 4ISOA 2ERWA 1BDAA 1FIWA 3P95A 1ZMNA 4KTUA 1D4PB 2FPZA 1HAZB 2FDAA 2O8LA 1UK4A 2WUCA 3OY5U 3ODFA 3TJOA 1C5YB 2GX4A 2R2WU 1AWHB 1KYNA 3MU0A 4YM9A 1FXYA 4KTSA 4U30A 5JFBA 2GKTI 1KXCA 1W14U 2V0BA 1GVLA 1GI4A 1HDLA 2HPQH 3SI3H 3ZZAA 4I7YH 2ANKH 2ODQA 4IS5A 1ZPBA 3BEIB 1P2NA 2HGTH 3TGJE 2WUBA 3GCTF 4D9QA 4F49A 1AKSA 1SGIB 1L1NA 5EQSA 2GCHF 3U69H 1FONA 1C1NA 4BAQB 1ELFA 1YGCH 3OSYA 4DIIH 2FODA 1B7XB 1Z7KB 3D49H 1BT7A 2OC0A 3F1SB 1SI5H 1T4VH 4WH8A 1T8NA 2ZDAH 3UPEA 2IPHA 1XM1A 1SPJA 1CT2I 5A8ZA 3GY4A 4YOJA 5CMXH 2TGTA 2ZC9H 1DICA 2GMTB 5DP5A 2ZF0H 1PQAA 1C5XB 1C1RA 3F6UH 1V2PT 1NFWA 1WUNH 2PKSC 4H42U 1QBNA 3STJA 2FOFA 3VB7A 3QGNB 2P94A 3ESTA 2YNBA 4D7GA 4K8BA 2BOKA 1C2DA 1V2NT 5GWZA 3QTOH 4NWLA 3SU0A 1TBRH 1E0FD 3IWMA 2ZCHP 2ZGXH 5F8TA 1J9CH 2BM2A 1MTNC 4CRFA 2NU0E 2P6AC 1W3CA 1SHYA 2FS8A 2GP9B 3M7QA 1BTUA 1P01A 1P3CA 1LHEH 3RXEA 4THNH 3VB4A 4ASHA 1ANCA 2Y5FA 2HRVA 1ZLRA 1Z8RA 1TGNA 2FESH 1CA0B 5CHAC 2V53A 4NWKA 2VB0A 3Q00A 4HZHA 1TUSA 4OS2A 4AG1A 1XX9A 1YLCA 1Q31A 2GCTB 4NIXA 4Y0ZE 1BUSA 3GY8A 1LR7A 3AVZA 1CVWH 1CT0I 3RXOA 2ZQ2A 4CHAC 1UVPA 5I46H 3SGQE 2GD4B 3LIWA 1VGCB 3KIDU 2H5CA 3OU0A 1C4Y2 5EPYA 3SV8A 2BD8A 1OS8A 2ZTYA 1TGSZ 2P3FH 4GVUA 5EXMA 3U98H 2ZDLA 1A5IA 1HAIH 2SGPE 2ODYB 3UOUA 1SGEI 1FI8A 1QHRB 2OY3A 3HPTB 3LGYA 4O03A 4E05H 1YCPK 1EZXC 1V2TT 1N6YA 1SGPE 1P2QA 5C1UA 3PV4A 1SGDI 4Q2KA 1S83A 3E0NB 4XBCA 1SGYE 1BA8B 1HYLA 1SC8U 3MNXA 2NU1E 1TNHA 1A5GH 1O2JA 4ABEA 2ZFPH 1UVUH 2CF9H 3RU4D 1N13A 2LEOA 2ZCKP 1OP8A 1IQEA 2ZU3A 1HJ8A 1TURA 2ULLA
chains in the Genus database with same CATH superfamily
1EKBB 2UVOA 5A09A 1NBME 1LVYA 1UTOA 3H09A 1KMHB 2J98B 1CO7E 3BV9B 2ZHQH 4ZKSU 2A5IA 2JETB 2ZTZA 4UXJA 2R0KA 1MT1A 1GMHF 4FUHA 5E0JA 4IBLH 1ARCA 1M8CA 3F0PA 1O30A 2V6NA 2ZPSA 4O9VA 4WVPE 1S0RA 1THSH 2M2AA 1HAYB 2AYWA 4F55A 1RFNA 3M3TA 3VEQB 3B8JA 3DHKH 2ORWA 1EXFA 4BAHB 1OYVI 1EB2A 1E35B 2OZUA 1EZUC 1VKYA 5CHBA 1GJDB 1ANEA 4GHQA 1PPFI 4K2YA 4JK6A 3F0OA 1RRKA 1RIWC 2PFEA 1O2IA 1DOJA 1S82A 2B0UC 4Q63A 1FUJA 2J2UA 3U8OH 3M3VA 1TAWA 1SMFE 1GJ9B 5JBBS 1TPAE 3ATLA 3ZZBA 1XUJA 4Y71A 2RIJA 2AGIX 2XTTB 1Z2IA 1YPEH 1EAIA 2TGAA 1C9TA 1BIOA 3LKWA 2QAAA 2QA9E 2ZEBA 2SGEI 4FU7A 3UWJH 4ZCNA 2ARPF 2FYRA 3SO3A 1WAYB 4K60A 5IYTA 4I8HA 5EPNA 3U8RH 2M5TA 2YQPA 1AFQB 3HGNA 1C1VH 2G52A 1NRSH 1SR5C 3GYMA 1EP5A 1U6QA 1AU8A 2JJ2D 3KCGH 1E1RD 5FPSA 1UJ1A 3BEFB 3QTLD 1X7AC 1CHOF 3PV5A 5CHAB 2M5XA 3B4VC 1WV7H 2CJIA 1MQ6A 1MKWH 1K1LA 3RDZA 1ZOMA 3SNDA 1XUGA 2DUCA 5FX6A 3SU2A 4YO9A 1O3AA 7GCHG 4CHAB 1A0HB 3S7HB 2ASUB 3SU1A 1UTLM 5CCMA 2JA1A 2F9UA 4B74A 1K1OA 3MH5A 5B6OA 1EB1H 3IITA 1RTKA 3QGJA 1HAOH 1A2CH 2ZFSA 4I8GA 2WYGA 5J8FA 2XOKD 1BQYA 1ZPZA 2PTNA 2KFWA 1O36A 1QL7A 2Y5GA 3MQKC 4YESB 1C2IA 3F2GA 3TNTA 1IQKA 5C0UA 4A1XA 1HAGE 1ABJH 2J4IA 2VIWA 3FKSD 1C5MD 3TO7A 1SOZA 4AZ2B 2IN2A 2ANYA 1QURH 1O5AB 1V2KT 2FI3E 4IC6A 5FUVA 8ESTE 3AW1A 4ZXXH 1GBKA 3RP2A 3ELAH 1BTZA 1EAXA 5HGGA 1MTSA 4KP0A 3S9BA 2V3MA 5JHWC 1OWDA 1TX8A 3QK1A 1CGJI 2EA3A 1NXUA 1ZRBA 1FQ3A 2OC7A 2O8UA 1P2JA 3FFGA 2YOLA 5GCHG 4X6PA 1DUEA 3ZZ4A 2KCAA 4XRNA 2Y81A 1ESTA 2WPIS 3O8RA 1A0JA 1S20A 4D76A 2ZHDA 2ZHEH 5FX5A 2Z9IA 2BTCE 1MU8B 1D3DB 2HNTC 3R5AA 3A7ZA 1MD7A 1C1MA 1TWXB 3NPSA 1CT4E 3A8BA 1TMTH 3PWBA 1RIWB 3A88A 1ZJKA 1KXBA 5C3NA 2FO9A 1LVMA 1BB0B 2ZKSA 4LZ4B 3TH3H 3U28C 2BX4A 3A89A 2BQWB 2BDGA 1F0RA 2OCVB 2ZU1A 3MFJA 3A8AA 4UFEH 2A5KA 5E8EH 3CNRA 1D6WA 1O2QA 1OX1A 1UCYE 3RXIA 4AOQA 1P04A 1SL3A 4NSYA 3ZZ7A 3D65E 1NU9A 3DA9B 3UNSA 3LJJA 3RMMH 1R0RI 5T6FA 3ZVCA 1H8IH 5FUYA 1EJNA 4Y8XA 3SBKA 1S0QA 3VFEA 3OX7U 1O37A 4ZKRU 4CBNA 4DT4A 1TQ7B 4Y7AA 1W4RA 1DPOA 3PB1E 1PPGE 3UB0A 1C5TA 4PROA 4JZFH 1GI1A 1IAUA 2E73A 1G36A 1PPCE 2GT8A 1P2IA 1T8LA 2Z3CA 3SEKC 1PJUA 1JWTA 1O3PB 1P09A 3GYLB 2ELIA 2Y82A 4Y10E 1P9GA 6CHAC 1N8OC 1TE0A 4RN6A 1MJ9A 1O31A 3V0XA 1GBCA 2B7DH 3E0PB 5JPMH 4X2VA 1AB9C 2KCOA 2BUSA 4DGJA 2DE8A 1GHAG 1WOFA 4SGBE 1QQ4A 4OM9A 4X1SU 1KLTA 2CWHA 3T28A 1KDQA 1WYKA 2VJ1A 5AFZH 5DP7A 1NTPA 1OYTH 4YTAA 1A4WH 4DT7B 1K7TA 1E79D 1HCGA 3UOPA 1YBWA 1ESAA 4X1QU 2XC5A 4X2WA 5JBTA 4FUFA 1GBBA 1MKWK 1O5FH 1Y3XA 4JK5A 3TO9A 2HPPH 1QJ7B 1C1QA 4TWWA 1NT1A 1K1PA 2AHME 3V13A 3QZRA 1IQJA 1FARA 1GBAA 2A2QH 3RXAA 4OS4A 1DANH 3TJNA 1BBRK 3P6ZB 3RMOH 2FNFX 3FP6E 1E34B 2A7CA 1OSSA 3FN8A 3TJQA 4O3UA 1THPB 3ATIA 1OXGA 4AGJA 2WPHS 3MI4A 2WHXA 3M35A 2H9TH 3RXPA 3SJ9A 4E1PA 2CWFA 3MH7A 1O5GH 3MWIU 2J9RA 1AZZA 2HVXA 3LGVA 2W26A 3S7KB 1OMTA 3OEED 1W13U 4LZ1H 1QJ1B 1ZJDA 2FXRA 4I8LA 1PPBH 2OD3B 2H9EH 2OTTX 4F48B 1GI3A 2FLBH 1GMCG 1Z8GA 1FYBA 4FVDA 1A1RA 1RD3B 2CN0H 1H9LB 2C8ZB 1X4SA 2PQ8A 3RXDA 5FPTA 1XBTA 4ACAA 1O39A 2SNWA 1FMGA 1O2KA 2WPMS 2XC0A 2KX4A 5G4BA 4TWYA 2L6OA 2F3CI 1GHYH 3SJKA 2JJ1D 1KTSB 1QFKH 1NM6A 1OP0A 4HI3A 1CBWC 2ZP0H 2NU2E 4ZKNU 1ESBA 5C1XA 1MUEB 5A0BA 1TA2A 3QAHA 1CSOI 2BZAA 4NGAH 1MBQA 2PW8H 1ZSJA 5I25A 3VB6A 1GDQA 1NROH 2WGCA 1PQ5A 1OHHD 2GV7A 1QY6A 7GCHF 2BLWA 1YPHC 2OQ5A 2TBSA 3Q3KA 3I78A 4NZLA 3TU7H 1K22H 2F4LA 2ESTE 3DSOA 1CGHA 2YNAA 4BXSA 4FUIA 3SW2B 1HBTH 4B2AA 1VR1H 1MJAA 1C2KA 2GZ8A 4FXGH 1O3JA 2QF4A 2X52A 1E36B 3U1IB 2C8YB 1SFQB 1DLEA 5LH8A 2ZIQH 4BAOB 3MH4A 1LR8A 2EC9H 1HGTH 1Q3XA 3NZIA 3VB5A 2PP6A 2AS9A 2BY5X 1P9ZA 2KMQA 4IC5A 2CV3A 3BTWE 9WGAA 5ETXA 1EJMA 3ZZ3A 6CHAB 1N8OB 2J95A 3SV2H 3AW0A 1MQ5A 2PKAA 1CE5A 3P8GA 2W3KA 1CHOI 2RG3A 1AB9B 3L3TA 3TNSA 2FTLE 2QCYA 1WDIA 1YCPH 3MU5A 4YT7H 4OS1A 2SNVA 4IN1A 2GCTC 1P2MA 1YP9A 1DE7H 1PPEE 4J2YB 2V1CA 4YT6H 1TIHA 4DOQA 1LKBA 1EJAA 5GJ4B 4XFQA 4O97A 4Y8YA 1HNEE 1C2MA 1P2KA 2J97A 1OWJA 2SGFE 4DNCA 2KMPA 2WSSD 1NESE 1IOEA 2PLXA 1FY7A 2OUAA 1LVBA 1EASA 1UTNA 3MOCA 1ELAA 1Y3UA 3ZYEA 1TRYA 3TGIE 2GDEH 4B71A 2XWAA 4DCDA 5IDKA 3O8BA 1CHOG 3URDA 1VCWA 1GMDG 5DO4H 5LPRA 4AORA 1COWD 2VINA 2NU4I 1O3IA 3UIRA 4XE4A 4ABGA 3F68H 2L74A 3T62A 1HIAA 1ZZZA 4TY6A 5C94A 2QQCA 1GJAB 5JB8S 1TIOA 2UUJB 1DXPA 1O3NA 2TGPZ 1Y5BT 4CRAA 2CHAC 1OMUA 1LO6A 1EUFA 3A85A 2J34A 3BG4C 3LDXH 3SU5A 5C0TA 5AFYH 4ZH8A 3SU4A 1UTPA 4DW2U 4BNRA 2JETC 3URCA 2ZZUH 4ABDA 5F6MA 5HIZA 1PTQA 3ZZ6A 1O2NA 1CBWB 3LOXA 2RFKC 5C20A 1YLNA 1NFXA 1L4ZA 5DP4A 1K9OE 1YM0A 4WXIA 4YLQH 1VJAU 4UDWH 1V6DA 4BTUB 3FSYA 1GHAF 2BHGA 4B1TA 1QB6A 3H5CB 1Y1BA 1BHXF 1TNIA 5EQRA 2FM2A 4L9MA 1YWUA 2I6SA 2QQ0A 3BTME 1NO9H 2SGQE 1YPGH 2VVCA 2FIRH 2FEQH 2HLDD 2J38A 1NBMD 1SBWA 4NZQA 1A46H 3BIVH 4MLFB 5GPIB 5C1YA 4FVBA 3A82A 3TPIZ 1GBIA 1G32B 2AIQA 4YOIA 4NIVA 3U1JB 2F83A 3WY8A 5DAEA 4JCNA 1FPCH 3E90B 3VDPA 4AYYB 4ISNA 1H8DH 4IMZA 2BLVA 4B76A 1MABB 1OKXA 2QC2A 1AFQC 3GDVA 3SQHE 2XNIA 4AFQA 1O32A 4FOUC 2BLOA 1EZQA 5ABWA 1QCPA 2GZ7A 3E91A 5E2OA 1BJUA 2JH5D 3Q77A 1NRRH 1K7VA 3ODDA 3BTHE 2A1DB 9LPRA 3VXFH 2A32A 2NU3E 4ZXYH 2EI7A 1ELCA 2AMDA 1V2LT 1HB0B 1NRPH 4WMFA 3GICB 3FP8E 1WU1A 1BBRE 3EQ0H 4X8SH 4MPIA 2Y7XA 1RJXB 1ANBA 1FDPA 1GI2A 1NZQH 2SGDI 3D00A 1P57B 1GBTA 4ABJA 1GMCF 2BDHA 1SGFG 1CQQA 1UUCA 4INLA 3PRBA 1MZAA 1CGII 3N99A 1EX3A 1O2LA 1DITH 2R0LA 3KF2A 1NRNH 4X8UH 1AN1I 1SGRI 2J9NA 1N6XA 2V7QD 3GCOA 1BHXB 2YUUA 2IJOB 1FAXA 1WTGH 1ZMJA 2HALA 7KMEH 2PGBB 1FPHH 3DFLA 2B9LA 1S85A 4B6DA 1PYTC 4WP4A 3M5OA 5SGAE 2THFB 3KYGA 2FMJA 3KNXA 5TJXA 3UR9A 1O3MA 3P8NA 3SGBI 4MNWA 4Z0KA 2ZECA 5E0GA 5FHTA 1EFRD 4ESTE 1MKXK 4I32A 3HATH 1C1TA 3T29A 3H7OA 3Q3XA 5DG6A 1SFIA 3HKIB 1GJ7B 5J4QA 3ZZDA 3NXPA 1TGCA 1O3FA 3B23B 1BMMH 2AMPA 1UVOA 4B6EA 2Z3DA 4JZIA 3SU3A 1DXWA 3M37A 2BYAX 1VITF 1CT2E 3RC6A 1RGQA 2R2MB 1JIMA 2EEKA 2OTVA 4Y7BA 2FOHA 1C9PA 2CHAB 4K8YA 1GJCB 3BG4B 1P03A 1Y3VA 1YF4A 5EW2H 1HFDA 4NSVA 4MPVA 4MPUA 1EPTA 1IW4A 5DN6D 2UWPA 1BTWA 3EDXB 3NKKA 2LB7A 1SQTA 4RKOB 2VIDA 2OC8A 2QXGA 3QWPA 3RC4A 1S81A 1NUBA 3GCHC 1GG6C 2A4QA 1BTXA 3SUDA 4RI0A 1UTJA 2EQNA 1SLVB 1ELGA 2W3IA 3EA9A 3RXMA 1KIGH 1LHDH 2VWOA 5A0CA 5K7RA 1NC6A 2F43B 3W1EA 5FL7D 1KDQB 2WV4A 3RLWH 3A7WA 4P00A 5EU8A 2Y80A 1C5SA 2VVUA 1YPJH 2V1CC 5C17A 4BTTB 2QIQA 2QY0B 4VGCC 1ETRH 3KHVA 2UUYA 2ZDKA 1O2OA 1AIXH 4AG2A 3OXGA 1BMFD 3HK3B 3K9XB 3QTVH 3VPKA 4MQAA 3GDSA 4QT8C 1GL0E 1QA7A 1HRTH 1V1HA 1SGQI 5EJLA 5A0AE 1UTKA 2TIOA 3CENA 2AERH 1CT0E 1DFPA 4ZUHA 1TALA 2OLGA 1QA0A 1DWEH 1RTFB 1MJBA 3A86A 2HNTE 4A6LA 4X8VH 2GKVA 1TMUH 2WVJA 1G30B 4LK4A 1W3SA 3RXFA 3VE5A 4K5ZA 3SNAA 2Z9LA 4A5TS 5F03A 1MMJN 1KSNA 4ABFA 1SGEE 3SUGA 5LPEA 3PMHB 1C2GA 4NA7A 1GMDF 2OINA 1KXEA 2AIPA 4GHTA 1C5LH 1SGDE 3BIUH 2KCXA 1NRQH 1QGFA 2ZU4A 1KMAA 5IK2D 2G4UA 3UY9A 3AASA 1D6RA 5FPYA 1AMHA 2PWXA 3MH6A 4GUXA 1GHWH 2VVVA 3STIA 1UVTH 1KY9A 5A2MH 3SU6A 2CF8H 3R5BA 3N7OA 1BBRH 1O34A 1MTVA 1D3QB 1EQ9A 1L0ZA 4ZROA 2Q6DA 1IQGA 2BVXH 1K1IA 1PQ7A 3ZZ9A 1FY4A 1HAVB 3D23A 2Y7ZA 3T2NA 2XXLA 1V1IA 5F53A 1ULMA 3N7DA 3O8CA 1EP6A 4B75A 1O5EL 3EE0B 1JIRA 3FAOA 4MNXA 4P02A 5JB9S 3FC3A 4Q7YA 1W2KH 1XUHA 3L33A 3K6ZA 1O2WA 4BAKB 2ZHWH 1NPMA 2RA0A 3RU4T 2TGDA 4JMYA 1QQUA 2A31A 4FKDA 5HM2A 3PM3A 3SZNA 3ZZ8A 4UFDH 1NFUA 1Z8IB 1S6FA 1DVAH 1BRUP 1DY8A 2JKHA 5EOKA 2ZPQA 1GBEA 2FZZA 4RT1A 1OWIA 2P95A 4DURA 2BD5A 4BTIB 1FNIA 1PPFE 1V2WT 2ZFRH 5HKKD 2BVRH 4OS7A 3K6YA 4NFFA 1SSXA 1FX0B 1F0UA 1V2OT 2ALPA 1J14A 3EYDA 3SORA 8LPRA 4DVAU 3A87A 1GBLA 1K7UA 2FOMB 2FOAA 1GJ4H 4TPYA 2H2ZA 3S9AA 4X6MA 2B8TA 4ACBA 1P57A 3KQCA 3GCHB 5A8YA 2PGQB 5L2ZH 3OY6U 5GIBA 2WCYA 1GG6B 3G01A 1O3DA 2SGEE 3RMLH 5E3QA 2PKAB 2KCYA 1O33A 2XNDD 3A80A 1JMOH 3SHAH 3SJIA 4ZMAH 4A24A 4WF8A 3GOXA 1QZ8A 5BPEA 1TGSI 1Z1JA 1TOTA 3ENSB 2P16A 4I8KA 2O8MA 2Y5HA 3VXEH 1BRBE 4LOYH 4R8TB 3VB3A 2XBXA 1K1JA 1UK2A 1DUAA 4A92A 4VGCB 3OVOA 3KL6A 1XUIA 1E1QD 2QYIA 1KXAA 2A5AA 1QB9A 3RXUA 2LUYA 2LPRA 2XYAA 4Z6AH 4CH8B 2GVFA 3B9FH 1UVFA 1WTHD 1GJBB 1Z71A 2RA3A 2R3YA 4AX9H 4NCYA 7ESTE 3SV6A 4Y0YE 3UEJA 1GDNA 2AGGX 1A61H 1K1NA 1H8ED 3F9EA 2CK3D 3MNCA 3TVJB 2TPIZ 3SUFA 2JA4A 5FBEA 3M36A 3BN9A 5KGOA 1W12U 1L4DA 4UONA 5BRRE 1M8BA 1MAXA 4D7FA 4XBBA 1SGNI 1ULKA 1P2OA 4FUEA 1EZSC 2FS9A 1HIAB 2H9HA 1YPHE 4NA9H 2J94A 2HOBA 2PTCE 1P8VC 4MDSA 5EX0A 1DY9A 1LCYA 1E37B 1TNKA 1MTUA 5HXFA 5AF9H 1AFEH 1V2ST 2BOHB 4AN7A 1Y8FA 3RXBA 1HAHH 2BXUH 5JBCS 1ELEE 4ISHH 1ACBE 2KZ4A 2PUQH 4TYDA 4X2YA 5EQQA 1EPTC 1ZTJA 1HV7A 1QL9A 1XKAC 2Z9JA 1C5PA 1S84A 3RXKA 4UXIA 4AGKA 2A20A 3P92A 3GISB 4OS6A 4RSPA 2WPLS 2G00A 5HI7A 2IJD1 1SKYE 2X3TA 2PSXA 1TRMA 3SN8A 4X1RU 4GI3C 3MO6A 1P0SH 4I86A 4Z1MD 3S9CA 4DY7B 1T4UH 3PMAB 3GDUA 1S6HA 1NU7B 1O0DH 3DSGA 1BZXE 3KY9A 3T25A 2EY4C 1IQNA 3MYWA 1T7CA 2ANWA 1V2QT 3RXVA 1HEVA 1GI7B 1ZHPA 4M7GA 4XD7D 4IW4E 2Z6BD 1OPHB 3MU4A 1C5VA 1GBMA 1W7XH 2BZ6H 3PTNA 1TOCB 1EAWA 2UWOA 1FY3A 3HGPA 2FX6A 1TOMH 1IHSH 2OP9A 2Z9KA 3C27B 3ZIAD 3CP7A 1G3EA 1DS2I 5TCCA 4F4OC 3E1XB 4HTCH 1BTHH 1D9IA 4X8TH 2UWLA 1O3CA 3ZVBA 3TJVA 2O8TA 1ZGIA 3U8TH 1J17T 4OGXA 5J4SA 3E6PH 2QQDA 1TGTA 3I77A 1XMNB 2FWWA 3V12A 3TOAA 1K28D 2FOCA 3OTJE 1F5RA 4ASUD 1AUJA 1J16A 1Z6EA 1HAVA 2ZPRA 1C1PA 2HVYB 2TRMA 4Q7XA 3SJ8A 3M61U 1V3XA 3EGKH 3E16B 4RKJB 1O5BB 4R0IA 2OU2A 1HXEH 1WKXA 1O5FL 1INCA 1AHTH 3BTFE 1LPGB 3LJOA 5EGMA 3UEYA 1TQ0B 5GDSH 1QB1A 4Y6DA 1H0ZA 3BSQA 3L6PA 3LU9B 2ROWA 1YTPA 2N52A 3P17H 3QO6A 1VCPA 5EW1H 1C2EA 1OOKB 4TSFD 1GVKB 2PV9B 3PLBA 1VITG 3SNCA 1O2HA 3LONA 4B2BA 3A7XA 1BJVA 1Y3YA 4YXWD 2V3HH 2UZ3A 1ZTLA 4Y8ZA 3QDZB 2WPJS 1QTFA 5EXNA 1ANDA 1GGDC 2LELA 3RC5A 1IY5A 4Y76A 3R5CA 5E2PA 1F5LA 1SLWB 3F9GA 5DGJA 3EA8A 2R9PA 3RU0A 2JH6D 4FUGA 3KQ5A 2OBOA 5FAHA 3F9FA 2QXJA 3BJIA 4X6OA 4H6TA 4HGUA 1C1OA 3DSPA 1A7SA 4I33A 1C1WH 4ZHMU 2E5RA 3UGDA 3U9AH 1O2UA 3MU8A 2O8WA 2ODPA 1BY2A 1CE3A 1O5DH 2J87A 2BY7X 2R3UA 1SQRA 4JZDH 1ORFA 4U2WA 1B0FA 3TK6A 1LMWB 1MZDA 1ELVA 3N7EA 1G3DA 1EPTB 1V2UT 1V2MT 3M5MA 3LC5A 5EIYA 1HAPH 1QNJA 3LT3A 2PSYA 2ZA5A 3GY2A 1UTQA 3GY3A 4WH6A 3ZV8A 1MKXH 3GCNA 2L7XA 2BD4A 1SVPA 1Y5AT 3BTKE 2VIOA 3BG8A 4DIHH 1SLUB 1U5KA 1BCUH 4INKA 3PLKA 3OL0A 4AB8A 1PPZA 1O2GH 1WXRA 3DD2H 4K1SA 5ESTE 1TA6A 5L2YH 2FX4A 2OK5A 2B0FA 1G2MA 3RMNH 1OWHA 1GHBG 3P8OA 4OGYA 1OWEA 1GDUA 3FOAA 1K21H 2QN5T 3BTTE 3ATWA 3A7TA 1FY8E 3MU1A 4TY7A 3RXTA 4AYVB 5CDFE 2NU0I 3RLYH 3FSXA 1O2SA 4BANB 1FIZA 1TFXA 1GPZA 2F3CE 3TK9A 5EJZA 1ZTKA 3HK6B 2BDBA 2ZU2A 2KM0A 3S69A 4FUBA 2SFAA 2WYJA 3VGCC 1SHHB 2LNCA 3GY5A 2N1AB 1IY6A 5HQ8A 1FN8A 1ZHRA 3ITIA 1CSOE 2ZFTA 4I31A 2AEIH 5T6GA 4MNVA 1AI8H 1F5KU 3PLPA 2G5NA 1DSUA 3QX5H 1A3BH 1ELTA 1T31A 3M7TA 1LPZB 3NK8A 4Y79A 1IQLA 2FP7B 1GBJA 3RXSA 7WGAA 3FZDA 4AC9A 4U01A 1G3BA 1TNGA 4FU9A 3PWCA 4CRBA 2BB4A 2OVOA 2IOTA 1EATA 3ZVDA 2VIVA 1A0LA 1GI0A 1QR3E 4FETA 3ATKA 5JDUB 3SGQI 1UHBA 2VGCC 2A4OA 1GVZA 1C5RA 1PFXC 5JBAS 2SGPI 2DIPA 3F9HA 1SGFA 4XBDA 1IQFA 3SNEA 2WV5A 1AWFH 1SGPI 4M9FA 1N1LA 2CMYA 2ZQ1A 1SGTA 1GBDA 1VZQH 4B2CA 1TNLA 3DFJA 3SYJA 1O2VA 4IN2A 2V3OH 1AVWA 1SGYI 1BMLA 5T3HA 1GBFA 2Z3EA 2BDCA 3V3MA 2EI6A 2NU1I 3RXLA 2ZNKH 1F0TA 3BF6H 2ZGBH 4CR9A 5TCAA 2QF3A 4WMEA 1SG8B 3VDUA 3QLPH 1KLIH 1LHGH 3SHCH 2GDDA 2W5EA 1Y5UT 3FZZA 2Z9GA 2QV1A 1C5QA 1GGDB 1T32A 1W11U 3FO8D 3MMGA 2OXSA 4K3JA 2CWGA 4BAMB 2KMRA 1AZ8A 2AGEX 1HJAI 1A3EH 1WSSH 2H6MA 8GCHF 4UE7H 2N17A 2B5TB 2BVSH 5L30H 2QF0A 3RXQA 1O3BA 2G51A 3W95A 4DJZB 3M7UA 1QRZA 2ZG0H 2XC4A 3M5LA 2W0TA 2L8EA 1UW7A 5DPAA 3P70B 2W7SA 2W6JD 2ZGJA 4ISIH 1TABE 3FVFB 1GHVH 1WQSA 2JYYA 4JZ1A 2SGAA 4ISLA 4K1TA 1D3TB 4U32A 5C5NA 3PMBB 3LGUA 3GY6A 3PO1B 4JYUH 1O35A 2BD7A 2NU4E 2VWLA 3E8LA 1Q2WA 1P3EA 1RS0A 2Z94A 3BEUA 3D62A 5K0HA 1C5UA 1UCYK 3BTQE 4TT3D 1DS3I 1PCEA 1O2ZA 1BMAA 3SV9A 2ZGHA 2ZDVH 1K1MA 3CXLA 2ZHFH 3DT0H 4FUJA 3T5FH 4INHA 1PTRA 1GJ8B 4H6SB 1W7GH 2GT7A 1UTMA 1Q9BA 4MPXA 5J8CA 2ZTXA 1VITH 2ZU5A 4OVOA 1AE8H 3W94A 1W0KD 4A1VA 5EODA 3TH2H 2N71A 4LXBH 4HGCA 2BD3A 3QN7A 3RXGA 3VGCB 1QL8A 1WCZA 4IGDA 4MPWA 2VNTA 3A8DA 2P59A 3QUMP 1YLDA 2ZDNA 5KECA 2ORVA 1VJ9U 1BRCE 1GJ6A 1JOUB 4MVNA 3MTYA 1H9HE 5FBIA 1NFYA 3A8CA 1QJ6B 1UMAH 2Q6FA 1F2SE 1DLKB 1HXFH 1GJ5H 2A4RA 1V2RT 2BDIA 1MCVA 1J15A 1P05A 4NA8A 2KAIA 2FI4E 2XWBI 2W6ID 2J5UA 4HFPB 1ZGVA 3LGWA 6GCHG 4X1NU 5GNDA 4GLYA 1KBFA 2VGCB 2FYQA 2A2XH 1TLDA 1O3HA 1E38B 1MD8A 4ABIA 2F9NA 1GHXH 1T8OA 3JZ1B 5DP6A 1ULNA 2ODDA 1FY1A 1XKBC 3ZVEA 1LDTT 1TBQH 2QGRA 1GCDA 4GCHG 3UTUH 3QZQA 2P3UB 1TPPA 2Q6GA 4FU8A 1G37A 3R3GB 4CRCA 1QRWA 1B5GH 1ZSLA 1FZZA 2RCEA 1DSTA 5ESBA 1V2JT 2STAE 2WINI 3KYFA 5JYIA 1HUTH 3ZVFA 3UNRA 2YMSC 1GWAA 4J1YA 2AFQB 3K2UA 5HM9A 1ABIH 2JH0D 5KEDA 3K65B 1YC0A 1P11E 4CR5A 1EOJA 5AHGH 3UGIA 4RT0A 3RM2H 1K0HA 2A0QB 4UFFH 1TBZH 2HLCA 3OEHD 1G2LA 3PMJA 2SGDE 4JYTA 1SQAA 3TITA 1UO6A 4ZKOU 1MH0A 1O3OA 2ZFFH 5FXLA 4KGAA 1CGIE 4BOHA 1O5EH 2JXDA 2XBWA 5F8XA 2PKSB 1AN1E 1HPGA 1GHBF 1SGRE 3R0FA 4YZUA 1XVOA 1GBHA 2BLQA 2F91A 4MG3A 2P3TB 1O3LA 1YU6C 5AVDA 2CJSC 1VDDA 1C5NH 4D8NA 1BUIA 1HLTH 1MTNB 4CREA 3SGBE 2BY8X 1TBRR 2VIQA 5DP9A 2ALVA 4WXVA 4E06H 1CT4I 3OYPA 3OE7D 1KTTB 4AFUA 3TOBA 2ZDMA 2B8OH 3T26A 3LH3A 5FCRA 1LHCH 4IMQA 1MBMA 3SJOA 4XOJA 5FUXA 2G55A 1BTYA 3TJUA 2JZMA 1P12E 2OC1A 1NN6A 3DCLA 3AAVA 4B6FA 2C8WB 2C90B 2ANMH 2XBVA 1ZRKA 3TLOA 1YYY1 4ABBA 1Z7KA 3RU4E 3WW7A 3SNBA 3BTDE 2G4TA 1O2PA 3QWCH 3PV2A 5DKMA 3HKJB 1O3KA 1KLJH 2OBQA 1V2VT 3MHWU 1JBUH 4CH2B 1SOTA 1UVGA 1HJAC 2XW9A 1P06A 4Y11E 1HAXB 3CS0A 1F0SA 3OFND 4ZAEA 5C2ZA 1J8AA 2P93A 1CA8B 5A8XA 3NUMA 1H4WA 1QBVH 1TMBH 2W7UA 3RXJA 2H5DA 5C5OA 4GSOA 3HH2C 6ESTA 1HPTA 1C2JA 2G5VA 3NRLA 3TH4H 2GV6A 1MTWA 1LVOA 3BTEE 2JW6A 4SGBI 1G3CA 3ATMA 5HIYA 2A7HA 2WPKS 1PPHE 2JDID 4X1PU 3FP7E 4AB9A 5PTPA 2GTBA 1C4U2 1S5SA 3LC3A 3MEKA 1IQIA 3MO9A 4XDEA 3SGAE 3SOSA 1SGQE 5T1VA 1LPKB 2XRCA 1RTLA 2VWNA 2QF5A 2BX3A 2D2DA 1TGBA 1TX7A 1ZSKA 2FTMA 2XCNA 4AFZA 2GIVA 2PHBA 3A84A 4I8JA 3ZZCA 1FY5A 5E0HA 3SI4H 2D1JA 4X6NA 1TBQR 1O38A 2C3SA 2ILNA 1TB6H 1F92A 1QRXA 5HYOA 2D8WA 2YMSB 4YOGA 3M3SA 4HG6A 4O3TA 3RXHA 2ZI2H 1YPMH 4ABHA 1NY22 3KQDA 1D3PB 3UFFA 1AGJA 1KXFA 4KTCA 3P8FA 2OYAA 2JOPA 2F9PA 1OWKA 2ZGCA 1AE5A 1P9SA 3A7YA 2BY9X 5EX3A 1LTOA 2RC4A 2GKVE 1RFHA 1F7ZA 3F2HA 3KQBA 1UHAA 1MU6B 2STBE 1W0YH 2GZ9A 1LQDB 3KEEA 4B73A 1MAYA 1HJ9A 3KQEA 1YPKH 4NIWA 1WQVH 2BQ7B 1DT2A 3GY7A 3E3TA 4ZHLU 1H9IE 2QQEA 3H7TA 3MNSA 1UK3A 3UNQA 1NS3A 4TPIZ 3MNBA 1SQOA 1ZHMA 1YCPM 6LPRA 1O2MA 3SV7A 1TONA 4ZHAA 1C1UH 1TRNA 2IPQX 1P02A 4BXWA 1PJPA 2FOGA 3TO6A 1BOQA 1A5HA 2BXTH 2FLRH 3RUOA 2UUKB 1C1SA 1XUKA 3GCTG 3A7VA 2NU2I 1T8MA 1IQMA 2J98A 2F9BH 4KELA 4H4FA 4Q80A 5DK1A 2VH0A 3LH1A 4K69A 4GPGA 4CRDA 4E7NA 5EJ1A 3AK5A 1ARBA 2GCHG 4YLUA 3E2IA 1EAUA 1LHFH 2VH6A 5DJ7A 1WBGB 1YY3A 4AFSA 1UHBB 2HWLB 2BD9A 2A4GA 1DWDH 2FI5E 2ZO3H 6GCHF 1W0ZU 4Q4LA 5F8ZA 4MNYA 2NWNA 1CGJE 1SLXB 5H4IB 1ID5H 2K1QA 4A1TA 1GCTC 2HNTF 4GCHF 2V35A 4NIYA 3ZVAA 1AKSB 8GCHG 4ABAA 1AQ7A 1BTPA 2DKVA 1C5OH 2GVIA 3T27A 5E3PA 2G8TA 3C1KA 5EXLA 4NG9H 2FOEA 1HJAB 3Q3YA 1ZPCA 3WWFA 1EOLA 2DB6A 1BMNH 2XCFA 2ZCLP 3ZZ5A 1TBNA 1CU1A 3PTBA 1FAKH 3A83A 2FOBA 2C93B 5LGOA 3NWUA 1P9UA 1AVXA 5DP3A 1ZYOA 3OXFA 1QIXB 1Z6JH 9ESTA 1C2LA 4AMLA 1WGCA 4CRGA 2P8OC 4X2XA 1QBOA 1O2YA 2Q1JA 1O3GA 1BRAA 2RDLA 2VU8E 1HDTH 1TPOA 1CHGA 2QE7D 3PYHA 3ZV9A 1AD8H 1TPSA 3UREA 1XXFA 1B0EA 3PROA 3EA7A 5GXPA 3ZVGA 2WV9A 2CGAA 3RXCA 1SGCA 1O3EA 2CXVA 2OQUA 3EAJA 1ELBA 3V7TA 3S0NA 1Z1IA 1OVOA 2ZFQH 1DWCH 5CCLA 3UQOA 1RXPA 1Y3WA 1XXDA 1O2RA 1SB1H 2I6QA 3GOVB 3UUZA 2H1UA 1JXPA 1OYQA 2VIPA 1GI5A 2ZWLH 3SQEE 7LPRA 2SGFI 1L2EA 1LQEA 1GI6A 2BDYA 5FCKA 1KBEA 1SGNE 1XX6A 2GGVB 1H8HD 1IQHA 1GL1A 3AAUA 3M5NA 1XUFA 3UAIC 3UR6A 3NCLA 2Y0MA 4UXHA 1THRH 2KR7A 5EG4A 5L6NH 1XA6A 4CBOA 4E1RA 1ETSH 1C2HA 1C2FA 1O5CB 2AH4X 1BITA 3RM0H 1FLEE 1AVGH 1PYTD 2DE9A 4UEHH 1FN6A 1AUTC 2PUXB 2D26C 3DUXH 2BMGB 3UWIA 2O9QA 1O2TA 2A45B 4JCVE 2GJGA 3SUEA 1BMOA 3O8DA 5DP8A 1W10U 2BDAA 4FUCA 2GMTC 4FUDA 1C4V2 4K1EA 5T6DA 2C8XB 1AO5A 2C4FH 1Z8JB 1PQ8A 1OP2A 2EI8A 3Q76A 1UCYH 4OS5A 4MTBA 2AMQA 3A81A 1GI9B 1YPLH 2PR3A 3LGTA 4XSKU 1DDJA 1H1BA 2WZQA 1IHTH 1TNJA 3UQVA 1FV9A 1Y8TA 3IG6B 2Z7FE 3KGPA 5LPFA 1VCQA 2BD2A 2XBYA 1K2I1 2KCPA 1DM4B 3MO3A 4WMDA 4A7IB 1C5ZB 3RXRA 2GKRI 1DWBH 1GMHG 3LGIA 4NFEA 4WJG2 5C67A 1TX6A 2G81E 2KAIB 1L1JA 1FJSA 3PO1C 1TYNA 3ZYDA 1ZR0A 5HMAA 5CE1A 2A7JA 2UUFB 1DS2E 3TIUA 2SGQI 4D9RA 1DX5M 4JYVH 2BQ6B 3TK5A 1CA0C 4E7RG 2Y6TA 1Y1CA 2QXIA 1L1GA 2ENNA 1GCTB 1LR9A 1X74A 1ZMLA 2F9OA 3CS7A 1KXDA 4SGAE 1ETTH 1GI8B 1UVSH 3I29A 1Y59T 1G9IE 1O2XA 1XVMA 2F9VA 1GHZA 4WWYA 5FUWA 2K0QA 4DG4A 3R5DA 3FANA 5GCHF 2YMSD 3TGKE 2J92A 2KMOA 1JRSA 3UFAA 1M9UA 1VGCC 1C5WB 4WY3A 1LKAA 4UFGH 2QXHA 2RDEA 2JP0A 1MCTA 2VWMA 1P10A 3JZ2B 8KME2 3UGLA 1JRTA 3LPRA 4GAWA 1W8BH 3F2FA 1ELDE 2P8OB 4KKDA 2BY6X 3KN2A 4X0WU 1WGTA 2VRWB 1FAQA 4UD9H 2NU3I 1AY6H 4JZEH 3BTGE 4Q7ZA 1YKTA 4ISOA 2ERWA 1BDAA 1FIWA 3P95A 1ZMNA 4KTUA 1D4PB 2FPZA 1HAZB 2FDAA 2O8LA 1UK4A 2WUCA 3OY5U 3ODFA 3TJOA 1C5YB 2GX4A 2R2WU 1AWHB 1KYNA 3MU0A 4YM9A 1FXYA 4KTSA 4U30A 5JFBA 2GKTI 1KXCA 1W14U 2V0BA 1GVLA 1GI4A 1HDLA 2HPQH 3SI3H 3ZZAA 4I7YH 3PDNA 2ANKH 2ODQA 4IS5A 1ZPBA 3BEIB 1P2NA 2HGTH 3TGJE 2WUBA 3GCTF 4D9QA 4F49A 3VG8A 1AKSA 1SGIB 1L1NA 1TBOA 5EQSA 2GCHF 3U69H 1FONA 1C1NA 4BAQB 1WTJA 1ELFA 3F3BA 1YGCH 3OSYA 4DIIH 2FODA 1B7XB 1Z7KB 3D49H 1BT7A 2ENZA 2OC0A 3F1SB 1SI5H 1T4VH 4WH8A 1T8NA 2ZDAH 3UPEA 2JIZD 2IPHA 1XM1A 1SPJA 1CT2I 5A8ZA 3GY4A 4YOJA 5CMXH 2TGTA 2ZC9H 1DICA 2GMTB 5DP5A 2K8IA 2ZF0H 1PQAA 1C5XB 1C1RA 3F6UH 1V2PT 1NFWA 1WUNH 2PKSC 4H42U 1QBNA 3STJA 2FOFA 3VB7A 3QGNB 2P94A 3ESTA 2YNBA 4D7GA 3OAAD 1R79A 4K8BA 2QPOA 2BOKA 1C2DA 1V2NT 5GWZA 3QTOH 4NWLA 3SU0A 1TBRH 1E0FD 3IWMA 2ZCHP 2ZGXH 5F8TA 1J9CH 2BM2A 3UOEA 1MTNC 1S6LA 4CRFA 2NU0E 2P6AC 1W3CA 1SHYA 2FS8A 2GP9B 3M7QA 1BTUA 1P01A 1P3CA 1LHEH 3RXEA 3EE7A 4THNH 3VB4A 4ASHA 1ANCA 2Y5FA 2HRVA 1ZLRA 1Z8RA 1TGNA 2FESH 2VBCA 1CA0B 5CHAC 2V53A 4NWKA 2VB0A 3Q00A 4HZHA 1TUSA 4OS2A 5B6LA 4AG1A 1XX9A 1YLCA 1Q31A 2GCTB 4NIXA 4Y0ZE 1BUSA 3OTPA 2LP6A 3GY8A 1LR7A 3AVZA 1CVWH 1CT0I 3RXOA 1W0JD 2ZQ2A 4CHAC 1UVPA 3OXLA 5I46H 3SGQE 2GD4B 3LIWA 1VGCB 3KIDU 2H5CA 3OU0A 1C4Y2 5EPYA 3SV8A 2BD8A 1OS8A 2ZTYA 1TGSZ 2P3FH 3PRDA 4GVUA 5EXMA 3U98H 2ZDLA 1A5IA 1HAIH 2SGPE 2ODYB 3UOUA 1SGEI 1FI8A 1QHRB 2OY3A 3HPTB 3LGYA 4O03A 4E05H 1YCPK 1EZXC 1V2TT 1N6YA 1SGPE 1P2QA 5C1UA 3PV4A 1SGDI 3E59A 4Q2KA 1S83A 2OD1A 3E0NB 4XBCA 1SGYE 3SZEA 1BA8B 1HYLA 1SC8U 3GS9A 3MNXA 2NU1E 1TNHA 1A5GH 1O2JA 4ABEA 2WPDD 5DSFA 2ZFPH 1UVUH 2CF9H 3RU4D 1N13A 2LEOA 2ZCKP 1OP8A 3WWBA 1IQEA 2ZU3A 1HJ8A 1TURA 2K9HA 5E3RA 2ULLA
chains in the Genus database with same CATH topology
1EKBB 5A09A 1LVYA 1UTOA 1CO7E 3BV9B 2ZHQH 4ZKSU 2A5IA 2JETB 2ZTZA 4UXJA 2R0KA 1MT1A 1GMHF 4FUHA 5E0JA 4IBLH 1ARCA 1M8CA 1O30A 2V6NA 2ZPSA 4O9VA 4WVPE 1S0RA 1THSH 1HAYB 2AYWA 1RFNA 3M3TA 3VEQB 3B8JA 3DHKH 2ORWA 1EXFA 4BAHB 1OYVI 1EB2A 1E35B 1EZUC 1GJDB 1ANEA 4GHQA 1PPFI 4K2YA 4JK6A 1RRKA 1RIWC 2PFEA 1O2IA 1DOJA 1S82A 2B0UC 1FUJA 2J2UA 3U8OH 3M3VA 1TAWA 1SMFE 1GJ9B 5JBBS 1TPAE 3ATLA 3ZZBA 1XUJA 4Y71A 2AGIX 2XTTB 1YPEH 1EAIA 2TGAA 1C9TA 1BIOA 3LKWA 2QAAA 2QA9E 2ZEBA 2SGEI 4FU7A 3UWJH 2ARPF 2FYRA 3SO3A 1WAYB 4K60A 5IYTA 4I8HA 5EPNA 3U8RH 2M5TA 2YQPA 1AFQB 3HGNA 1C1VH 2G52A 1NRSH 1SR5C 3GYMA 1EP5A 1U6QA 1AU8A 3KCGH 5FPSA 1UJ1A 3BEFB 3QTLD 1X7AC 1CHOF 5CHAB 2M5XA 3B4VC 1WV7H 2CJIA 1MQ6A 1MKWH 1K1LA 3RDZA 1ZOMA 3SNDA 1XUGA 2DUCA 5FX6A 3SU2A 4YO9A 1O3AA 7GCHG 4CHAB 1A0HB 3S7HB 2ASUB 3SU1A 1UTLM 5CCMA 2JA1A 2F9UA 4B74A 1K1OA 3MH5A 5B6OA 1EB1H 3IITA 1RTKA 3QGJA 1HAOH 1A2CH 2ZFSA 4I8GA 2WYGA 1BQYA 1ZPZA 2PTNA 1O36A 1QL7A 2Y5GA 4YESB 1C2IA 3TNTA 1IQKA 4A1XA 1HAGE 1ABJH 2J4IA 2VIWA 1C5MD 1SOZA 4AZ2B 2IN2A 2ANYA 1QURH 1O5AB 1V2KT 2FI3E 4IC6A 5FUVA 8ESTE 3AW1A 4ZXXH 1GBKA 3RP2A 3ELAH 1BTZA 1EAXA 5HGGA 1MTSA 4KP0A 3S9BA 5JHWC 1OWDA 1TX8A 3QK1A 1CGJI 2EA3A 1ZRBA 1FQ3A 2OC7A 2O8UA 1P2JA 3FFGA 2YOLA 5GCHG 4X6PA 1DUEA 3ZZ4A 2Y81A 1ESTA 2WPIS 3O8RA 1A0JA 4D76A 2ZHDA 2ZHEH 5FX5A 2Z9IA 2BTCE 1MU8B 1D3DB 2HNTC 3A7ZA 1MD7A 1C1MA 1TWXB 3NPSA 1CT4E 3A8BA 1TMTH 3PWBA 1RIWB 3A88A 1ZJKA 1KXBA 5C3NA 2FO9A 1LVMA 1BB0B 2ZKSA 4LZ4B 3TH3H 2BX4A 3A89A 2BQWB 2BDGA 1F0RA 2OCVB 2ZU1A 3MFJA 3A8AA 4UFEH 2A5KA 5E8EH 1D6WA 1O2QA 1OX1A 1UCYE 3RXIA 4AOQA 1P04A 1SL3A 4NSYA 3ZZ7A 3D65E 1NU9A 3DA9B 3UNSA 3LJJA 3RMMH 1R0RI 5T6FA 3ZVCA 1H8IH 5FUYA 1EJNA 4Y8XA 3SBKA 1S0QA 3VFEA 3OX7U 1O37A 4ZKRU 4CBNA 1TQ7B 4Y7AA 1W4RA 1DPOA 3PB1E 1PPGE 1C5TA 4PROA 4JZFH 1GI1A 1IAUA 2E73A 1G36A 1PPCE 2GT8A 1P2IA 1T8LA 2Z3CA 3SEKC 1PJUA 1JWTA 1O3PB 1P09A 3GYLB 2ELIA 2Y82A 4Y10E 6CHAC 1N8OC 1TE0A 4RN6A 1O31A 3V0XA 1GBCA 2B7DH 3E0PB 5JPMH 4X2VA 1AB9C 2BUSA 4DGJA 2DE8A 1GHAG 1WOFA 4SGBE 1QQ4A 4X1SU 1KLTA 3T28A 1KDQA 1WYKA 2VJ1A 5AFZH 5DP7A 1NTPA 1OYTH 4YTAA 1A4WH 4DT7B 1HCGA 3UOPA 1YBWA 1ESAA 4X1QU 2XC5A 4X2WA 5JBTA 4FUFA 1GBBA 1MKWK 1O5FH 1Y3XA 4JK5A 2HPPH 1QJ7B 1C1QA 4TWWA 1NT1A 1K1PA 3V13A 3QZRA 1IQJA 1FARA 1GBAA 2A2QH 3RXAA 4OS4A 1DANH 3TJNA 1BBRK 3P6ZB 3RMOH 2FNFX 3FP6E 1E34B 2A7CA 1OSSA 3TJQA 4O3UA 1THPB 3ATIA 1OXGA 4AGJA 2WPHS 3MI4A 3M35A 2H9TH 3RXPA 3SJ9A 4E1PA 3MH7A 1O5GH 3MWIU 2J9RA 1AZZA 2HVXA 3LGVA 2W26A 3S7KB 1OMTA 1W13U 4LZ1H 1QJ1B 1ZJDA 2FXRA 4I8LA 1PPBH 2OD3B 2H9EH 2OTTX 1GI3A 2FLBH 1GMCG 1Z8GA 1FYBA 4FVDA 1A1RA 1RD3B 2CN0H 1H9LB 2C8ZB 1X4SA 3RXDA 5FPTA 1XBTA 1O39A 2SNWA 1FMGA 1O2KA 2WPMS 2XC0A 5G4BA 4TWYA 2F3CI 1GHYH 3SJKA 1KTSB 1QFKH 1NM6A 1OP0A 4HI3A 1CBWC 2ZP0H 2NU2E 4ZKNU 1ESBA 5C1XA 1MUEB 5A0BA 1TA2A 1CSOI 2BZAA 4NGAH 1MBQA 2PW8H 1ZSJA 5I25A 3VB6A 1GDQA 1NROH 1PQ5A 2GV7A 1QY6A 7GCHF 2BLWA 1YPHC 2OQ5A 2TBSA 3Q3KA 3I78A 4NZLA 3TU7H 1K22H 2ESTE 1CGHA 2YNAA 4BXSA 4FUIA 3SW2B 1HBTH 4B2AA 1VR1H 1C2KA 2GZ8A 4FXGH 1O3JA 1E36B 3U1IB 2C8YB 1SFQB 1DLEA 5LH8A 2ZIQH 4BAOB 3MH4A 1LR8A 2EC9H 1HGTH 1Q3XA 3NZIA 3VB5A 2AS9A 2BY5X 2KMQA 4IC5A 2CV3A 3BTWE 5ETXA 1EJMA 3ZZ3A 6CHAB 1N8OB 2J95A 3SV2H 3AW0A 1MQ5A 2PKAA 1CE5A 3P8GA 2W3KA 1CHOI 2RG3A 1AB9B 3L3TA 3TNSA 2FTLE 2QCYA 1YCPH 3MU5A 4YT7H 4OS1A 2SNVA 4IN1A 2GCTC 1P2MA 1YP9A 1DE7H 1PPEE 4J2YB 2V1CA 4YT6H 1TIHA 4DOQA 1LKBA 1EJAA 5GJ4B 4XFQA 4O97A 4Y8YA 1HNEE 1C2MA 1P2KA 1OWJA 2SGFE 2KMPA 1NESE 1IOEA 2PLXA 2OUAA 1LVBA 1EASA 1UTNA 3MOCA 1ELAA 1Y3UA 3ZYEA 1TRYA 3TGIE 2GDEH 4B71A 2XWAA 4DCDA 5IDKA 3O8BA 1CHOG 3URDA 1VCWA 1GMDG 5DO4H 5LPRA 4AORA 2VINA 2NU4I 1O3IA 3UIRA 4XE4A 4ABGA 3F68H 3T62A 1HIAA 1ZZZA 4TY6A 2QQCA 1GJAB 5JB8S 1TIOA 2UUJB 1DXPA 1O3NA 2TGPZ 1Y5BT 4CRAA 2CHAC 1OMUA 1LO6A 1EUFA 3A85A 2J34A 3BG4C 3LDXH 3SU5A 5AFYH 4ZH8A 3SU4A 1UTPA 4DW2U 4BNRA 2JETC 3URCA 2ZZUH 4ABDA 5F6MA 1PTQA 3ZZ6A 1O2NA 1CBWB 3LOXA 5C20A 1NFXA 1L4ZA 5DP4A 1K9OE 1YM0A 4WXIA 4YLQH 1VJAU 4UDWH 1V6DA 4BTUB 1GHAF 2BHGA 4B1TA 1QB6A 3H5CB 1Y1BA 1BHXF 1TNIA 5EQRA 2FM2A 4L9MA 2I6SA 2QQ0A 3BTME 1NO9H 2SGQE 1YPGH 2VVCA 2FIRH 2FEQH 2J38A 4NZQA 1SBWA 1A46H 3BIVH 4MLFB 5GPIB 5C1YA 4FVBA 3A82A 3TPIZ 1GBIA 1G32B 2AIQA 4YOIA 4NIVA 3U1JB 2F83A 3WY8A 5DAEA 4JCNA 1FPCH 3E90B 3VDPA 4AYYB 4ISNA 1H8DH 4IMZA 2BLVA 4B76A 1OKXA 2QC2A 1AFQC 3GDVA 3SQHE 2XNIA 4AFQA 1O32A 2BLOA 1EZQA 5ABWA 1QCPA 2GZ7A 3E91A 5E2OA 1BJUA 2JH5D 3Q77A 1NRRH 3ODDA 3BTHE 2A1DB 9LPRA 3VXFH 2A32A 2NU3E 4ZXYH 2EI7A 1ELCA 2AMDA 1V2LT 1HB0B 1NRPH 4WMFA 3GICB 3FP8E 1WU1A 1BBRE 3EQ0H 4X8SH 2Y7XA 1RJXB 1ANBA 1FDPA 1GI2A 1NZQH 2SGDI 1P57B 1GBTA 4ABJA 1GMCF 2BDHA 1SGFG 1CQQA 1UUCA 4INLA 1MZAA 1CGII 1EX3A 1O2LA 1DITH 2R0LA 3KF2A 1NRNH 4X8UH 1AN1I 1SGRI 2J9NA 1N6XA 3GCOA 1BHXB 2YUUA 2IJOB 1FAXA 1WTGH 1ZMJA 2HALA 7KMEH 2PGBB 1FPHH 3DFLA 2B9LA 1S85A 4B6DA 1PYTC 3M5OA 5SGAE 2THFB 2FMJA 3KNXA 5TJXA 3UR9A 1O3MA 3P8NA 3SGBI 4MNWA 4Z0KA 2ZECA 5E0GA 5FHTA 4ESTE 1MKXK 4I32A 3HATH 1C1TA 3T29A 3H7OA 3Q3XA 5DG6A 1SFIA 3HKIB 1GJ7B 5J4QA 3ZZDA 3NXPA 1TGCA 1O3FA 3B23B 1BMMH 2AMPA 1UVOA 2Z3DA 4JZIA 3SU3A 1DXWA 3M37A 2BYAX 1VITF 1CT2E 3RC6A 1RGQA 2R2MB 1JIMA 2EEKA 2OTVA 4Y7BA 2FOHA 1C9PA 2CHAB 4K8YA 1GJC<