2XRCA

Human complement factor i
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
548
structure length
461
Chain Sequence
EDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAMDAERRRIKSLLPKLSCGVDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGQWGEVKLISNCSKFYGNRFYEKEMECAGTYSGGPLVCMDANNVTYVWGVVSWPEFPGVYTKVANYFDWISYHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN COMPLEMENT FACTOR I
publication title Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
pubmed doi rcsb
molecule tags Immune system
total genus 92
structure length 461
sequence length 548
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.45: Complement factor I.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00089 Trypsin Trypsin
A PF00530 SRCR Scavenger receptor cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xrcA04
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 2xrcA03
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2xrcA02
5DP4A 3LJJA 3Q3YA 2W7SA 2ZQ2A 2AH4X 1ZOMA 1NU9A 1V2JT 2G4UA 4LK4A 1AU8A 5DJ7A 4AG1A 1S83A 5EXLA 1KYNA 1PPFI 1A61H 1HRTH 1UTQA 3Q76A 2Y5HA 3FP7E 3HK3B 4NIXA 1WV7H 2O8WA 4BXWA 1NRRH 2O8LA 1UCYK 1MTVA 1WU1A 3ZZ7A 2BDCA 4WH6A 1ZZZA 3QN7A 2ALVA 4AX9H 4AYYB 2BMGB 2V6NA 3SOSA 3LJOA 5TCAA 1TB6H 1DICA 1HFDA 5CE1A 2J4IA 1V2LT 3SEKC 4K8YA 1GVZA 7ESTE 1NROH 5JHWC 2WYJA 1P04A 2FO9A 1GMHG 3R0FA 3N7OA 3ZYEA 5HYOA 2Z7FE 2O8MA 1ELEE 1K1IA 1C5UA 4B73A 1ZTLA 3DD2H 2SGQE 2ZECA 1SQAA 3M61U 3ODDA 2M5TA 1T8NA 3DFJA 3RXFA 1QL8A 1WYKA 2VIDA 4R0IA 1OYQA 4Y8ZA 1SGRE 2FOCA 4IMZA 1ORFA 5FCRA 5T3HA 3B9FH 1GBAA 1F5KU 4UFFH 1MTWA 1SGYI 3EA9A 4D8NA 1TMBH 3LKWA 3MNBA 1UTNA 5J4QA 1O2MA 4JZ1A 2AGGX 3K6ZA 5C2ZA 1GJDB 3EQ0H 1O34A 1RJXB 1HV7A 1ZMJA 1ELAA 2Y81A 8LPRA 1TBRR 3UOPA 5HXFA 4KTSA 4XFQA 4K1SA 1SHHB 3BN9A 1LR8A 1SGFA 3A89A 4CREA 1TNIA 3QTOH 3BEFB 1YKTA 1YPHE 4CRFA 2P3TB 2QF3A 3K65B 1UK3A 2ZU3A 1O3CA 2GV7A 1DS2I 3BTGE 1GWAA 2OC7A 4HFPB 3SJ9A 1TX6A 1AMHA 5FBIA 3MOCA 1OWKA 3A87A 3TJVA 1E35B 1ZSKA 3QWCH 4FUEA 2ZFRH 4JMYA 1O0DH 4X6OA 1VZQH 2BZ6H 1UHBB 1CA0C 1CHOG 2ZGXH 4HZHA 1KTTB 2V53A 2P93A 4KGAA 1PQ5A 3PLPA 1AWHB 4GPGA 2BX3A 3WY8A 2CF8H 3F6UH 2D2DA 1UMAH 1HUTH 3S0NA 4ZUHA 4TYDA 3RC5A 3QTLD 3KHVA 2QYIA 3SO3A 2J94A 2UUJB 4AOQA 1XKAC 5DGJA 3NK8A 1N6YA 1P03A 1TRMA 1AQ7A 2A5AA 1GI9B 2F3CE 3P92A 3UIRA 3D65E 2PKAA 1U6QA 5GCHG 3C1KA 4DVAU 1XVMA 1L0ZA 4I8LA 1GMHF 1HJ9A 4BAQB 3PM3A 2GD4B 1DS3I 1IHTH 9ESTA 5HM9A 2BLVA 2TGDA 1OWHA 1XUGA 1UUCA 1W0ZU 2ZDNA 1C2HA 1C1QA 2WINI 1QURH 4X1NU 1SGQE 2H6MA 5FCKA 4NIYA 3RU4T 1CT4I 1AN1I 3UQVA 2P8OB 1Z1JA 2HNTF 3UNQA 1V2TT 3SV6A 1CO7E 1ZRKA 1HDTH 1AI8H 1O2UA 2VGCB 1D4PB 5EPYA 2A7CA 1OSSA 4B2CA 3KQEA 1YGCH 3SV9A 2G55A 1G37A 2BDYA 3ZVFA 2UWLA 3E0NB 1O2NA 2M5XA 3DUXH 1V2UT 3E1XB 2Y6TA 1L1JA 1TX8A 2A4OA 1OKXA 3F68H 1IQIA 1YCPH 1G9IE 2BDIA 2ZFTA 2TGAA 1TOMH 4ZH8A 2R2WU 1C1NA 1PPGE 5GWZA 5DO4H 1GI5A 3M7TA 1SR5C 3QX5H 1O39A 1KMAA 1K1LA 3BG4B 1A0LA 2XYAA 1MCTA 2ILNA 2P8OC 4ZKSU 1VGCC 1GBFA 2FI4E 1E34B 1UTKA 2VGCC 1CHOF 2BQ6B 3U1JB 1P01A 4UFDH 2BX4A 3PWBA 1WSSH 3URCA 1P9UA 4NA8A 1AVXA 1RRKA 1WOFA 4A1XA 5F8XA 1IQNA 1A1RA 3GY6A 2FOEA 1O3AA 1P2JA 2J92A 2D8WA 4B74A 2OXSA 3RM0H 1N6XA 2ZU2A 3VB4A 4X8SH 2WPJS 2ODPA 3RMOH 1C4Y2 1FN8A 6GCHG 3QGNB 1QBNA 3A7ZA 2GP9B 1TIHA 2NU4E 3HK6B 1HCGA 1SVPA 2W3KA 2XC4A 1XUJA 1ZPBA 2P6AC 1MZDA 2SGFE 5GCHF 3M3VA 3PLBA 5K0HA 1TPAE 1TPSA 3BG4C 2GZ7A 1B0EA 2CJIA 3VGCB 4Y7AA 4CR5A 1MKXK 1DDJA 4D7GA 5LPFA 1E37B 2GZ8A 3SJ8A 1GHWH 2G5VA 5AVDA 2AYWA 1BTPA 8GCHG 1BCUH 1D9IA 4BAKB 4NFFA 2C8WB 2ZGBH 1WQSA 3LIWA 2VWLA 1R0RI 3P8OA 2VIOA 1AIXH 2A2XH 2BHGA 4ABBA 1QJ6B 1B5GH 1ZSLA 5F03A 1OS8A 1O2PA 4I8JA 2A4GA 2EI8A 4TPIZ 3P8FA 1EQ9A 2OUAA 3DT0H 3L33A 3MH7A 4DGJA 1C5QA 3EA8A 3VXEH 5A09A 2ZU5A 3GYLB 1UTMA 1SFIA 1P09A 1HLTH 4IGDA 1C1VH 2ZHQH 3SJIA 4DCDA 2Z9GA 4K60A 4X1PU 1GBKA 1TURA 2JH0D 4LZ1H 1NO9H 1C1SA 3ATLA 2Z6BD 1SG8B 1Y5UT 1V2PT 3RXUA 4FUCA 1J16A 3LGYA 1W0YH 6LPRA 2ZPRA 5EXNA 1EB2A 1G2MA 4B1TA 1NM6A 3JZ2B 3KF2A 4TWYA 2FESH 2CXVA 2OC1A 1O5EL 4ISOA 1B7XB 2QV1A 4GAWA 3MU4A 5DKMA 2F91A 2TGTA 1OXGA 1P2QA 3M36A 3MYWA 2KMQA 5H4IB 4Y10E 1AB9C 4KP0A 3V13A 3TGIE 5A0BA 1F7ZA 1ABIH 2SGQI 1UHBA 1LKBA 1OVOA 5C1YA 2ANWA 4ZROA 3NZIA 4AYVB 4D9QA 4DJZB 3M3TA 2C93B 4F4OC 1SGRI 1V2WT 2BOHB 5GIBA 1QR3E 1L4DA 3KQDA 1CU1A 4BAMB 6GCHF 3SGAE 1IQJA 2C4FH 5L2ZH 2GT7A 2TIOA 3SZNA 1UTOA 2FPZA 1L2EA 2GV6A 1O2TA 4K69A 3V3MA 1AWFH 4MNXA 2FS8A 1O2SA 1QTFA 5EW2H 1GG6B 4XBDA 1C2KA 3U98H 3LGIA 2XNIA 1O3NA 1E36B 2Y7ZA 1BUIA 1K2I1 2B0FA 1YYY1 2ZHWH 1FXYA 8GCHF 1BTZA 2HNTC 1C2DA 2ODYB 3BV9B 1C5MD 5DP7A 1SFQB 3RXVA 1HJAB 5HMAA 3TVJB 1NFUA 1KXBA 5PTPA 3ZZBA 3E0PB 3QLPH 1LO6A 1O3KA 5I25A 2BY7X 3GDVA 1O3PB 1SQTA 2PLXA 3W95A 4ZHLU 4UD9H 3TITA 2FWWA 1GBMA 4H6SB 4OS6A 3RXRA 4A6LA 2ZCKP 2VWNA 2PGBB 2ZDAH 3B4VC 1Z7KA 1PQ7A 3O8RA 1GJ9B 5L6NH 1VR1H 4WVPE 1LHGH 3BTFE 2QA9E 3EE0B 2CHAC 1E38B 1GBHA 3SI3H 1CGJE 2QXGA 1DM4B 1GG6C 1GCTC 3VB7A 1OP0A 1QL7A 1OWIA 1SLUB 4QT8C 1GGDB 3D49H 1FY5A 3UUZA 3HH2C 1XXFA 4YO9A 2OYAA 4Q7XA 5DG6A 2JETC 5EXMA 2AMQA 1DY8A 3PMJA 2A7HA 1O2IA 1NT1A 2PKSB 5IYTA 1P10A 2VB0A 1AD8H 4DIIH 3TH2H 1LQEA 4MPVA 1K21H 3BTME 3LGTA 2EI6A 4ASHA 1O5FL 1IQHA 1SGQI 1C5RA 4BTTB 4KTUA 3PB1E 1MBMA 1T8MA 5AF9H 1BY2A 4INHA 2F9UA 3MTYA 5DPAA 4ABFA 2ZFPH 1P57B 1ZYOA 2ZCLP 5DK1A 3STJA 1EUFA 3RC6A 2KAIB 3SBKA 1XM1A 3SU4A 5JBCS 3OSYA 3G01A 2R0KA 4FVBA 1YBWA 1GGDC 1BDAA 2FTMA 1DY9A 1UVUH 1LVBA 3MNSA 5AFYH 4FXGH 1F0SA 5FPSA 5HM2A 2CGAA 2OVOA 3M5MA 2EEKA 1BMMH 3UNSA 1G32B 1F0RA 1PQAA 3QZQA 1S84A 1EZSC 2SGPE 2ZI2H 1GVLA 2PKSC 2CF9H 3V12A 4INKA 1VJ9U 1V6DA 2GVFA 1UTPA 4DG4A 5LPEA 3A85A 5A0AE 2H9HA 1PPEE 2JKHA 1PJUA 4TY7A 4IC6A 2I6QA 4UFEH 1IQMA 3RU4D 1YCPM 3BTQE 3SQEE 1GHBF 3RXKA 3RLYH 3T2NA 1TGTA 5EQSA 1ELDE 3A7TA 2TGPZ 1BA8B 2A5IA 2PSYA 4YLUA 4MNVA 4TWWA 1S0QA 1NRNH 5ESBA 4ABJA 3SV2H 3RXIA 1WQVH 1LPKB 2LPRA 1A5GH 3LGUA 4ABHA 1LHCH 1O2QA 2ZZUH 4SGBI 1S6FA 3ENSB 5GXPA 1WUNH 1WBGB 2VNTA 3NXPA 1NFWA 8KME2 4TPYA 2ANMH 5FPTA 1GJ5H 5JYIA 3P17H 1BRUP 2A4QA 2R0LA 3GDSA 4ZXYH 5AFZH 1O3LA 1TQ7B 2Z94A 1DSTA 4WJG2 2HPPH 1IAUA 2DUCA 2F9PA 1V2VT 2NU4I 4A92A 1O2XA 1SHYA 1ZPCA 2ZO3H 1NUBA 4PROA 1DWEH 1O2LA 1AFEH 1MQ5A 2SGFI 1TNLA 1YLCA 2JOPA 1ZGVA 2H9TH 3Q77A 3F9GA 1SBWA 3RXJA 5F8TA 1TE0A 1HXFH 3SJKA 4GCHG 1ANDA 1A3BH 3A7VA 1K1JA 4JK5A 2GCHG 1HAHH 4JZIA 1C5WB 2STBE 1HXEH 1V2ST 5E0HA 3AASA 3FP6E 3PMAB 2FOBA 3VXFH 1TPOA 1TAWA 3RM2H 2BLOA 3L3TA 1QRWA 2WPIS 1O3GA 3PMBB 1P05A 2GT8A 3U9AH 1EAUA 2WCYA 2HOBA 2YNBA 1Y3YA 1C5TA 5IDKA 2FI3E 2Z9LA 2WV5A 2GX4A 2BM2A 2SGEE 1XUFA 3TJNA 4Z6AH 3H7OA 1PCEA 3LH1A 1JRSA 4X1SU 2OY3A 3GCHB 3FFGA 4UDWH 2WUCA 3A82A 1QGFA 3GY5A 5EU8A 1H9LB 4DY7B 3JZ1B 3SU1A 2V3HH 2Q6DA 2OQUA 4UE7H 3NCLA 3L6PA 3GICB 1EP6A 3R3GB 2BXTH 3P8NA 1VJAU 4OS2A 2SGDE 1Y3WA 4YOGA 2WUBA 3MNCA 1MAYA 3ATIA 1VITH 1J8AA 1MMJN 3SU2A 3SNEA 1O2WA 4ABDA 2AEIH 3RXEA 1FZZA 1P8VC 4BTUB 3BIUH 1YCPK 1BT7A 4OS1A 1CA0B 4M7GA 2RCEA 1GI6A 4X8TH 2QF0A 5EODA 1SMFE 2ERWA 5E0JA 4AN7A 5E2PA 5JB9S 1V2RT 1G2LA 1MKWH 1DITH 3GCHC 2ODQA 3GISB 1UJ1A 1S81A 3TJUA 5JB8S 1A7SA 4E7NA 4LZ4B 2AIPA 2Y82A 1XX9A 1V3XA 3MU1A 1JOUB 1HAVB 3A88A 1OP8A 2BVSH 1DPOA 5T6DA 1J15A 4O3TA 5FBEA 1HAGE 2CMYA 1UVPA 4RSPA 1KSNA 2NU3E 3DHKH 3GY4A 3U69H 3TGJE 1IQGA 4I31A 2KMPA 1Z71A 4Y0YE 3TH3H 3MU0A 4YTAA 1T32A 1Z6JH 4CBOA 2JP0A 2QAAA 3SUEA 5A2MH 4GCHF 1OPHB 2GCHF 1O3OA 1HIAB 2F83A 1O2YA 1BRCE 1ID5H 3RXSA 2ANKH 2GDDA 1YC0A 1DOJA 4R8TB 5A8ZA 3T28A 1HJAI 1P2NA 1TPPA 2BD4A 2QXJA 4NSVA 4IN1A 3RXHA 3A7WA 2FX6A 1TBQH 4FU9A 1W2KH 1HPGA 2BZAA 5EQQA 2PR3A 1K1PA 1MQ6A 1K1NA 4IS5A 4NZLA 4OVOA 1NFYA 2ZC9H 3A86A 4HTCH 1UK4A 4CRAA 2QN5T 1D3PB 3M5OA 1GI3A 2QCYA 1DT2A 1MZAA 1DX5M 2KAIA 2B7DH 3ZV8A 5A0CA 1GI0A 2AFQB 2SNVA 1Z8IB 2VWOA 1THPB 3O8DA 2JH6D 5EOKA 3T26A 1JRTA 2IN2A 4K3JA 3S9BA 1CGJI 1O3MA 3VEQB 1C1WH 1FIWA 1SQOA 1ZMNA 1C5SA 2XBYA 3BF6H 1C5NH 4DW2U 3ZVDA 2PFEA 2RDLA 1A0HB 1G3CA 1O5EH 1SGFG 3H5CB 5JBAS 1PJPA 2BLWA 1SI5H 1EOLA 3RMNH 2VVUA 5FX5A 4Y0ZE 2FODA 1QCPA 5C5NA 1F92A 1C2FA 1VGCB 1ABJH 4K1TA 3RXMA 1H8IH 2HPQH 1GMCG 3HATH 3Q3KA 1D6WA 1S85A 2C3SA 3GCOA 1EPTC 1WTHD 1TWXB 3VPKA 1F5RA 2FM2A 4YZUA 2BD2A 3KN2A 1P11E 2Q6GA 2WPKS 1F5LA 3UR9A 4WMEA 2R3UA 1BUSA 3EYDA 1TGSZ 2Q1JA 2IPHA 5TJXA 1SSXA 1C4U2 1O5GH 2Z9IA 2AS9A 2HVXA 1C9PA 4OS4A 1LHFH 3UNRA 3GCTG 2ZDMA 1ZLRA 3LONA 3ZVCA 1FY8E 1FUJA 3SU5A 3GY3A 2OCVB 1DWCH 4ZXXH 1EZXC 3LH3A 9LPRA 1NTPA 4X6PA 2SGPI 5L2YH 3RXOA 1C1OA 4FUHA 5LH8A 4KKDA 3S9CA 2WPHS 4YOJA 1PYTD 4FU7A 1HJ8A 1M9UA 2P95A 3MU5A 4VGCB 5A8YA 1FAXA 3BG8A 1ANEA 4OS7A 3MMGA 4XOJA 2ZHDA 4SGBE 4A1TA 2O9QA 1AHTH 2BTCE 1VCPA 5C3NA 1ARCA 1YPLH 3T27A 2BVXH 1Z1IA 2WPLS 1YPEH 1C5XB 4ZAEA 1SLVB 2NU2E 1QL9A 1AZ8A 1RGQA 1O5CB 5GDSH 3MU8A 3NUMA 4I33A 3AW0A 1HB0B 3ZZ9A 3W94A 2GCTB 3ZZ4A 3KNXA 1SOZA 1EXFA 2G5NA 1AKSB 2FOAA 5EPNA 3FVFB 1J9CH 1JIRA 1P0SH 4A1VA 1BTWA 4I8HA 3GDUA 2Z9JA 1YTPA 2A32A 2TPIZ 2ZFFH 2SFAA 4X2VA 2BDAA 1KXCA 2AMDA 3PTNA 4BOHA 1MTUA 2ZIQH 3KL6A 2G51A 4VGCC 1N8OC 1FN6A 3ZZAA 4XE4A 3A8DA 2V35A 3TK5A 3ZZ8A 2R2MB 1DXPA 3E6PH 1D6RA 2DE9A 1AB9B 1O5FH 4YT7H 1GMCF 3DFLA 1ANBA 1P3EA 1AE5A 2ZTXA 3PV4A 5B6OA 1C2GA 1CGHA 4TY6A 3GCNA 3VB3A 4O9VA 2GCTC 3EDXB 1C5OH 4Y8XA 4RKOB 1SGNE 5SGAE 1FI8A 1GHVH 3SNDA 2FYRA 3BTKE 3SUFA 2VIQA 1EX3A 2SGEI 4O03A 1YLDA 1HAVA 1GJBB 4AZ2B 3MH4A 3KGPA 2WV4A 4X8UH 4Y7BA 1AFQC 4BXSA 2XCFA 2QXIA 4X8VH 3V7TA 2VVCA 1ZTJA 4UONA 4B2AA 4ISLA 4D9RA 4THNH 1DFPA 4BTIB 2R3YA 3H7TA 1TIOA 1W12U 1FMGA 5ETXA 3ZVBA 2RA0A 1SGDE 2HNTE 3SUGA 3RDZA 1Y1CA 2YOLA 1BMOA 1BRBE 5LGOA 4YM9A 3BTHE 1Z8GA 1TGBA 3PYHA 1ELVA 4AFZA 1HIAA 2OD3B 3T25A 4RN6A 4LOYH 1YPJH 3LPRA 4DT7B 2SGDI 3Q00A 1P9SA 2FMJA 2XW9A 1QJ1B 1ZHMA 2Z3EA 1AUTC 2ALPA 2Y5GA 1M8BA 5DP9A 4MTBA 3AAUA 2RA3A 4AFSA 1G36A 1GHZA 2IOTA 3GY8A 1TMTH 1W11U 1O37A 4HGUA 1GJCB 3BEUA 2HRVA 1TX7A 1G3DA 1ETRH 1DSUA 2BLQA 2THFB 2CHAB 3SGBE 2LNCA 4ZKOU 4NZQA 1GMDG 2PWXA 1T8OA 3A7XA 1GCTB 1LPZB 2VWMA 1CE3A 1BJVA 1HAIH 1TUSA 1ELBA 1MTNC 2QIQA 1IQKA 2FTLE 6CHAB 2NU3I 4FUDA 3QTVH 2OBQA 2PSXA 5HGGA 4CR9A 5FHTA 1ESBA 1GVKB 1TOCB 1LHEH 2P94A 2QC2A 3I29A 3LC3A 3PTBA 1XXDA 2KMOA 2G4TA 4U32A 1GJ7B 3TK9A 1EJMA 2JETB 3EA7A 1TA2A 4Q7ZA 3VB5A 1NN6A 3M5NA 2OTTX 2BDHA 1C4V2 1EOJA 1MH0A 2VINA 1JXPA 2OQ5A 2ZKSA 1QB9A 1THRH 7GCHG 1MU6B 3M7UA 3ZZ5A 4XBCA 1AE8H 1MD7A 4GUXA 4CRBA 2XBVA 1AGJA 3LGWA 1YPGH 2FLRH 1AY6H 1HYLA 3UPEA 2IJOB 1QJ7B 2UUYA 1N13A 4CH8B 1H0ZA 1ZRBA 3B8JA 3FP8E 4YT6H 4CRDA 4Y71A 1Y3UA 1UO6A 3ESTA 4UEHH 6CHAC 4WF8A 1NRPH 2FOMB 1SLXB 1QA0A 4FUBA 1T31A 2GMTB 3PWCA 3SU6A 1AUJA 1DXWA 1H4WA 1RXPA 2WYGA 2V3OH 2B0UC 1BITA 3ZVGA 1K28D 2Y5FA 1NFXA 1HAOH 4AB8A 1C2MA 4KTCA 1NY22 4X0WU 1DWDH 3A83A 4I7YH 2GZ9A 2ZNKH 1YM0A 1SL3A 1D3DB 3UFAA 2XCNA 1TFXA 2B5TB 2FP7B 2FOFA 3M35A 1T7CA 1FAKH 1RD3B 1ARBA 1V2OT 3SI4H 5EG4A 1NPMA 4Y11E 1SOTA 1C1PA 1H1BA 4O3UA 3E16B 1TGNA 3SGQE 4AGJA 4B75A 2NU1E 1H9IE 1G3BA 2BY9X 3MH6A 3TLOA 2ZQ1A 2ULLA 1FDPA 8ESTE 1N1LA 5AHGH 2Y7XA 1GI4A 2UWPA 1BHXF 3KCGH 5FAHA 1JBUH 1ZMLA 2AERH 2GMTC 1KXEA 1XUIA 2O8TA 4GHTA 4FUGA 1WAYB 1P2KA 1PPHE 1GJ8B 1FONA 1GMDF 2FDAA 1A3EH 3ATWA 2XWBI 3NPSA 1TBRH 1AKSA 1YU6C 1ZGIA 4Y8YA 2P59A 1E0FD 1GHAG 2XC0A 3LT3A 1GI7B 3SW2B 1CQQA 4FUJA 2ZEBA 1OWJA 5E8EH 5JBTA 1S82A 3BEIB 1MKWK 4D7FA 1SGEE 5TCCA 1BTHH 2ZTYA 1T4VH 1LR7A 1W14U 5A8XA 1GI1A 2DE8A 3PROA 2OP9A 1O31A 2XWAA 3T29A 2N17A 1GHXH 1PPBH 4MNWA 4ZHMU 1FY4A 1GI8B 1H8DH 3UOUA 2FI5E 1L1GA 1D3TB 1KXDA 4AGKA 4F49A 3BTWE 3SJOA 2GKRI 5I46H 4NSYA 4XBBA 3F9EA 1MU8B 1OWDA 1FYBA 5JPMH 3HGPA 1K1MA 3ZZDA 2F9VA 4GI3C 1O38A 2H5DA 2ZGHA 1ZHPA 4MPWA 1XMNB 1SGCA 1LKAA 1LPGB 1NRQH 3V0XA 2NU2I 4XSKU 3DA9B 2GKVE 3LDXH 1KLIH 4JK6A 5C5OA 2W7UA 4CHAC 4JZEH 4Y79A 4B2BA 3FZDA 1GBEA 3NWUA 3AW1A 4IBLH 1JWTA 2G81E 2ZTZA 1IW4A 3GYMA 4WMDA 1SGPE 2YNAA 3M5LA 4KELA 5CHAC 4H42U 2VIVA 2BY6X 1OX1A 5ABWA 3HKIB 1SC8U 1J14A 1EATA 3KQBA 3TNTA 1ELGA 1LVMA 4Y6DA 2AMPA 4U30A 1O2ZA 1ZPZA 1PFXC 2VH6A 3ATMA 1F2SE 1C2LA 3QGJA 4H4FA 4JCNA 3ZVEA 2NWNA 1DUAA 2VIPA 3ZZCA 1LDTT 3RXDA 4MPXA 3SV7A 1SB1H 3IWMA 4H6TA 3TJOA 5K7RA 2VH0A 4E05H 5C20A 1TBZH 3URDA 1SGNI 1VCWA 3RLWH 1NS3A 1HAPH 3ATKA 4WH8A 1A4WH 3A84A 1F0UA 2J38A 2EC9H 2B8OH 3RXGA 1GHAF 1FLEE 2ZG0H 3RXPA 5L30H 4WXIA 1O3EA 1AVWA 1RFNA 1EAIA 1S6HA 1FY1A 1O2KA 2ZDVH 1B0FA 4UFGH 3VB6A 3E3TA 4E7RG 1O35A 2BD9A 2PUXB 3MO9A 3CENA 3EGKH 1UTJA 2NU0E 4X1QU 3CP7A 1LCYA 2ZFQH 1SLWB 1KXFA 3RC4A 2XBXA 1GPZA 2D26C 2BUSA 2Z3DA 2PTNA 1O2OA 1SGDI 2SNWA 4U01A 5C67A 2A31A 2BB4A 1Q31A 1BTXA 4U2WA 1ELFA 1QA7A 2D1JA 1EZUC 1C5VA 1CSOE 3SU3A 1ZJKA 1WCZA 3RXLA 1O30A 1BHXB 2ZCHP 1NC6A 1YP9A 2ZHEH 1T4UH 1ZR0A 4GHQA 3O8CA 1TYNA 1C1RA 4IC5A 1P06A 3OU0A 1C1UH 1AZZA 1QBVH 2ZA5A 1EAWA 3ZV9A 3ZZ6A 4JYTA 2H1UA 2XTTB 1W13U 1OP2A 1HAYB 4CRGA 3OTJE 1PYTC 2ZGJA 2ZGCA 4E06H 3SGBI 1Y3VA 2Z9KA 3ZZ3A 1ESTA 1TRYA 4NIVA 2G8TA 3GY2A 4O97A 3MHWU 1GBJA 2N71A 1LTOA 4ISHH 3GOVB 3STIA 4A7IB 1GJ6A 1CHOI 1BIOA 1BBRH 4WY3A 4K1EA 2B9LA 2ZP0H 3BTTE 2A45B 4JZFH 4GSOA 1HDLA 3QZRA 2C8YB 2GTBA 3SU0A 1ACBE 4ZKNU 1P12E 1P57A 1EPTB 4INLA 1BBRE 1DANH 1GDUA 1RTLA 1O2GH 4Q80A 1K1OA 1EZQA 2HALA 4JYVH 2FZZA 1V2KT 1KDQB 2HWLB 2H2ZA 4DURA 1MD8A 3C27B 5BRRE 1BTUA 4AB9A 2J34A 3AVZA 5CMXH 3QUMP 1YF4A 1HAXB 1EP5A 1YPHC 2XRCA 2BOKA 2WPMS 1QQ4A 3OVOA 2RG3A 2BD3A 1BJUA 2C8ZB 1TNJA 1W7GH 1ZTKA 3K2UA 4D76A 2CV3A 1UCYH 3SHAH 4A5TS 4AG2A 4WWYA 4YLQH 1MCVA 2F9BH 4FVDA 2H5CA 1LMWB 2FIRH 4CBNA 3S7HB 1KY9A 1QIXB 4NA7A 2KMRA 1Y3XA 3CS0A 1D3QB 2VU8E 1AO5A 1P02A 1QRXA 1UCYE 1QB1A 1BTYA 2PV9B 4AFUA 3RUOA 1O3FA 3U8TH 5EGMA 4OS5A 2ASUB 1TALA 4I32A 1PPZA 1TNHA 2ZU1A 1LHDH 2ANYA 5GJ4B 3P8GA 1TA6A 3SGQI 2NU1I 2BD5A 3FZZA 3BTEE 3P70B 5DP5A 1QBOA 2SGAA 1Z7KB 1W7XH 2A2QH 1ELCA 3I78A 2UUFB 1TRNA 2GKVA 3CS7A 3K9XB 1FY3A 1GJAB 2PUQH 3A8BA 3OY6U 3MH5A 3QO6A 1MT1A 2XBWA 1O3HA 1FV9A 2JA4A 4MPUA 1O3BA 1CT0E 3S7KB 2C90B 5J4SA 1HBTH 1TGSI 5DP6A 1DVAH 1N8OB 3RXBA 1BRAA 2Z3CA 1SGEI 1Q2WA 1CE5A 3SNCA 2JYYA 5DAEA 1QY6A 3HGNA 1GBIA 3P95A 1O3IA 1O3DA 1UVOA 2ZHFH 4BAOB 1S0RA 1ZSJA 1CGIE 4ABIA 5BPEA 2UUKB 4NGAH 1UVTH 2ZU4A 1FJSA 2J95A 2N52A 5T6FA 1OYTH 3KEEA 3BTDE 2P3UB 1TABE 5DP3A 3UREA 3MNXA 1GBDA 3MO6A 3RMLH 1GL0E 4BAHB 3P6ZB 2HLCA 1TMUH 1MAXA 3F9HA 1AFQB 4B71A 1M8CA 3ITIA 3U8RH 1CT2E 5FPYA 4MNYA 3AAVA 2QQDA 2QGRA 1KLJH 3RXQA 1EAXA 4XDEA 2ZF0H 1WTGH 1NRSH 3OY5U 2GKTI 1FPCH 1P2MA 3FAOA 4NCYA 2XC5A 4HI3A 3RXCA 3S69A 1SGPI 1Y5BT 2Q6FA 4OGXA 4I8GA 4AFQA 2EI7A 1Y59T 1FPHH 3TU7H 1CVWH 1F0TA 5GPIB 3FANA 1TBQR 2BDBA 2BXUH 3SHCH 2OBOA 3RXAA 4WXVA 1IOEA 3ELAH 3NKKA 1S5SA 1O5AB 1PPFE 1ELTA 7LPRA 1UK2A 5F6MA 1GBCA 4IW4E 1IQFA 1K9OE 2CN0H 4NG9H 1W3CA 2VIWA 1QB6A 3F9FA 1C2EA 4NFEA 1XUHA 1RS0A 1YPMH 4Y76A 2ESTE 3A81A 4X2WA 3PLKA 5E2OA 1HPTA 1IY6A 3QK1A 3OX7U 2ZPSA 3TK6A 3UWIA 3PO1B 3LU9B 4BANB 1P2IA 1QHRB 1NESE 3GCTF 1G3EA 3SNBA 1KLTA 3MWIU 4MG3A 4IMQA 4FUFA 4K8BA 4ESTE 2TRMA 5DP8A 1AVGH 1UTLM 3ZVAA 1OMTA 1OOKB 4HGCA 2AGEX 1XVOA 3RU4E 1MTNB 3VGCC 1Z8JB 2Y80A 3F1SB 5FXLA 1HGTH 3ZYDA 5EW1H 3SN8A 2BDGA 3E90B 3LC5A 2ARPF 3D62A 4GLYA 3EAJA 2R9PA 1O5DH 4ZHAA 1V2NT 1XKBC 1J17T 2BD7A 3HPTB 2NU0I 1EJNA 2JXDA 1SPJA 4FU8A 1CA8B 1K22H 1TONA 2PGQB 4MLFB 1SGYE 4K2YA 2FX4A 2OLGA 1HAZB 1DWBH 4OGYA 1C5PA 1FNIA 3U1IB 3A80A 1V2MT 2I6SA 1TNKA 1EPTA 3PO1C 1O5BB 2C8XB 1UVFA 1CSOI 3I77A 1IQEA 3RP2A 2ZDKA 1KIGH 1A5IA 6ESTA 1GBLA 1O2HA 1P3CA 2STAE 4ABAA 1KDQA 1C5ZB 5T6GA 1W10U 1Q3XA 4YESB 1LQDB 2FS9A 1Y1BA 2KCXA 1JIMA 1SGIB 3TJQA 5C1UA 1BMAA 1DS2E 3D23A 1ZJDA 1VCQA 4ABGA 2F9OA 2QY0B 1GDQA 4J2YB 3PMHB 1VITG 1UVSH 2EA3A 3SV8A 1C1TA 1PQ8A 1O3JA 3A8CA 4NWLA 2OC8A 4DOQA 1TLDA 4X6NA 1JMOH 1EKBB 2BQ7B 2W26A 2A7JA 2J2UA 2G00A 1O36A 5E0GA 2AGIX 2TBSA 4YOIA 3S9AA 4ZMAH 1NU7B 3B23B 1MBQA 1CBWB 2FYQA 1QNJA 2W5EA 2W3IA 2LEOA 4ISIH 1HNEE 4B76A 1O2RA 3IG6B 2AIQA 3MI4A 1BMLA 1V2QT 1MKXH 5JFBA 3IITA 1CHGA 3VFEA 1GHBG 1OYVI 1KXAA 2V0BA 1EJAA 4SGAE 1O2VA 2PHBA 1C5LH 2P16A 1O2JA 1QQUA 4LXBH 1GI2A 4RKJB 1BB0B 3TH4H 1ANCA 1A0JA 2G52A 4K5ZA 4Q7YA 2J9NA 2BY8X 1FIZA 3RXTA 1GJ4H 2VJ1A 3M7QA 4JZDH 1C2IA 3UQOA 1O33A 3GY7A 1DE7H 4ABEA 1C2JA 1TGCA 3O8BA 2P3FH 2PW8H 2ZDLA 4MVNA 2JZMA 5LPRA 1A5HA 3M3SA 1CBWC 1C5YB 4DIHH 2F3CI 2BVRH 1HJAC 1A46H 1CT4E 1T8LA 2XXLA 1AN1E 2ZWLH 4NWKA 1KTSB 4AORA 2A5KA 4ZKRU 2ZFSA 1G30B 5ESTE 1LR9A 2O8UA 1ESAA 2FEQH 2UWOA 1INCA 1Z6EA 5F8ZA 2HGTH 4X2YA 1ETSH 3SUDA 1O32A 1RIWB 1MTSA 2QXHA 5C1XA 1OWEA 2BD8A 2FLBH 2VVVA 2A0QB 1Y5AT 3T62A 1GBTA 1Y8TA 3ODFA 1EB1H 1IHSH 4CHAB 3U8OH 2PKAB 4X1RU 3K6YA 1VITF 3OYPA 4IN2A 4ISNA 4I8KA 3SQHE 3UY9A 1ETTH 3UWJH 4MQAA 1TNGA 3MFJA 3SNAA 3HKJB 1DLEA 2A1DB 3E8LA 1YPKH 1DUEA 5CHAB 3TNSA 2JH5D 1NZQH 1W8BH 1XUKA 2F9NA 1SGTA 1BQYA 3TPIZ 7GCHF 1CT0I 4X2XA 4Z0KA 2GGVB 3Q3XA 4JYUH 1FQ3A 2PTCE 1GCDA 1GDNA 2OC0A 3RMMH 2ZPQA 3MO3A 1GL1A 1QRZA 4Q2KA 4WMFA 4FUIA 5JBBS 3E91A 1GBBA 3TGKE 3QDZB 1DLKB 1RIWC 4CRCA 3M37A 1A2CH 5G4BA 4GVUA 1IQLA 4BNRA 1X7AC 1BZXE 1UVGA 2GDEH 1CGII 1TQ0B 2H9EH 1P2OA 1LVOA 1IY5A 1LVYA 1RTKA 3BSQA 3KIDU 1H9HE 3A7YA 4NA9H 1BBRK 4X6MA 3UTUH 5JDUB 2A4RA 3SORA 3LOXA 3T5FH 3UR6A 1BMNH 2BY5X 1GHYH 4CH2B 2OTVA 1ZHRA 4MDSA 1QFKH 2BYAX 4NIWA 2FOHA 1Z8RA 1BOQA 3KQCA 1CT2I 3LGVA 2K1QA 7KMEH 2QQCA 1RTFB 1C1MA 2FOGA 2BQWB 2OINA 1L4ZA 3TIUA 1C9TA 4J1YA 1PPCE 1L1NA 1MUEB 1THSH 1OMUA 5FX6A 3BIVH 2FXRA 5EQRA 1EASA 3A8AA
chains in the Genus database with same CATH superfamily
5DP4A 3LJJA 3Q3YA 2W7SA 2ZQ2A 2AH4X 1ZOMA 1NU9A 1V2JT 2G4UA 4LK4A 1AU8A 5DJ7A 4AG1A 1S83A 5EXLA 1KYNA 4DT4A 1PPFI 1A61H 1HRTH 1UTQA 3Q76A 2Y5HA 3FP7E 3HK3B 4NIXA 1WV7H 2O8WA 4BXWA 1NRRH 2O8LA 1UCYK 1MTVA 1WU1A 3U28C 3ZZ7A 2BDCA 4WH6A 1ZZZA 3QN7A 2ALVA 3OEED 4AX9H 4AYYB 2BMGB 5HI7A 2V6NA 3SOSA 3LJOA 5TCAA 5EIYA 1TB6H 1DICA 2UZ3A 1HFDA 5CE1A 2J4IA 1V2LT 3SEKC 4K8YA 1GVZA 7ESTE 1NROH 5JHWC 2WYJA 1P04A 2FO9A 1GMHG 3R0FA 3N7OA 3ZYEA 5HYOA 5HQ8A 2Z7FE 2O8MA 1ELEE 1K1IA 1C5UA 4B73A 1ZTLA 3DD2H 2SGQE 2ZECA 1SQAA 3M61U 3ODDA 2M5TA 1T8NA 3DFJA 3RXFA 1QL8A 1WYKA 2VIDA 4R0IA 1OYQA 4Y8ZA 1SGRE 2FOCA 1FX0B 4IMZA 1ORFA 5FCRA 5T3HA 3B9FH 1GBAA 1F5KU 4UFFH 1MTWA 1SGYI 3EA9A 4D8NA 1TMBH 3LKWA 3MNBA 1UTNA 5J4QA 2K9HA 1O2MA 4JZ1A 2AGGX 3K6ZA 5C2ZA 1GJDB 3EQ0H 1O34A 1RJXB 1HV7A 1ZMJA 1ELAA 2Y81A 8LPRA 1TBRR 3UOPA 5HXFA 4KTSA 4XFQA 4DNCA 4K1SA 2VRWB 1SHHB 3BN9A 1LR8A 1SGFA 3A89A 4CREA 1TNIA 3QTOH 3BEFB 1YKTA 1YPHE 4CRFA 2P3TB 2QF3A 3K65B 1UK3A 2ZU3A 1O3CA 2GV7A 2X3TA 1DS2I 2A20A 3BTGE 1GWAA 2OC7A 4HFPB 3SJ9A 1TX6A 1AMHA 5FBIA 4HG6A 2JA1A 3MOCA 1OWKA 3A87A 3SYJA 3R5BA 3TJVA 1E35B 1ZSKA 3QWCH 4FUEA 2ZFRH 4JMYA 1O0DH 4X6OA 1VZQH 5J8CA 4Q4LA 2BZ6H 1UHBB 1CA0C 1CHOG 2ZGXH 4HZHA 1KTTB 2V53A 2P93A 4KGAA 1PQ5A 3PLPA 1AWHB 4GPGA 1MJAA 1U5KA 2BX3A 3WY8A 2CF8H 3F6UH 2D2DA 1UMAH 1HUTH 3VE5A 3VDUA 3S0NA 4ZUHA 4TYDA 3RC5A 3QTLD 3KHVA 3F2FA 2QYIA 3SO3A 2J94A 3CXLA 2UUJB 4AOQA 1XKAC 5DGJA 3NK8A 1N6YA 2RIJA 1P03A 1TRMA 1AQ7A 1NBMD 2A5AA 1GI9B 2F3CE 3P92A 3UIRA 3D65E 2PKAA 1U6QA 5GCHG 3C1KA 4DVAU 1XVMA 1L0ZA 4I8LA 1GMHF 1HJ9A 4BAQB 3PM3A 2GD4B 1DS3I 1IHTH 9ESTA 5HM9A 4RT0A 2BLVA 2TGDA 1OWHA 1XUGA 1UUCA 1W0ZU 2ZDNA 1C2HA 1C1QA 2WINI 1QURH 4X1NU 1H8HD 1SGQE 2H6MA 5FCKA 4NIYA 3RU4T 2OK5A 1CT4I 1YY3A 1AN1I 3UQVA 2P8OB 1Z1JA 2HNTF 3UNQA 1V2TT 3SV6A 3OXFA 1CO7E 1ZRKA 1HDTH 1AI8H 1O2UA 2VGCB 1D4PB 2J98A 5EPYA 2WVJA 2A7CA 1OSSA 4B2CA 3KQEA 1YGCH 5FUXA 4E1PA 3SV9A 2G55A 1G37A 2BDYA 3ZVFA 2E73A 2UWLA 3E0NB 1O2NA 2M5XA 3DUXH 1V2UT 4ASUD 3E1XB 2Y6TA 1L1JA 1TX8A 2A4OA 1OKXA 2N1AB 3F68H 1IQIA 1YCPH 1G9IE 2BDIA 2ZFTA 1YLNA 2TGAA 1TOMH 4ZH8A 2R2WU 1C1NA 1PPGE 5GWZA 3D00A 5DO4H 1GI5A 3M7TA 1SR5C 1YWUA 3QX5H 1O39A 1KMAA 1K1LA 3BG4B 1A0LA 4JCVE 2XYAA 1MCTA 2ILNA 2P8OC 4ZKSU 1VGCC 1GBFA 2FI4E 1E34B 1UTKA 2LP6A 2VGCC 1CHOF 2BQ6B 3U1JB 1P01A 5FUVA 4UFDH 3F0PA 2BX4A 3PWBA 1WSSH 3URCA 1P9UA 4NA8A 1AVXA 1RRKA 1WOFA 4A1XA 1SQRA 5F8XA 1IQNA 1A1RA 3GY6A 2FOEA 1O3AA 1P2JA 2J92A 4Z1MD 2AHME 2D8WA 4B74A 2OXSA 4XRNA 3RM0H 1N6XA 2ZU2A 3VB4A 4X8SH 2WPJS 2ODPA 2OZUA 3RMOH 1C4Y2 1FN8A 4AC9A 6GCHG 3QGNB 1QBNA 3A7ZA 2GP9B 1TIHA 2NU4E 3HK6B 2CWFA 1HCGA 3H09A 1SVPA 2W3KA 2XC4A 1XUJA 1ZPBA 2P6AC 1MZDA 2SGFE 5GCHF 3M3VA 3PLBA 5K0HA 3PV5A 1TPAE 1TPSA 3BG4C 1KMHB 2GZ7A 1B0EA 2CJIA 2YMSC 3VGCB 4Y7AA 4CR5A 1MKXK 1DDJA 4D7GA 5LPFA 1E37B 2GZ8A 3SJ8A 1GHWH 2G5VA 5AVDA 2AYWA 1WGTA 1BTPA 8GCHG 1BCUH 1D9IA 4BAKB 4NFFA 2C8WB 2ZGBH 1WQSA 3LIWA 2VWLA 1R0RI 3P8OA 2W0TA 2VIOA 1AIXH 2A2XH 2BHGA 4ABBA 1QJ6B 1B5GH 5E3QA 1ZSLA 2HLDD 1OS8A 5F03A 4P02A 1O2PA 1MJ9A 4I8JA 2A4GA 2ENNA 2EI8A 1WGCA 4TPIZ 1K7VA 3P8FA 1EQ9A 2OUAA 1W0KD 3DT0H 3L33A 3MH7A 4DGJA 1C5QA 3EA8A 3VXEH 5A09A 2ZU5A 3GYLB 1UTMA 1SFIA 1P09A 1HLTH 3OEHD 4IGDA 1C1VH 2ZHQH 2OU2A 3SJIA 4DCDA 4UXHA 1VKYA 2Z9GA 4K60A 4X1PU 1GBKA 1TURA 2JH0D 4LZ1H 1NO9H 1C1SA 3ATLA 2Z6BD 1SG8B 1Y5UT 1V2PT 3RXUA 2KCOA 4FUCA 1J16A 3LGYA 1W0YH 6LPRA 2ZPRA 5EXNA 1EB2A 1G2MA 4B1TA 1BMFD 1NM6A 3JZ2B 3KF2A 4TWYA 2FESH 2CXVA 2OC1A 1O5EL 4ISOA 1B7XB 2QV1A 4GAWA 3MU4A 5DKMA 2F91A 2TGTA 1OXGA 1P2QA 3M36A 3MYWA 2KMQA 5H4IB 4Y10E 1AB9C 2ENZA 4KP0A 3V13A 3TGIE 5A0BA 1F7ZA 1ABIH 2SGQI 1UHBA 4F55A 1LKBA 1OVOA 5C1YA 2ANWA 4ZROA 3NZIA 4AYVB 4D9QA 4DJZB 3M3TA 3VDPA 2C93B 4F4OC 1SGRI 1V2WT 1S20A 2BOHB 5GIBA 1QR3E 1L4DA 5E3RA 3KQDA 1CU1A 4BAMB 6GCHF 3SGAE 4L9MA 1IQJA 2C4FH 5L2ZH 2GT7A 2DKVA 2TIOA 3SZNA 1COWD 1UTOA 2FPZA 1L2EA 2GV6A 1O2TA 4K69A 3V3MA 1AWFH 4MNXA 2FS8A 1O2SA 1QTFA 5EW2H 1GG6B 4XBDA 1C2KA 3U98H 2KR7A 3LGIA 2XNIA 1O3NA 1E36B 2Y7ZA 4B6EA 3R5AA 1BUIA 1K2I1 2B0FA 1YYY1 2ZHWH 1FXYA 8GCHF 1BTZA 2HNTC 1C2DA 2ODYB 3BV9B 1C5MD 5DP7A 1SFQB 3RXVA 1HJAB 5HMAA 3TVJB 1NFUA 1KXBA 5PTPA 3ZZBA 3E0PB 3QLPH 1LO6A 1O3KA 3N7EA 2BY7X 5I25A 3GDVA 1O3PB 4RT1A 1SQTA 2PLXA 3W95A 4ZHLU 4UD9H 3TITA 2FWWA 1GBMA 4H6SB 3F3BA 4OS6A 3RXRA 4A6LA 2CWHA 2ZCKP 2VWNA 2PGBB 2ZDAH 3B4VC 1Z7KA 1PQ7A 3O8RA 1GJ9B 5L6NH 1VR1H 4WVPE 1LHGH 3BTFE 2QA9E 3EE0B 2CHAC 1E38B 1GBHA 3SI3H 1CGJE 2QXGA 1DM4B 1GG6C 1GCTC 3VB7A 1OP0A 3OAAD 1QL7A 1OWIA 1SLUB 4QT8C 1WDIA 1GGDB 3D49H 1FY5A 3UUZA 3HH2C 1XXFA 4YO9A 2OYAA 4Q7XA 5DG6A 2JETC 5EXMA 2AMQA 1DY8A 3PMJA 2A7HA 1O2IA 1NT1A 2PKSB 5IYTA 1P10A 2VB0A 1AD8H 4DIIH 3TH2H 1V1IA 1LQEA 4MPVA 1K21H 1QZ8A 4ACBA 3BTME 3LGTA 2EI6A 4ASHA 1O5FL 5C0TA 1IQHA 1SGQI 1C5RA 4BTTB 2CK3D 4KTUA 3PB1E 1MBMA 1T8MA 5AF9H 1BY2A 4INHA 3RU0A 2F9UA 3MTYA 5DPAA 4ABFA 2ZFPH 1P57B 1ZYOA 2ZCLP 5DK1A 3STJA 1EUFA 3RC6A 2KAIB 1S6LA 3SBKA 5DN6D 1XM1A 3TO9A 3SU4A 5JBCS 3OSYA 3G01A 2R0KA 4FVBA 1YBWA 1GGDC 1BDAA 2FTMA 1DY9A 1UVUH 1LVBA 3MNSA 5AFYH 5FUYA 4FXGH 2LUYA 1F0SA 5FPSA 5HM2A 2CGAA 2OVOA 3M5MA 2EEKA 1BMMH 3UNSA 1G32B 1F0RA 1PQAA 3QZQA 1S84A 1P9ZA 1EZSC 2SGPE 2ZI2H 1GVLA 2PKSC 2CF9H 3V12A 4INKA 1VJ9U 1V6DA 2GVFA 1UTPA 4DG4A 5LPEA 3A85A 5A0AE 2H9HA 3PRDA 1PPEE 2JKHA 1PJUA 4TY7A 4IC6A 2I6QA 2W6JD 4UFEH 1IQMA 3RU4D 1YCPM 3BTQE 3SQEE 1GHBF 3RXKA 3RLYH 3T2NA 1TGTA 5EQSA 1ELDE 3A7TA 2TGPZ 1BA8B 2A5IA 2PSYA 4YLUA 4FOUC 4MNVA 4TWWA 1S0QA 1NRNH 5ESBA 4ABJA 3SV2H 3RXIA 1WQVH 1LPKB 2LPRA 1A5GH 3LGUA 4ABHA 1LHCH 1O2QA 2ZZUH 4MPIA 4SGBI 1S6FA 3ENSB 5GXPA 1WUNH 1WBGB 2VNTA 3NXPA 1NFWA 8KME2 4TPYA 2ANMH 5FPTA 1GJ5H 5JYIA 3P17H 1BRUP 2A4QA 2R0LA 3GDSA 4ZXYH 5AFZH 1O3LA 1TQ7B 2Z94A 1DSTA 4WJG2 2HPPH 1VDDA 1IAUA 2DUCA 2F9PA 1E79D 3FOAA 1V2VT 2NU4I 3KY9A 4A92A 1O2XA 1SHYA 1ZPCA 2ZO3H 1NUBA 4PROA 1DWEH 1O2LA 1AFEH 1MQ5A 2SGFI 1TNLA 4RI0A 1YLCA 2JOPA 1ZGVA 2H9TH 3Q77A 2J87A 3TOAA 3F9GA 1SBWA 3RXJA 5F8TA 1TE0A 1HXFH 3SJKA 4GCHG 1ANDA 1A3BH 3A7VA 1K1JA 4JK5A 2GCHG 1HAHH 4JZIA 1C5WB 2STBE 1HXEH 1V2ST 5E0HA 3AASA 3FP6E 3PMAB 2FOBA 1FARA 3VXFH 1TPOA 1TAWA 3RM2H 2BLOA 3L3TA 1QRWA 2WPIS 1W4RA 1O3GA 3PMBB 1P05A 2GT8A 3U9AH 1EAUA 5KGOA 2WCYA 2HOBA 2YNBA 1Y3YA 1C5TA 5IDKA 2FI3E 2Z9LA 2WV5A 2GX4A 2BM2A 2JDID 2SGEE 1XUFA 2QF4A 3TJNA 2UVOA 4Z6AH 3H7OA 1PCEA 3LH1A 1JRSA 4X1SU 2OY3A 2L8EA 3GCHB 3FFGA 4UDWH 2WUCA 3A82A 2ORWA 1QGFA 3GY5A 3WWBA 5EU8A 1H9LB 4DY7B 3JZ1B 3SU1A 2V3HH 2Q6DA 2OQUA 2JJ2D 4UE7H 5EX3A 3NCLA 3L6PA 3GICB 1EP6A 5CDFE 3R3GB 2BXTH 3P8NA 3UB0A 1VJAU 4OS2A 2SGDE 1Y3WA 2V1CA 4YOGA 2WUBA 3MNCA 1MAYA 3ATIA 1VITH 1J8AA 1MMJN 3SU2A 3SNEA 1O2WA 4ABDA 2AEIH 2F43B 1FZZA 1P8VC 3RXEA 4BTUB 3BIUH 1YCPK 1BT7A 4OS1A 1CA0B 4M7GA 2RCEA 1GI6A 4X8TH 2QF0A 5EODA 1SMFE 1MJBA 2ERWA 5E0JA 4AN7A 5E2PA 5JB9S 1V2RT 1G2LA 1MKWH 3TO6A 1DITH 3GCHC 2ODQA 3GISB 1UJ1A 1S81A 3TJUA 5JB8S 1A7SA 4E7NA 4LZ4B 2AIPA 2Y82A 1XX9A 1V3XA 3MU1A 1JOUB 1HAVB 3A88A 1OP8A 2BVSH 1DPOA 5T6DA 1J15A 4O3TA 5FBEA 1HAGE 2CMYA 1UVPA 4E1RA 4RSPA 1KSNA 2NU3E 3DHKH 3GY4A 3U69H 3TGJE 1IQGA 4I31A 2KMPA 1Z71A 4Y0YE 3TH3H 3MU0A 4YTAA 1T32A 1Z6JH 4CBOA 2JP0A 2QAAA 1E1RD 3SUEA 5A2MH 4GCHF 2QPOA 1OPHB 2GCHF 1O3OA 1UHAA 1HIAB 2F83A 1O2YA 1BRCE 1ID5H 3RXSA 2ANKH 2GDDA 1YC0A 1DOJA 4R8TB 1W0JD 3T28A 5A8ZA 1HJAI 1P2NA 1TPPA 2BD4A 2QXJA 4NSVA 2ODDA 4IN1A 3RXHA 4ZCNA 3A7WA 2FX6A 1TBQH 4FU9A 1W2KH 1HPGA 2BZAA 5EQQA 2PR3A 1K1PA 5HKKD 1MQ6A 1K1NA 4IS5A 4NZLA 4OVOA 1EFRD 1NFYA 2ZC9H 3A86A 4HTCH 1UK4A 4CRAA 5C17A 2QN5T 1D3PB 3M5OA 1GI3A 2QCYA 1DT2A 1MZAA 1DX5M 2KAIA 2B7DH 3ZV8A 5A0CA 1GI0A 2AFQB 2SNVA 1Z8IB 2VWOA 1THPB 3O8DA 2JH6D 5EOKA 3T26A 1JRTA 2IN2A 4K3JA 3S9BA 1CGJI 1O3MA 3VEQB 1C1WH 1FIWA 1SQOA 1ZMNA 1C5SA 2JIZD 2XBYA 3BF6H 1C5NH 4DW2U 3ZVDA 2PFEA 2RDLA 1PTQA 1A0HB 1G3CA 1O5EH 1SGFG 3H5CB 5JBAS 3DCLA 1PJPA 2GVIA 2BLWA 1SI5H 5B6LA 4A24A 1EOLA 1X74A 3RMNH 2VVUA 5FX5A 4Y0ZE 2FODA 1QCPA 5C5NA 1F92A 1C2FA 1UW7A 1VGCB 1ABJH 4K1TA 3RXMA 1H8IH 2HPQH 1GMCG 3HATH 3Q3KA 1D6WA 3UGIA 4FETA 1S85A 2C3SA 3GCOA 1EPTC 3W1EA 1WTHD 1TWXB 3VPKA 1F5RA 2FM2A 2E5RA 4YZUA 2BD2A 3UGDA 3KN2A 1P11E 3TO7A 2Q6GA 2WPKS 1F5LA 3UR9A 1X4SA 4WMEA 2R3UA 1BUSA 3EYDA 1TGSZ 4TSFD 2Q1JA 2IPHA 3GS9A 5TJXA 1SSXA 1C4U2 1O5GH 2Z9IA 2AS9A 2HVXA 1C9PA 4OS4A 5CCMA 1LHFH 2QF5A 3UNRA 3GCTG 2ZDMA 1ZLRA 3LONA 3ZVCA 1FY8E 1FUJA 3SU5A 3GY3A 2OCVB 5FUWA 1DWCH 2YMSB 4ZXXH 1EZXC 3LH3A 9LPRA 1NTPA 4X6PA 2QE7D 2SGPI 5L2YH 2V7QD 3RXOA 1C1OA 4FUHA 2IPQX 5LH8A 4KKDA 3KQ5A 3S9CA 3FSYA 2WPHS 4YOJA 1PYTD 4FU7A 1HJ8A 1M9UA 2P95A 3MU5A 4VGCB 2WV9A 5A8YA 1FAXA 3BG8A 2DIPA 1ANEA 4OS7A 3MMGA 4XOJA 2ZHDA 4SGBE 4A1TA 2O9QA 1AHTH 2BTCE 1VCPA 5C3NA 1ARCA 1YPLH 3WW7A 3T27A 2BVXH 1Z1IA 2WPLS 1YPEH 1C5XB 4ZAEA 1SLVB 1QL9A 2NU2E 1AZ8A 1RGQA 1O5CB 5GDSH 3MU8A 3NUMA 4I33A 3AW0A 1HB0B 3ZZ9A 3W94A 2GCTB 3ZZ4A 3KNXA 1SOZA 1EXFA 4B6FA 2G5NA 1AKSB 2FOAA 5EPNA 3FVFB 1J9CH 1JIRA 1P0SH 3DSPA 4A1VA 1BTWA 2WZQA 4I8HA 3GDUA 2Z9JA 1YTPA 2A32A 2TPIZ 2ZFFH 2SFAA 4X2VA 2BDAA 1KXCA 2AMDA 3PTNA 4BOHA 4UXIA 1MTUA 2ZIQH 3KL6A 2G51A 4VGCC 1N8OC 1FN6A 3ZZAA 4XE4A 3A8DA 2V35A 3TK5A 3ZZ8A 2R2MB 1DXPA 3E6PH 1D6RA 2DE9A 1AB9B 1O5FH 4YT7H 1GMCF 3DFLA 1ANBA 3UOEA 1P3EA 1AE5A 2K8IA 2ZTXA 3PV4A 5B6OA 1C2GA 1CGHA 4TY6A 3GCNA 3VB3A 4O9VA 2GCTC 3EDXB 1C5OH 4Y8XA 4RKOB 1SGNE 5CCLA 3OTPA 5SGAE 1FI8A 1GHVH 3SNDA 5EJZA 2FYRA 3BTKE 3SUFA 2VIQA 1EX3A 2SGEI 4O03A 1YLDA 1HAVA 1GJBB 2JW6A 4AZ2B 3MH4A 3KGPA 5HIZA 2WV4A 4X8UH 4Y7BA 1AFQC 2J5UA 4BXSA 2XCFA 2QXIA 4X8VH 3QAHA 2J9RA 3V7TA 2VVCA 1ZTJA 3VG8A 4UONA 2KCPA 4B2AA 4ISLA 4D9RA 4THNH 1DFPA 4BTIB 2R3YA 3H7TA 1TIOA 1W12U 1FMGA 2FNFX 5ETXA 3ZVBA 2RA0A 1SGDE 2HNTE 3SUGA 3RDZA 1Y1CA 2YOLA 1BMOA 1BRBE 5LGOA 4YM9A 3BTHE 1Z8GA 1TGBA 3PYHA 1ELVA 4AFZA 1HIAA 2L74A 2OD3B 4RN6A 3T25A 4LOYH 1YPJH 3LPRA 2M2AA 4DT7B 2SGDI 3Q00A 1P9SA 2FMJA 2XW9A 1QJ1B 1ZHMA 2Z3EA 1AUTC 2ALPA 2Y5GA 1M8BA 5DP9A 4MTBA 4B6DA 3AAUA 4WP4A 2RA3A 4AFSA 1G36A 1W3SA 1GHZA 2IOTA 3GY8A 2KM0A 1TMTH 1W11U 1O37A 4HGUA 1GJCB 3BEUA 2HRVA 1TX7A 1G3DA 1ETRH 1DSUA 2BLQA 2THFB 2CHAB 3SGBE 2LNCA 4ZKOU 3ZIAD 4NZQA 1FY7A 1GMDG 2PWXA 1T8OA 3A7XA 1GCTB 2WPDD 2WGCA 1LPZB 2VWMA 1CE3A 1BJVA 1HAIH 1TUSA 1ELBA 1MTNC 3R5DA 2QIQA 1IQKA 2FTLE 6CHAB 2NU3I 4FUDA 3QTVH 1Q9BA 2OBQA 2PSXA 5HGGA 4CR9A 5FHTA 1ESBA 1GVKB 1TOCB 1LHEH 2P94A 2QC2A 3I29A 3LC3A 3PTBA 1XXDA 2KMOA 2G4TA 4U32A 1GJ7B 3TK9A 1EJMA 2JETB 3EA7A 1TA2A 4Q7ZA 3VB5A 1NN6A 3M5NA 2OTTX 2BDHA 1C4V2 1EOJA 1MH0A 2VINA 1JXPA 2OQ5A 2ZKSA 4M9FA 1QB9A 1THRH 7GCHG 1MU6B 3M7UA 3ZZ5A 2QQEA 4XBCA 1E1QD 1AE8H 1MD7A 4GUXA 4CRBA 2XBVA 1AGJA 3LGWA 1YPGH 2FLRH 1AY6H 1HYLA 3UPEA 2IJOB 1QJ7B 2UUYA 2XNDD 1N13A 4CH8B 1H0ZA 1ZRBA 3B8JA 3FP8E 4YT6H 4CRDA 4Y71A 1Y3UA 1UO6A 1NXUA 3ESTA 5KEDA 4UEHH 6CHAC 4WF8A 1NRPH 2FOMB 1SLXB 1QA0A 4FUBA 1T31A 2GMTB 3PWCA 3SU6A 1AUJA 1DXWA 1H4WA 1RXPA 2WYGA 2RDEA 2V3OH 2B0UC 1BITA 3ZVGA 1K28D 2Y5FA 3BJIA 1NFXA 1HAOH 4AB8A 1HEVA 1C2MA 4KTCA 1NY22 4X0WU 1TBOA 1DWDH 3A83A 4Q63A 4I7YH 2GZ9A 2ZNKH 1YM0A 1SL3A 1D3DB 3UFAA 2XCNA 1TFXA 1ULNA 2B5TB 1K7TA 2FP7B 2FOFA 3M35A 1T7CA 1FAKH 1RD3B 3N99A 1ARBA 1V2OT 3SI4H 5EG4A 1NPMA 4Y11E 1SOTA 1C1PA 1H1BA 4O3UA 3E16B 1TGNA 3SGQE 4AGJA 4B75A 2NU1E 1H9IE 1G3BA 2BY9X 3MH6A 3TLOA 2ZQ1A 3UGLA 2ULLA 1FDPA 8ESTE 2V3MA 1N1LA 5AHGH 2Y7XA 1GI4A 2UWPA 1BHXF 3KCGH 5FAHA 1JBUH 1ZMLA 2AERH 2GMTC 1KXEA 1XUIA 2O8TA 2YQPA 4GHTA 4FUGA 1WAYB 1P2KA 1PPHE 1GJ8B 1FONA 1GMDF 2FDAA 1A3EH 3ATWA 2XWBI 3NPSA 5KECA 1TBRH 1AKSA 1YU6C 1ZGIA 4Y8YA 2P59A 1E0FD 1GHAG 2XC0A 3LT3A 1GI7B 3SW2B 1CQQA 4FUJA 2ZEBA 1OWJA 5E8EH 5JBTA 1S82A 3BEIB 1MKWK 4D7FA 2RFKC 1SGEE 5TCCA 1BTHH 2ZTYA 1T4VH 2EQNA 1LR7A 1W14U 5T1VA 3WWFA 5A8XA 1GI1A 2DE8A 3PROA 2OP9A 1O31A 1OHHD 2XWAA 3T29A 2N17A 1TBNA 1GHXH 1PPBH 2EY4C 4MNWA 4ZHMU 1FY4A 1GI8B 1H8DH 3UOUA 2FI5E 1L1GA 1D3TB 2PQ8A 1KXDA 4AGKA 4F49A 3BTWE 3SJOA 2GKRI 5I46H 2DB6A 1NBME 4NSYA 3F9EA 1MU8B 1OWDA 4XBBA 1FYBA 5JPMH 3HGPA 1K1MA 3ZZDA 2F9VA 4GI3C 1O38A 2H5DA 2ZGHA 1ZHPA 2J98B 3F2HA 4MPWA 1XMNB 2RC4A 1SGCA 3OL0A 1LKAA 1LPGB 1NRQH 4ACAA 3V0XA 1XX6A 2NU2I 4XSKU 3DA9B 2GKVE 3LDXH 1KLIH 4JK6A 5C5OA 2W7UA 4CHAC 4JZEH 4Y79A 4B2BA 3FZDA 1GBEA 3NWUA 2LB7A 3AW1A 4IBLH 1JWTA 2G81E 3PV2A 2ZTZA 1IW4A 3GYMA 4WMDA 1SGPE 3PRBA 2YNAA 3M5LA 4KELA 5CHAC 4H42U 2VIVA 2BY6X 1XBTA 1OX1A 5ABWA 3HKIB 1SC8U 1J14A 1EATA 3KQBA 3TNTA 1ELGA 1LVMA 4Y6DA 2AMPA 4U30A 1O2ZA 1ZPZA 1PFXC 2VH6A 3ATMA 1F2SE 1C2LA 5C0UA 3QGJA 4H4FA 4JCNA 3ZVEA 2NWNA 1DUAA 2VIPA 3ZZCA 1LDTT 3RXDA 4MPXA 3SV7A 1SB1H 1WTJA 3R5CA 3IWMA 4H6TA 3TJOA 5K7RA 2VH0A 4E05H 5C20A 1TBZH 3URDA 1SGNI 1VCWA 3RLWH 1NS3A 1HAPH 3ATKA 4WH8A 1A4WH 3A84A 1F0UA 2J38A 2EC9H 2B8OH 3RXGA 1GHAF 1RFHA 1FLEE 2ZG0H 3RXPA 5L30H 4WXIA 1XA6A 1O3EA 1AVWA 1RFNA 1EAIA 1S6HA 5CHBA 1FY1A 2ROWA 1O2KA 2ZDVH 1B0FA 4UFGH 3VB6A 3E3TA 4E7RG 1O35A 2BD9A 2PUXB 3MO9A 3CENA 3EGKH 1UTJA 2NU0E 4X1QU 3EE7A 3CP7A 1LCYA 2ZFQH 1SLWB 1KXFA 3RC4A 2XBXA 1GPZA 2D26C 1KBEA 2BUSA 2Z3DA 2PTNA 1O2OA 1SGDI 2SNWA 4U01A 5C67A 2A31A 2BB4A 1Q31A 1BTXA 2KCYA 4U2WA 1ELFA 1QA7A 2D1JA 1EZUC 1C5VA 1CSOE 3SU3A 1ZJKA 1WCZA 3RXLA 1O30A 1BHXB 2KX4A 2ZCHP 1NC6A 1YP9A 2ZHEH 3UFFA 1T4UH 1ZR0A 4GHQA 3O8CA 1TYNA 1C1RA 4IC5A 1P06A 3NRLA 1C1UH 3OU0A 1MABB 1AZZA 1QBVH 2ZA5A 1EAWA 3ZV9A 3ZZ6A 4JYTA 2H1UA 2XTTB 3FC3A 1W13U 1OP2A 1HAYB 1Y8FA 4CRGA 2CWGA 3OTJE 1PYTC 2K0QA 2ZGCA 2ZGJA 4E06H 3SGBI 1Y3VA 2Z9KA 3ZZ3A 1ESTA 1TRYA 4NIVA 2G8TA 3GY2A 4O97A 3MHWU 3SZEA 1GBJA 3CNRA 1LTOA 2N71A 4ISHH 3GOVB 3STIA 4A7IB 1GJ6A 1CHOI 1BIOA 3KYFA 1BBRH 4WY3A 1V1HA 4K1EA 2B9LA 1WKXA 2ZP0H 3BTTE 2A45B 4JZFH 4GSOA 1HDLA 3QZRA 2C8YB 3TOBA 2GTBA 3SU0A 1ACBE 4ZKNU 1P12E 3MQKC 1P57A 1EPTB 4INLA 1BBRE 1DANH 1GDUA 1RTLA 2F4LA 1O2GH 4Q80A 1K1OA 1EZQA 2HALA 4JYVH 2FZZA 1V2KT 1KDQB 2HWLB 2H2ZA 4DURA 1MD8A 3C27B 5BRRE 1BTUA 4AB9A 2J34A 3AVZA 5CMXH 3QUMP 1YF4A 1HAXB 1EP5A 5EX0A 3FO8D 1YPHC 2XRCA 2BOKA 2WPMS 4F48B 1QQ4A 3OVOA 2RG3A 2BD3A 1BJUA 2C8ZB 1TNJA 1W7GH 1ZTKA 2LELA 3K2UA 4D76A 2CV3A 1UCYH 3SHAH 4A5TS 4AG2A 4WWYA 4YLQH 1MCVA 2F9BH 4FVDA 2H5CA 1LMWB 2WHXA 2FIRH 4CBNA 3S7HB 1KY9A 5E3PA 1QIXB 4NA7A 2KMRA 1Y3XA 3CS0A 4AMLA 1D3QB 2VU8E 1AO5A 1P02A 1QRXA 1UCYE 1QB1A 1BTYA 2PV9B 4AFUA 3RUOA 1O3FA 3U8TH 5EGMA 3OXLA 3AK5A 4OS5A 2ASUB 1TALA 3DSGA 4I32A 1PPZA 1TNHA 2ZU1A 1LHDH 2ANYA 5GJ4B 3P8GA 1TA6A 3SGQI 2NU1I 2BD5A 3FZZA 3BTEE 3P70B 5DP5A 1QBOA 2SGAA 1Z7KB 1W7XH 2A2QH 1ELCA 3I78A 2UUFB 1TRNA 2GKVA 3CS7A 3K9XB 1FY3A 1GJAB 2PUQH 3A8BA 3OY6U 1FAQA 3MH5A 3QO6A 1PTRA 1MT1A 2XBWA 1O3HA 1FV9A 3OE7D 4MPUA 1O3BA 1CT0E 2JA4A 3S7KB 2C90B 5J4SA 1HBTH 1TGSI 5DSFA 5IK2D 5DP6A 1DVAH 1N8OB 3RXBA 1BRAA 2Z3CA 1SGEI 1Q2WA 3QWPA 1CE5A 3SNCA 2JYYA 5DAEA 1QY6A 3HGNA 1GBIA 2XOKD 3F0OA 3P95A 1O3IA 1O3DA 1UVOA 2ZHFH 4BAOB 2ELIA 1S0RA 4FKDA 1ZSJA 1CGIE 4ABIA 5BPEA 2UUKB 4NGAH 5F53A 1UVTH 2ZU4A 1FJSA 2J95A 2N52A 5T6FA 1OYTH 3KEEA 3BTDE 2P3UB 1TABE 5DP3A 3UREA 3MNXA 1GBDA 3MO6A 3RMLH 1GL0E 4BAHB 3P6ZB 2HLCA 4TT3D 1TMUH 1MAXA 3F9HA 1AFQB 4B71A 1M8CA 3N7DA 3ITIA 3U8RH 1CT2E 5FPYA 1TOTA 2QQ0A 4MNYA 3AAVA 2QQDA 2QGRA 1KLJH 3RXQA 1EAXA 4XDEA 2J97A 2ZF0H 1WTGH 1NRSH 3OY5U 2GKTI 1FPCH 1P2MA 3FAOA 4NCYA 2XC5A 4HI3A 3RXCA 3S69A 1SGPI 1Y5BT 2Q6FA 4OGXA 4I8GA 5HIYA 4AFQA 2EI7A 1Y59T 1FPHH 3TU7H 1CVWH 1F0TA 5GPIB 3FANA 1TBQR 2BDBA 3FKSD 2BXUH 1H8ED 3SHCH 2OBOA 3RXAA 2PP6A 4WXVA 1IOEA 3ELAH 3NKKA 1S5SA 1O5AB 1PPFE 1ELTA 2VBCA 7LPRA 1UK2A 5F6MA 1GBCA 4IW4E 1IQFA 1K9OE 3UEJA 2ORVA 2CN0H 1KBFA 4NG9H 1W3CA 2VIWA 1QB6A 3F9FA 1C2EA 3GOXA 2JJ1D 4NFEA 1XUHA 1RS0A 1YPMH 2OD1A 4Y76A 2ESTE 3A81A 4X2WA 3PLKA 5E2OA 1HPTA 1IY6A 3QK1A 3OX7U 2ZPSA 3TK6A 3UWIA 3PO1B 3LU9B 4BANB 1P2IA 1QHRB 1NESE 3GCTF 1G3EA 3SNBA 1KLTA 3MWIU 4MG3A 4IMQA 4FUFA 4K8BA 4ESTE 2TRMA 5DP8A 1AVGH 1UTLM 3ZVAA 1OMTA 1OOKB 4HGCA 2AGEX 1XVOA 3RU4E 1MTNB 3VGCC 1Z8JB 2Y80A 3F1SB 5FXLA 1HGTH 3ZYDA 5EW1H 3SN8A 2BDGA 3E90B 3LC5A 2ARPF 3D62A 2GJGA 4GLYA 3EAJA 3UEYA 2R9PA 1O5DH 4ZHAA 1V2NT 5EJ1A 1XKBC 1J17T 1ULMA 2BD7A 3HPTB 2NU0I 1EJNA 2JXDA 1SPJA 4FU8A 1CA8B 2L6OA 1K22H 1TONA 2PGQB 4MLFB 1SGYE 2B8TA 4K2YA 2FX4A 3UAIC 2OLGA 5EJLA 1HAZB 1DWBH 4OGYA 1C5PA 1FNIA 3U1IB 3A80A 1V2MT 2I6SA 1TNKA 1EPTA 3PO1C 1O5BB 2C8XB 1UVFA 1CSOI 3I77A 1IQEA 3RP2A 2ZDKA 1KIGH 1A5IA 6ESTA 1GBLA 1O2HA 1P3CA 2STAE 4ABAA 1KDQA 1C5ZB 5T6GA 1W10U 1Q3XA 4YESB 1LQDB 2FS9A 1Y1BA 2KCXA 1JIMA 1SGIB 3TJQA 5C1UA 1BMAA 1DS2E 3D23A 1ZJDA 1VCQA 4ABGA 2F9OA 2QY0B 1GDQA 4J2YB 3PMHB 1VITG 1UVSH 2EA3A 3SV8A 1C1TA 1PQ8A 1O3JA 3A8CA 4NWLA 2OC8A 4DOQA 1TLDA 4X6NA 1JMOH 1EKBB 1SKYE 2BQ7B 2W26A 3MEKA 2A7JA 2J2UA 2G00A 1O36A 5E0GA 2AGIX 2TBSA 4YOIA 2Y0MA 3E59A 3S9AA 4ZMAH 1NU7B 3B23B 1MBQA 2L7XA 1CBWB 2FYQA 1QNJA 2W5EA 1WXRA 2W3IA 2LEOA 2YMSD 4ISIH 1HNEE 4B76A 1O2RA 3FN8A 3IG6B 2AIQA 3MI4A 1BMLA 1V2QT 1MKXH 5JFBA 3IITA 3PDNA 1CHGA 3VFEA 1GHBG 1OYVI 1KXAA 2V0BA 3F2GA 1EJAA 5C94A 4SGAE 1O2VA 2PHBA 1C5LH 2P16A 1O2JA 1QQUA 4LXBH 1GI2A 4RKJB 1BB0B 3E2IA 3TH4H 1ANCA 2GIVA 1A0JA 2G52A 4K5ZA 7WGAA 4Q7YA 2J9NA 2BY8X 1FIZA 3RXTA 1GJ4H 2VJ1A 3M7QA 4JZDH 1C2IA 3UQOA 1O33A 3GY7A 1DE7H 4ABEA 1C2JA 1TGCA 3O8BA 2P3FH 2PW8H 2ZDLA 4I86A 4MVNA 5LPRA 1A5HA 2JZMA 3M3SA 2V1CC 1CBWC 3DSOA 1C5YB 4DIHH 2F3CI 2BVRH 1HJAC 1A46H 4UXJA 1CT4E 2IJD1 1T8LA 1R79A 2XXLA 1AN1E 2ZWLH 4NWKA 1KTSB 4AORA 2A5KA 4ZKRU 2ZFSA 3OFND 1G30B 5ESTE 1LR9A 2O8UA 1Z2IA 2KZ4A 1ESAA 2FEQH 2UWOA 4XD7D 1INCA 1Z6EA 2W6ID 2HGTH 5F8ZA 4X2YA 3KYGA 1ETSH 3SUDA 2X52A 1O32A 1RIWB 3OXGA 1MTSA 2QXHA 5C1XA 1OWEA 2BD8A 2FLBH 2KFWA 2VVVA 2A0QB 1Y5AT 3T62A 5J8FA 1GBTA 1Y8TA 3ODFA 1EB1H 1IHSH 9WGAA 4CHAB 2WSSD 5GNDA 2PKAB 3U8OH 4X1RU 3K6YA 1VITF 3OYPA 4IN2A 4ISNA 4I8KA 3SQHE 3UY9A 1ETTH 3UWJH 4MQAA 1TNGA 3MFJA 3SNAA 3HKJB 1DLEA 2A1DB 3E8LA 1YPKH 1DUEA 5CHAB 3TNSA 2JH5D 1NZQH 1W8BH 1XUKA 2F9NA 1SGTA 1BQYA 3TPIZ 7GCHF 1CT0I 4X2XA 4Z0KA 2GGVB 3Q3XA 4JYUH 1FQ3A 2PTCE 1GCDA 1GDNA 2OC0A 3RMMH 2ZPQA 3MO3A 1GL1A 1QRZA 4Q2KA 4WMFA 4FUIA 3FSXA 5JBBS 3E91A 1GBBA 3TGKE 3QDZB 1DLKB 1K0HA 1RIWC 4CRCA 3M37A 1A2CH 5G4BA 4GVUA 1IQLA 4BNRA 1X7AC 1BZXE 4P00A 1ULKA 1UVGA 2GDEH 1CGII 1TQ0B 2H9EH 1P2OA 1K7UA 1LVOA 1IY5A 1LVYA 1RTKA 3BSQA 3KIDU 1H9HE 3A7YA 4NA9H 1BBRK 4X6MA 3UTUH 2YUUA 5JDUB 2A4RA 3SORA 3LOXA 5FL7D 3T5FH 3UR6A 1BMNH 2BY5X 1GHYH 4CH2B 2OTVA 2HVYB 1ZHRA 4MDSA 1QFKH 2BYAX 4NIWA 2FOHA 1P9GA 1Z8RA 1BOQA 3KQCA 1CT2I 3LGVA 2K1QA 7KMEH 2QQCA 1RTFB 4OM9A 1C1MA 2FOGA 2BQWB 2KCAA 2OINA 1L4ZA 3TIUA 1C9TA 4J1YA 1PPCE 2CJSC 1L1NA 1MUEB 4YXWD 1THSH 1OMUA 5FX6A 3BIVH 2FXRA 5EQRA 1EASA 3A8AA
chains in the Genus database with same CATH topology
5DP4A 3LJJA 3Q3YA 2W7SA 2ZQ2A 2AH4X 1ZOMA 1NU9A 1V2JT 2G4UA 4LK4A 1AU8A 5DJ7A 4AG1A 1S83A 5EXLA 1KYNA 1PPFI 1A61H 1HRTH 1UTQA 3Q76A 2Y5HA 3FP7E 3HK3B 4NIXA 1WV7H 2O8WA 4BXWA 1NRRH 2O8LA 1UCYK 1MTVA 1WU1A 3ZZ7A 2BDCA 4WH6A 1ZZZA 3QN7A 2ALVA 4AX9H 4AYYB 2BMGB 5HI7A 2V6NA 3SOSA 3LJOA 5TCAA 1TB6H 1DICA 2UZ3A 1HFDA 5CE1A 2J4IA 1V2LT 3SEKC 4K8YA 1GVZA 7ESTE 1NROH 5JHWC 2WYJA 1P04A 2FO9A 1GMHG 3R0FA 3N7OA 3ZYEA 5HYOA 5HQ8A 2Z7FE 2O8MA 1ELEE 1K1IA 1C5UA 4B73A 1ZTLA 3DD2H 2SGQE 2ZECA 1SQAA 3M61U 3ODDA 2M5TA 1T8NA 3DFJA 3RXFA 1QL8A 1WYKA 2VIDA 4R0IA 1OYQA 4Y8ZA 1SGRE 2FOCA 4IMZA 1ORFA 5FCRA 5T3HA 3B9FH 1GBAA 1F5KU 4UFFH 1MTWA 1SGYI 3EA9A 4D8NA 1TMBH 3LKWA 3MNBA 1UTNA 5J4QA 2K9HA 1O2MA 4JZ1A 2AGGX 3K6ZA 5C2ZA 1GJDB 3EQ0H 1O34A 1RJXB 1HV7A 1ZMJA 1ELAA 2Y81A 8LPRA 1TBRR 3UOPA 5HXFA 4KTSA 4XFQA 4K1SA 2VRWB 1SHHB 3BN9A 1LR8A 1SGFA 3A89A 4CREA 1TNIA 3QTOH 3BEFB 1YKTA 1YPHE 4CRFA 2P3TB 2QF3A 3K65B 1UK3A 2ZU3A 1O3CA 2GV7A 1DS2I 2A20A 3BTGE 1GWAA 2OC7A 4HFPB 3SJ9A 1TX6A 1AMHA 5FBIA 2JA1A 3MOCA 1OWKA 3A87A 3TJVA 1E35B 1ZSKA 3QWCH 4FUEA 2ZFRH 4JMYA 1O0DH 4X6OA 1VZQH 2BZ6H 1UHBB 1CA0C 1CHOG 2ZGXH 4HZHA 1KTTB 2V53A 2P93A 4KGAA 1PQ5A 3PLPA 1AWHB 4GPGA 1U5KA 2BX3A 3WY8A 2CF8H 3F6UH 2D2DA 1UMAH 1HUTH 3VE5A 3VDUA 3S0NA 4ZUHA 4TYDA 3RC5A 3QTLD 3KHVA 2QYIA 3SO3A 2J94A 3CXLA 2UUJB 4AOQA 1XKAC 5DGJA 3NK8A 1N6YA 1P03A 1TRMA 1AQ7A 2A5AA 1GI9B 2F3CE 3P92A 3UIRA 3D65E 2PKAA 1U6QA 5GCHG 3C1KA 4DVAU 1XVMA 1L0ZA 4I8LA 1GMHF 1HJ9A 4BAQB 3PM3A 2GD4B 1DS3I 1IHTH 9ESTA 5HM9A 2BLVA 2TGDA 1OWHA 1XUGA 1UUCA 1W0ZU 2ZDNA 1C2HA 1C1QA 2WINI 1QURH 4X1NU 1SGQE 2H6MA 5FCKA 4NIYA 3RU4T 1CT4I 1AN1I 3UQVA 2P8OB 1Z1JA 2HNTF 3UNQA 1V2TT 3SV6A 3OXFA 1CO7E 1ZRKA 1HDTH 1AI8H 1O2UA 2VGCB 1D4PB 5EPYA 2WVJA 2A7CA 1OSSA 4B2CA 3KQEA 1YGCH 5FUXA 4E1PA 3SV9A 2G55A 1G37A 2BDYA 3ZVFA 2E73A 2UWLA 3E0NB 1O2NA 2M5XA 3DUXH 1V2UT 3E1XB 2Y6TA 1L1JA 1TX8A 2A4OA 1OKXA 2N1AB 3F68H 1IQIA 1YCPH 1G9IE 2BDIA 2ZFTA 2TGAA 1TOMH 4ZH8A 2R2WU 1C1NA 1PPGE 5GWZA 3D00A 5DO4H 1GI5A 3M7TA 1SR5C 3QX5H 1O39A 1KMAA 1K1LA 3BG4B 1A0LA 4JCVE 2XYAA 1MCTA 2ILNA 2P8OC 4ZKSU 1VGCC 1GBFA 2FI4E 1E34B 1UTKA 2VGCC 1CHOF 2BQ6B 3U1JB 1P01A 5FUVA 4UFDH 2BX4A 3PWBA 1WSSH 3URCA 1P9UA 4NA8A 1AVXA 1RRKA 1WOFA 4A1XA 5F8XA 1IQNA 1A1RA 3GY6A 2FOEA 1O3AA 1P2JA 2J92A 2D8WA 4B74A 2OXSA 3RM0H 1N6XA 2ZU2A 3VB4A 4X8SH 2WPJS 2ODPA 3RMOH 1C4Y2 1FN8A 6GCHG 3QGNB 1QBNA 3A7ZA 2GP9B 1TIHA 2NU4E 3HK6B 1HCGA 1SVPA 2W3KA 2XC4A 1XUJA 1ZPBA 2P6AC 1MZDA 2SGFE 5GCHF 3M3VA 3PLBA 5K0HA 1TPAE 1TPSA 3BG4C 2GZ7A 1B0EA 2CJIA 3VGCB 4Y7AA 4CR5A 1MKXK 1DDJA 4D7GA 5LPFA 1E37B 2GZ8A 3SJ8A 1GHWH 2G5VA 5AVDA 2AYWA 1BTPA 8GCHG 1BCUH 1D9IA 4BAKB 4NFFA 2C8WB 2ZGBH 1WQSA 3LIWA 2VWLA 1R0RI 3P8OA 2W0TA 2VIOA 1AIXH 2A2XH 2BHGA 4ABBA 1QJ6B 1B5GH 1ZSLA 5F03A 1OS8A 1O2PA 4I8JA 2A4GA 2ENNA 2EI8A 4TPIZ 3P8FA 1EQ9A 2OUAA 3DT0H 3L33A 3MH7A 4DGJA 1C5QA 3EA8A 3VXEH 5A09A 2ZU5A 3GYLB 1UTMA 1SFIA 1P09A 1HLTH 4IGDA 1C1VH 2ZHQH 3SJIA 4DCDA 4UXHA 2Z9GA 4K60A 4X1PU 1GBKA 1TURA 2JH0D 4LZ1H 1NO9H 1C1SA 3ATLA 2Z6BD 1SG8B 1Y5UT 1V2PT 3RXUA 4FUCA 1J16A 3LGYA 1W0YH 6LPRA 2ZPRA 5EXNA 1EB2A 1G2MA 4B1TA 1NM6A 3JZ2B 3KF2A 4TWYA 2FESH 2CXVA 2OC1A 1O5EL 4ISOA 1B7XB 2QV1A 4GAWA 3MU4A 5DKMA 2F91A 2TGTA 1OXGA 1P2QA 3M36A 3MYWA 2KMQA 5H4IB 4Y10E 1AB9C 2ENZA 4KP0A 3V13A 3TGIE 5A0BA 1F7ZA 1ABIH 2SGQI 1UHBA 1LKBA 1OVOA 5C1YA 2ANWA 4ZROA 3NZIA 4AYVB 4D9QA 4DJZB 3M3TA 3VDPA 2C93B 4F4OC 1SGRI 1V2WT 2BOHB 5GIBA 1QR3E 1L4DA 3KQDA 1CU1A 4BAMB 6GCHF 3SGAE 4L9MA 1IQJA 2C4FH 5L2ZH 2GT7A 2TIOA 3SZNA 1UTOA 2FPZA 1L2EA 2GV6A 1O2TA 4K69A 3V3MA 1AWFH 4MNXA 2FS8A 1O2SA 1QTFA 5EW2H 1GG6B 4XBDA 1C2KA 3U98H 3LGIA 2XNIA 1O3NA 1E36B 2Y7ZA 1BUIA 1K2I1 2B0FA 1YYY1 2ZHWH 1FXYA 8GCHF 1BTZA 2HNTC 1C2DA 2ODYB 3BV9B 1C5MD 5DP7A 1SFQB 3RXVA 1HJAB 5HMAA 3TVJB 1NFUA 1KXBA 5PTPA 3ZZBA 3E0PB 3QLPH 1LO6A 1O3KA 5I25A 2BY7X 3GDVA 1O3PB 1SQTA 2PLXA 3W95A 4ZHLU 4UD9H 3TITA 2FWWA 1GBMA 4H6SB 4OS6A 3RXRA 4A6LA 2ZCKP 2VWNA 2PGBB 2ZDAH 3B4VC 1Z7KA 1PQ7A 3O8RA 1GJ9B 5L6NH 1VR1H 4WVPE 1LHGH 3BTFE 2QA9E 3EE0B 2CHAC 1E38B 1GBHA 3SI3H 1CGJE 2QXGA 1DM4B 1GG6C 1GCTC 3VB7A 1OP0A 1QL7A 1OWIA 1SLUB 4QT8C 1GGDB 3D49H 1FY5A 3UUZA 3HH2C 1XXFA 4YO9A 2OYAA 4Q7XA 5DG6A 2JETC 5EXMA 2AMQA 1DY8A 3PMJA 2A7HA 1O2IA 1NT1A 2PKSB 5IYTA 1P10A 2VB0A 1AD8H 4DIIH 3TH2H 1V1IA 1LQEA 4MPVA 1K21H 3BTME 3LGTA 2EI6A 4ASHA 1O5FL 1IQHA 1SGQI 1C5RA 4BTTB 4KTUA 3PB1E 1MBMA 1T8MA 5AF9H 1BY2A 4INHA 3RU0A 2F9UA 3MTYA 5DPAA 4ABFA 2ZFPH 1P57B 1ZYOA 2ZCLP 5DK1A 3STJA 1EUFA 3RC6A 2KAIB 3SBKA 1XM1A 3SU4A 5JBCS 3OSYA 3G01A 2R0KA 4FVBA 1YBWA 1GGDC 1BDAA 2FTMA 1DY9A 1UVUH 1LVBA 3MNSA 5AFYH 5FUYA 4FXGH 2LUYA 1F0SA 5FPSA 5HM2A 2CGAA 2OVOA 3M5MA 2EEKA 1BMMH 3UNSA 1G32B 1F0RA 1PQAA 3QZQA 1S84A 1EZSC 2SGPE 2ZI2H 1GVLA 2PKSC 2CF9H 3V12A 4INKA 1VJ9U 1V6DA 2GVFA 1UTPA 4DG4A 5LPEA 3A85A 5A0AE 2H9HA 1PPEE 2JKHA 1PJUA 4TY7A 4IC6A 2I6QA 4UFEH 1IQMA 3RU4D 1YCPM 3BTQE 3SQEE 1GHBF 3RXKA 3RLYH 3T2NA 1TGTA 5EQSA 1ELDE 3A7TA 2TGPZ 1BA8B 2A5IA 2PSYA 4YLUA 4MNVA 4TWWA 1S0QA 1NRNH 5ESBA 4ABJA 3SV2H 3RXIA 1WQVH 1LPKB 2LPRA 1A5GH 3LGUA 4ABHA 1LHCH 1O2QA 2ZZUH 4SGBI 1S6FA 3ENSB 5GXPA 1WUNH 1WBGB 2VNTA 3NXPA 1NFWA 8KME2 4TPYA 2ANMH 5FPTA 1GJ5H 5JYIA 3P17H 1BRUP 2A4QA 2R0LA 3GDSA 4ZXYH