2XRCA

Human complement factor i
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
548
structure length
461
Chain Sequence
EDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAMDAERRRIKSLLPKLSCGVDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGQWGEVKLISNCSKFYGNRFYEKEMECAGTYSGGPLVCMDANNVTYVWGVVSWPEFPGVYTKVANYFDWISYHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HUMAN COMPLEMENT FACTOR I
publication title Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
pubmed doi rcsb
total genus 92
structure length 461
sequence length 548
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.45: Complement factor I.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00089 Trypsin Trypsin
A PF00530 SRCR Scavenger receptor cysteine-rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xrcA04
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 2xrcA03
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2xrcA02
5C2ZA 2OD3B 1Z6EA 5BRRE 2D2DA 1P2JA 4WH6A 4X2XA 1AI8H 5HMAA 1V2OT 4THNH 4CHAB 3SV2H 1RXPA 2ARPF 1GJ7B 2ZF0H 3O8CA 2VIVA 1T32A 3AVZA 3QTVH 5TCAA 3LPRA 1IY6A 3ATIA 2J95A 2P94A 1Z1IA 3MWIU 5HYOA 3BEIB 2UUYA 1BY2A 1AUTC 5FPSA 7GCHF 4GI3C 2JOPA 4OGXA 2PLXA 1C2IA 5A2MH 4ZXYH 3FZZA 1C2MA 1DUAA 2G5VA 4ABAA 3BV9B 2AH4X 1C2LA 5F6MA 2GKTI 1GL1A 1LVMA 4NIVA 3TJVA 4BXWA 3QGNB 4BAOB 1TBZH 1HXFH 1YCPK 1AD8H 2GMTB 3VPKA 1GCTB 2FOAA 2XNIA 4FU7A 2FTMA 1GI3A 4X8UH 4FVDA 4FXGH 2LNCA 1PQAA 2SGQI 4XSKU 1DT2A 1FMGA 1L4ZA 3QDZB 3FAOA 4K1EA 1C2JA 1C1PA 4MPWA 2BD8A 1MTUA 2VWMA 3K6ZA 3G01A 4IMQA 3LKWA 1BBRH 5TJXA 3TVJB 1PJUA 3V3MA 1N6YA 1BOQA 2FXRA 2GCHG 3ZVFA 4X8TH 1WV7H 1SR5C 1AN1E 1MKWK 1NS3A 3PO1B 3A80A 3U8TH 4Y8XA 2CXVA 5FBEA 1TGSI 1IQEA 1GHZA 1OMTA 3TK5A 2JA4A 2GMTC 1E38B 2ZFPH 1BJUA 1Y1BA 1GCTC 1XM1A 4B74A 3HGPA 1SGRE 1ZHRA 3SV7A 1ETTH 1MCTA 5AHGH 3ZZDA 2VWLA 1ARBA 4NWKA 4Q7XA 2BOHB 3GYMA 1BDAA 3M7TA 1P2MA 2BQWB 2NU2E 4R0IA 1PPGE 4OVOA 1P2IA 2FI5E 4NA9H 1BITA 2BD2A 3UUZA 2XW9A 4Q7YA 1EJAA 1ZRBA 5FPTA 2RA3A 4B1TA 2VVVA 3OX7U 2BDHA 1GI7B 2D26C 3PO1C 5FBIA 3S69A 1GDUA 3S9AA 1IHTH 1HAPH 1GI8B 4GLYA 1AUJA 2G51A 2QV1A 3A8CA 4BAMB 1CT4I 3URDA 4TPYA 1MBMA 4ZHLU 4YT7H 2VWNA 1A4WH 1FAKH 1G2MA 1RGQA 1GBJA 4XBBA 4AGKA 4BXSA 1UCYK 1SGDE 2JETB 1IQNA 1EUFA 1H8DH 4WMDA 1CGJE 1P2NA 1TRYA 3KQDA 5JBAS 4Y6DA 4O97A 1ABJH 5ETXA 2SGDE 2VVCA 2PTNA 4F4OC 2FWWA 2A0QB 1TX7A 2ZZUH 1QRZA 2N52A 3SGQI 2A32A 2AS9A 2BD3A 2IN2A 3A7VA 3PMJA 4ISNA 1SL3A 1OXGA 3A89A 3SUGA 1BTXA 4YTAA 1O38A 5FX5A 1O3LA 2OC1A 1TX8A 1QQUA 1HDTH 3RXEA 1DWBH 3S9BA 1A0LA 1AB9C 1UK2A 5ESTE 2ZU3A 1ZPZA 3E0PB 3ZZ5A 1SC8U 1L0ZA 2VB0A 1YTPA 3EA7A 3P8GA 2UUKB 2OC8A 2JETC 1TLDA 4D76A 2QGRA 2ZO3H 2NU3I 3LGUA 4J1YA 4NCYA 1QGFA 3KQBA 4DGJA 5EW2H 1SHYA 3ELAH 4WWYA 4ISLA 4KP0A 1MQ6A 1C5OH 4E7NA 1L1GA 2QXHA 2ZFRH 1BCUH 3TGKE 2R2WU 2AEIH 5EPYA 2BYAX 2BOKA 1B7XB 1AMHA 1LR9A 2RDLA 1NROH 2Y81A 2A2XH 2DE9A 4NSYA 1W3CA 5JBTA 2P6AC 1C1QA 3ZV9A 1AGJA 1HJ8A 1BMNH 5JYIA 1S81A 3K65B 3IWMA 2QQDA 1BMAA 3QK1A 1GGDB 1O3KA 5E0GA 3OVOA 2TGDA 1QIXB 1LHFH 1QHRB 2Z94A 5EQQA 1GJCB 2R2MB 4MPUA 1K22H 4UE7H 4E06H 2IJOB 1T4UH 1IQMA 3LGYA 3RXVA 1V2KT 3KHVA 4ZMAH 4WXIA 3R3GB 1SGFA 2A5AA 1QA0A 1UVSH 2DUCA 5H4IB 8LPRA 2BX3A 5PTPA 1KXAA 1D3DB 1YPLH 1HLTH 2WCYA 2AGEX 3A7YA 4O9VA 2F91A 2SGEE 3RLWH 4ABHA 3BG4B 1SGFG 1GHAF 3GDSA 3RDZA 4Y8ZA 1S85A 5ABWA 1A5IA 1IQJA 1SSXA 1GL0E 3SNAA 2ZHQH 3EAJA 3PB1E 4DJZB 1BTUA 4K8YA 1HAVB 1PPZA 2ODPA 5K0HA 1XUFA 4OGYA 3P95A 1FPCH 3M37A 1W13U 3U98H 1O5EH 5C3NA 1AO5A 1UTNA 1HPTA 3BTFE 5FXLA 4JZEH 1ORFA 2SNWA 2HVXA 3A85A 2SGFE 1FIWA 4CREA 3AAUA 3MNCA 2F3CE 3BG4C 4MTBA 3LGTA 1O2MA 5GCHG 3U8OH 1DE7H 2PGBB 1O2VA 4IS5A 5E2PA 5GJ4B 1UMAH 1SHHB 3R0FA 2W7UA 4JYUH 1U6QA 1W0ZU 4Y76A 1GI4A 1GJ8B 1HB0B 4ISOA 5DP6A 2ALVA 4OS7A 1IQFA 1W8BH 1ACBE 1C1TA 3A7ZA 3ZVEA 3I29A 5DP8A 4X2YA 2WV4A 2FOFA 1IQGA 2OTTX 3QTOH 3S7HB 1BTPA 1Y3VA 1CT2E 2IOTA 4GCHG 1O31A 4AG2A 1Y1CA 1HDLA 3M3SA 2FYQA 2EI6A 1SGQI 1C5NH 4HI3A 2FLBH 2GT8A 4I32A 1G3EA 1TPAE 3T25A 3AAVA 2BTCE 3PM3A 3QTLD 1GMCF 2H1UA 4A92A 1OYTH 1NRNH 1MUEB 5F8TA 1TB6H 5J4QA 1SGEI 2FDAA 2ZIQH 5E8EH 3K6YA 3L3TA 4OS4A 1A2CH 3Q76A 2NU0I 3D62A 5FPYA 1O3GA 2GCTB 5EQRA 1VCPA 1Y3YA 2B7DH 1YGCH 3KGPA 1O2NA 4TPIZ 2O8TA 5SGAE 2FI3E 1F0RA 5B6OA 1XUIA 3MH7A 1O2LA 2Z3DA 3SOSA 2ZI2H 1THSH 2KMRA 1EP6A 2Q6DA 3FP8E 4ZROA 2BHGA 3VB6A 3FZDA 6CHAC 3CP7A 3M3VA 2JH5D 2HNTC 5ESBA 1C1MA 1EAUA 1AWFH 3M5OA 2XBXA 5F8ZA 2XYAA 4CBOA 1A5GH 1V2UT 1QBVH 2F9VA 1ELGA 1Y59T 3PLPA 1CGIE 4YO9A 1ELBA 1OWEA 2C3SA 2SFAA 3RXIA 4AFSA 1CHOI 2AFQB 1VZQH 4OS5A 2P16A 1V2MT 1ZMJA 2BMGB 3HATH 2Q6FA 3SJ8A 3OY6U 2GCTC 1UTQA 4MNVA 2XBWA 4YOIA 1BHXB 4IW4E 1EX3A 1G37A 2FLRH 1F92A 1HAZB 4AORA 2HPQH 1V3XA 3A7XA 2HNTF 2BD4A 1HRTH 2OBQA 1T7CA 3RXPA 1YP9A 1O3PB 2UWLA 5DPAA 4CRAA 1LQEA 4AYVB 2AERH 4IN2A 1BRCE 1K1LA 3VGCB 4NZQA 3GICB 2J9NA 4JZIA 1H0ZA 5DGJA 1G3DA 1TNGA 1ELFA 1FNIA 2GZ7A 4ABGA 3LONA 1VJ9U 2FOEA 3RXMA 3JZ1B 4Y7BA 2OLGA 4CRBA 4I8HA 4MNXA 3SW2B 1NRRH 3PMBB 1OWIA 2GX4A 2F9BH 1ESAA 1LTOA 2UUFB 2STBE 1SGPE 4LXBH 2GTBA 4YESB 1EAWA 3P8FA 1QJ1B 4CRFA 1XUKA 1H1BA 1V2ST 2NU4E 4XE4A 3KCGH 2ZG0H 1O2UA 1XKAC 1ZTJA 2VH0A 1C2EA 3VB4A 3NUMA 2B0FA 3VGCC 2ZFTA 1BBRK 4NIYA 2VINA 1F0TA 1P2QA 5I46H 2GGVB 2BZ6H 1CT0E 3UPEA 1CE5A 4KTCA 1YPGH 3A84A 4XDEA 2ZWLH 1OWKA 4FUDA 2OYAA 1INCA 2ERWA 4I8GA 3SU6A 4CH8B 5HXFA 1SGCA 1HYLA 1ELEE 1T8MA 1PPEE 1UVPA 1P0SH 2OTVA 1L4DA 1SOZA 1JRTA 3ATWA 1C5VA 2ZFSA 1TRNA 2ZHDA 1HAVA 3BTQE 3Q3YA 2ANYA 1K9OE 1C5WB 2BDAA 1G32B 1GMDG 2PSYA 1TIOA 2AIQA 5A0CA 4U32A 1HV7A 3U1JB 3RXUA 5C20A 1GVKB 3A88A 3RP2A 4FU8A 1GMHG 1UHBB 2H5DA 1A3BH 4NIXA 1P09A 3PWCA 2GDDA 2C8XB 1GBTA 2ZDAH 2GCHF 4NGAH 3ESTA 3LDXH 5DP7A 2OCVB 4H6SB 1FLEE 1O5FL 3U69H 1NU9A 2NWNA 1LPKB 3TK6A 4WVPE 3QWCH 3VB5A 4AGJA 1WTGH 3OTJE 2N71A 1WCZA 4BANB 3SZNA 8ESTE 1FN6A 3SJKA 3BIVH 4K2YA 2C4FH 1MAXA 1O2TA 1TPOA 2WPIS 3AW0A 2YOLA 2ZU4A 3RM0H 1TGCA 3MTYA 3SJIA 1GBCA 5CMXH 1C4U2 1DUEA 3OU0A 1RFNA 3DD2H 1DFPA 3GY2A 2P59A 4OS6A 1L1JA 4M7GA 4K69A 1AVGH 1LVOA 1VGCC 4WXVA 3HKJB 5DG6A 1UTLM 4DIHH 1A61H 1SLUB 1EB2A 3RXTA 1SBWA 3PYHA 1ZYOA 4BNRA 2BB4A 4A5TS 3ZZ7A 5C1UA 1O3BA 1YPJH 1D3TB 3NK8A 5LPRA 1YU6C 5EODA 1Y5AT 3DFJA 1LHCH 3LOXA 1A46H 2H9EH 1T8LA 1UTMA 2ZTXA 1TX6A 3RMOH 3RMLH 1SFIA 2ZTYA 4ASHA 4ESTE 1CHOG 1B0EA 1QTFA 4ABJA 3L33A 5J4SA 1EXFA 2AGGX 3TJUA 3KIDU 2EA3A 1P10A 2AMQA 1ZGVA 2W7SA 3O8DA 1BUSA 1MD7A 2V53A 2Y7ZA 3PV4A 1LPZB 2H9HA 2Y6TA 4NSVA 2WYJA 4NA8A 4UFFH 3GY6A 3P70B 3SQHE 1EJNA 4YM9A 2ZTZA 1O2YA 4ZAEA 1KXBA 1ANCA 1TOCB 2ANMH 3U1IB 6GCHF 2RG3A 3UREA 4JK6A 1M8CA 3E16B 1TNHA 4YLUA 3T28A 5E0HA 3A8DA 1FAXA 4Y71A 1DS2E 3RU4D 4ZKNU 1LR8A 2I6QA 2R0LA 2GZ8A 1PPHE 1ZJKA 3SNDA 3MU0A 2QYIA 3QLPH 2JXDA 3FVFB 4WMEA 1AFEH 1P2OA 2ZECA 4MNYA 2P3FH 1JMOH 4CHAC 1E34B 5JDUB 3E3TA 2QXIA 4DCDA 2A5IA 1B0FA 1FJSA 4JK5A 1OYQA 1J17T 1GI5A 4AFQA 4TYDA 5AF9H 2ZGBH 4AZ2B 4K1SA 5JPMH 5K7RA 1GBKA 2ZHEH 3VB3A 1RS0A 1MZDA 4JYTA 1P8VC 2Z9KA 1PCEA 5HM2A 1HGTH 1O0DH 1Z8JB 3ZYDA 3DUXH 5JB8S 1HXEH 1KSNA 2ZU2A 4CH2B 1T8NA 1EPTA 1HJ9A 1M8BA 3GY7A 3URCA 1T4VH 2ZDKA 1TYNA 1BIOA 3W95A 3UQOA 1ZPCA 5EGMA 1YPMH 2WPLS 1ZSJA 2SGQE 1QCPA 4WMFA 1KLTA 7ESTE 5GXPA 1QFKH 1YPHE 3UQVA 2I6SA 2TGPZ 1FZZA 1XUJA 3M7UA 5A8YA 2ZCLP 2TGTA 4HGCA 1C1VH 2Z6BD 1Z7KA 1HPGA 3SU3A 3RXDA 3SNCA 1ZR0A 3CS0A 1WQVH 4ZKOU 1J16A 1SGRI 4Y11E 1AY6H 1SGIB 1OWJA 1JOUB 2C8YB 3QX5H 5E2OA 4FVBA 2BDBA 5EXMA 1EP5A 1O5EL 2FOBA 2BZAA 2OQ5A 1AU8A 3PLBA 1ZHMA 5EXNA 1BRAA 1SB1H 1ELVA 1KDQA 1LDTT 5LPFA 1EB1H 4IC6A 1GBLA 5DP4A 2CGAA 1UHBA 3ZZ4A 4D9RA 1YC0A 2Y7XA 1V2JT 1ZOMA 2VWOA 3MI4A 2JYYA 1VITH 1QB1A 3PWBA 1CA8B 1G3CA 1SVPA 1C9TA 1OX1A 5GCHF 5C5OA 3UOUA 3Q77A 3RXLA 1MTNB 1ZPBA 2G4UA 3M5NA 1NO9H 4GAWA 4AOQA 1SGDI 2OVOA 1O3AA 1YYY1 2ODYB 5HGGA 1C5MD 1CGJI 1EOJA 5C5NA 1FYBA 3ENSB 2ZDMA 2TIOA 4PROA 2QY0B 5LH8A 1WU1A 1VITG 3F9FA 3MH5A 4YZUA 2G55A 1GDQA 1MD8A 1A0HB 3SU0A 1PFXC 2H6MA 1F0SA 2STAE 3TJNA 2ZQ2A 1AZ8A 3EQ0H 1DM4B 2GKRI 5JBBS 4UONA 2J4IA 4GCHF 1CGHA 1GJ5H 1L1NA 3ATMA 1XMNB 2WUCA 3BN9A 4AB8A 2BDIA 1ZZZA 4AX9H 4F49A 3SGQE 1OSSA 1CA0B 1TNKA 1TMUH 1H4WA 1JWTA 3RXQA 1K1OA 1SGNI 3RUOA 1G2LA 3ZZ9A 4I8KA 3SHAH 1AKSA 3MNSA 1DSUA 1PQ7A 1BTHH 4ABIA 4Q80A 1TBQH 3E91A 1MCVA 2F9PA 2FZZA 1D6WA 3EA9A 3FP7E 4LK4A 4KGAA 4H4FA 2K1QA 1LKAA 4YLQH 3SUEA 1BTZA 3ZZAA 1GBAA 1HAHH 1MZAA 3RXGA 3GDUA 1O3CA 4R8TB 3K9XB 4AYYB 2ZDVH 4UFDH 2TRMA 3UNRA 2KAIA 2IPHA 1C9PA 1F7ZA 1O2QA 2BD5A 1UCYE 3BF6H 2ZEBA 4CRDA 3PROA 1FV9A 1CA0C 2C8ZB 1O30A 2ZQ1A 3E90B 5EXLA 3GCTF 1K2I1 1W7GH 1MTSA 3MYWA 1P3EA 1FY4A 3MO9A 1GJAB 1ETSH 1KTSB 2GDEH 2A7CA 3NWUA 1TNIA 2ZFQH 2ZC9H 5GIBA 2TBSA 2ZU1A 1Y8TA 4CR5A 3TK9A 3K2UA 1TBRR 1GI0A 3QZRA 2PUXB 4FUJA 2H5CA 3BG8A 1Z8GA 1YLCA 1HCGA 1LQDB 3GDVA 4ZHAA 3V13A 2G8TA 4K5ZA 2SGEI 1ELCA 1W7XH 4O03A 1AZZA 2Y5GA 2ZKSA 2J2UA 3U9AH 5DAEA 1GJDB 3HK3B 3ZZ8A 3PTBA 5CHAB 1Y3XA 1ID5H 1GGDC 1SFQB 2B9LA 2OP9A 2ZCKP 3F9HA 1GJ4H 1O3DA 3ZVDA 1Y3UA 1PYTC 3BTEE 3HH2C 4FUHA 5FAHA 1DDJA 3UIRA 4MPVA 1DY8A 4X8SH 5T6FA 1BRBE 1UTPA 4IN1A 1FY5A 1J8AA 1BJVA 1KYNA 3MH4A 1W0YH 1UK3A 2A4RA 1BA8B 5JB9S 1N13A 3RXFA 2A5KA 2YNBA 1P04A 4Q7ZA 1IW4A 2F3CI 1PPCE 2WPMS 2BLOA 1FUJA 1UTJA 1WSSH 1XX9A 5CHAC 4BAHB 4RSPA 1LVYA 1BMMH 1OWDA 1QR3E 1BTYA 1GHXH 4Z6AH 1TIHA 2XCNA 3H7OA 1H9LB 4WY3A 1O2WA 8GCHG 1UTOA 2PGQB 2D1JA 3SBKA 1V2LT 1GHBG 2XRCA 3MU4A 5TCCA 2AMPA 3TNTA 1SG8B 2XC5A 1GBHA 1O2RA 4HGUA 4GVUA 5L30H 1C5YB 5DKMA 3AASA 3B4VC 1O2GH 3MU8A 1CT2I 3VFEA 2XWAA 4MPXA 1G36A 2GD4B 3KNXA 1NFYA 1QL7A 1IQIA 1GBEA 4NA7A 2UWPA 4K1TA 4X6NA 2Z3EA 1MMJN 1HUTH 2C90B 2SGAA 1OP0A 1S0RA 3RC4A 1GMHF 4B2CA 4K8BA 4UFEH 2HLCA 1O5BB 4NFFA 3ATKA 1WBGB 2Z9LA 3WY8A 1YBWA 2PV9B 2QA9E 2ZFFH 4YOJA 1V2VT 3GCNA 2Z9JA 6LPRA 3BTWE 1FN8A 1EZQA 4IC5A 1C5UA 1AE8H 1ZHPA 3NZIA 2H9TH 3B8JA 4MDSA 4Y79A 3V12A 1HIAA 1SGEE 1SGTA 1NU7B 3LJJA 3V7TA 4OS1A 2GP9B 1LMWB 3M35A 3UWIA 1E37B 1P06A 4FUIA 2NU0E 5LPEA 4TWYA 3SGAE 1L2EA 4FU9A 1AQ7A 3F9EA 4JZFH 4A6LA 2AGIX 4X1RU 5EPNA 2BQ7B 1SQTA 2CF8H 1TPPA 4HZHA 2EEKA 2AMDA 1NTPA 1O2SA 4E7RG 3GISB 1ETRH 3STIA 4BTTB 4O3TA 2B0UC 2HNTE 4MNWA 2NU1I 4I8LA 4ZXXH 5A8ZA 3UOPA 2G4TA 9LPRA 4BAKB 1F2SE 4I31A 1C1RA 4I8JA 5JFBA 1QY6A 2A7JA 1P03A 3RU4E 3T62A 3H7TA 5E0JA 4SGBE 1T31A 2F9UA 2HOBA 2QCYA 1UVTH 1Q31A 2WPJS 2KMQA 1CHOF 2A31A 3UR9A 1GJ6A 3E8LA 5AFZH 1TGBA 4X6MA 1DSTA 2VIPA 1GPZA 2O8MA 1TALA 5AFYH 5F03A 4DIIH 2TGAA 1JBUH 4ABEA 1LR7A 1O3NA 4DVAU 3GCHB 1EASA 3TH4H 5HM9A 2WV5A 4JYVH 1O3JA 3ZVGA 4CR9A 1OYVI 2Y5FA 2GV6A 2FTLE 4B71A 1WQSA 1GHAG 2UUJB 1GBFA 1QB6A 1D3QB 1QL8A 9ESTA 1SGPI 1JIRA 1Z8IB 2HRVA 2ZGJA 4TWWA 2R3YA 1D4PB 1DOJA 1EPTB 3D23A 4ZH8A 1QB9A 4HTCH 3LH3A 1ZMNA 3MO6A 2ZCHP 3LT3A 2WYGA 1P02A 1UVGA 4J2YB 3ZZBA 2ALPA 1SQOA 1TE0A 4B76A 4VGCB 1TURA 1K1NA 1SOTA 1VJAU 2V3HH 1RD3B 1CT0I 2ASUB 1SGYE 1G9IE 1SLVB 5JBCS 2ZGXH 2V3OH 3GCHC 3W94A 1BHXF 2ZNKH 2A4OA 1Z7KB 3SJ9A 3GYLB 3NPSA 1O3HA 1S6HA 1DX5M 4DOQA 2SGPE 1PPFE 2J38A 1TWXB 1EPTC 1A1RA 1N1LA 2ANKH 2M5TA 4ISIH 1CHGA 3IG6B 3GY3A 1CSOI 1QA7A 1HFDA 5A8XA 3C27B 1G30B 1O39A 1KDQB 2ZPRA 3CENA 3HGNA 1AFQB 4VGCC 3TJOA 2PR3A 2WUBA 1ZJDA 2GT7A 2KCXA 1BQYA 3ZV8A 4GUXA 1MU8B 7LPRA 1W11U 2VGCB 1V2TT 1IY5A 4I33A 2ULLA 3ZZ6A 2CN0H 6ESTA 3S9CA 1O2HA 1N8OB 3D49H 5DJ7A 1LKBA 4AG1A 3F1SB 4WF8A 3U8RH 1GCDA 2XWBI 1BBRE 3A87A 1NC6A 1QNJA 1TGNA 1ZRKA 2OXSA 5T6DA 1R0RI 1A7SA 2B5TB 3LGVA 4ABDA 1WUNH 3RC5A 1DPOA 2VIQA 1GI9B 3SEKC 1WYKA 3LGWA 1AFQC 3PTNA 2FIRH 1HBTH 1C1OA 2SNVA 2BVSH 3SGBI 2GKVE 1V2PT 1CBWB 1Z1JA 4Y10E 1UO6A 3KQEA 5C67A 5A0AE 3MU5A 3EYDA 5A0BA 4TY6A 3RU4T 2XC4A 1C2DA 3A7WA 1MQ5A 1BT7A 2BY9X 1KY9A 3E0NB 1FY1A 1TGTA 1FY3A 4B2AA 2C8WB 1AKSB 1MU6B 4JZ1A 1EATA 1XKBC 1DXWA 1KTTB 2J34A 1X7AC 1UJ1A 2FESH 3A86A 2BDYA 1DWDH 1K1MA 4GHQA 1MH0A 1NESE 3MNBA 1NM6A 1QBNA 2P93A 2VJ1A 4D7FA 3H5CB 3MHWU 1CBWC 2KAIB 4IGDA 5FHTA 3TGIE 1EZXC 3M5MA 2QQCA 2BY8X 1VITF 2CF9H 2QF0A 4SGAE 1IQKA 1C1SA 1YPEH 3B9FH 2FEQH 2PWXA 3RM2H 4ZKSU 1GI2A 4D9QA 1F0UA 2XC0A 1AVWA 1FPHH 4INKA 3SU2A 2O8UA 3T27A 2R9PA 2VH6A 2ZHFH 3C1KA 4AB9A 3L6PA 2JH6D 2W3KA 1M9UA 4A1VA 4AFZA 1H9IE 3GCOA 3DA9B 1TMTH 1ZLRA 1DS2I 2BUSA 3SUFA 2D8WA 3PMHB 1RRKA 3EA8A 4DURA 3O8RA 3UR6A 2LPRA 5DP3A 2UWOA 1C5TA 2FMJA 4MVNA 2WPKS 4O3UA 1AHTH 2JP0A 3SJOA 1CE3A 1CU1A 4X1PU 3ODDA 3ZZ3A 1C2KA 1C1UH 2ILNA 4TY7A 1O2JA 2HWLB 5DK1A 3A8AA 3TPIZ 1BTWA 1A3EH 1NFWA 3VXEH 1DANH 3IITA 4RKOB 2C93B 2FO9A 1O5DH 1ABIH 3B23B 1NY22 1P3CA 3TU7H 1BMOA 4DW2U 1DLKB 4KTUA 2R0KA 4ZUHA 1DWCH 1ELTA 1WOFA 2A4GA 2P8OB 3P8NA 2HALA 1FIZA 1GHVH 1PPBH 2QAAA 1E0FD 3LC3A 5CE1A 4UFGH 3Q3XA 2M5XA 4OS2A 4MQAA 2VNTA 2J94A 2HGTH 2Z9GA 1AN1I 2W5EA 2GZ9A 1WAYB 4K60A 1YPHC 5DP9A 3A83A 1K21H 3SNBA 1P05A 1HAYB 1TRMA 4NWLA 1S83A 4X2VA 3RXHA 3SNEA 1ELDE 1C1NA 1E36B 4ISHH 2FOGA 4BTIB 2XXLA 1SPJA 3F9GA 1D6RA 1QQ4A 2CV3A 1CVWH 3SI3H 1GG6B 2B8OH 4ZKRU 1AE5A 3FANA 2QXJA 1GHYH 3TJQA 1DWEH 5C1YA 1KLJH 3UNSA 1CO7E 3MFJA 1C5SA 2P8OC 2QIQA 4NZLA 1SQAA 3SO3A 2NU2I 1MKXH 4I7YH 1C5QA 3NXPA 1O5GH 3BTGE 2BLVA 1EAIA 2JZMA 1O3EA 1O5FH 2ODQA 1YPKH 3A81A 3OYPA 3QZQA 1K1PA 4FUFA 1ELAA 2ZA5A 2ZPQA 1V2RT 4MLFB 4B2BA 3UFAA 1GI6A 3QN7A 2FM2A 1ZSKA 1TONA 1TQ0B 2GKVA 1O33A 4H42U 2V6NA 2EC9H 5LGOA 1GBMA 1GG6C 1Q2WA 3SV9A 3KEEA 2BLWA 1P9SA 2XBVA 1MT1A 3F68H 1C4Y2 1W10U 1F5KU 1ZGIA 1C2GA 2Y80A 1BUIA 2FODA 1ANEA 1HIAB 2KMPA 3SHCH 3MNXA 1AB9B 1CT4E 8GCHF 2SGDI 3STJA 4GHTA 3KQCA 4IMZA 1GHWH 1GHBF 4BTUB 1J14A 4XBDA 3QUMP 5T3HA 5GPIB 3ZYEA 4MG3A 4D8NA 1HNEE 1IOEA 1DS3I 4X0WU 1W12U 4CRCA 1XXDA 2W3IA 2A7HA 1RTLA 5T6GA 4UEHH 1TABE 3QO6A 1QRWA 1TAWA 3T26A 1TA6A 1W2KH 1THRH 1K1IA 4NG9H 1EOLA 1GBDA 1MTNC 1D9IA 3RXCA 1KXDA 1O2KA 1S6FA 1NN6A 5FCRA 1Y5BT 1D3PB 1UUCA 4LZ1H 2FYRA 2Z3CA 1Y5UT 2ANWA 1RTKA 6GCHG 1SGNE 4UD9H 4AN7A 3MH6A 2O8WA 1KXEA 2NU3E 4ZHMU 1MTVA 7GCHG 1NFXA 1P01A 1IQLA 5I25A 1NT1A 4JZDH 1HAIH 4GPGA 1KXCA 1QL9A 1ZTKA 1GVLA 3ZVCA 1BZXE 5EW1H 3LIWA 3TH3H 4U01A 4LOYH 3SU4A 3M36A 4FUGA 3RXBA 4FUEA 1GBIA 1O3MA 4Y0YE 1LCYA 1KLIH 1SMFE 1P11E 4WH8A 1GWAA 3UNQA 4KELA 1FXYA 3RXSA 1TMBH 1TA2A 1YF4A 2GV7A 5EOKA 5A09A 1GI1A 2OC0A 1NRPH 4IBLH 1P57B 1V2QT 2YNAA 3O8BA 1FONA 3E6PH 4X2WA 1S5SA 1VCQA 5BPEA 1OPHB 1OMUA 4XFQA 4A1TA 1JXPA 2ZU5A 3I78A 1J9CH 3S0NA 1TUSA 1TNJA 1O2OA 1XVMA 2KMOA 1PQ5A 2BQ6B 1OP2A 1O2XA 3Q00A 5C1XA 1C5RA 2AIPA 3A82A 1B5GH 2ESTE 3D65E 2BDGA 2ZGCA 3RMMH 2OINA 3GOVB 3BTDE 3NKKA 1ZMLA 3GY5A 1OP8A 2Z9IA 4Y8YA 1H8IH 1S82A 1BRUP 1YCPH 1YM0A 2Q6GA 2DE8A 1DXPA 3NCLA 2BXTH 3SU5A 1DICA 2P3UB 1TPSA 1RTFB 2V35A 1KMAA 1RJXB 1ZTLA 3M3TA 4KKDA 2SGFI 3OSYA 1NPMA 2LEOA 3P8OA 5L2ZH 2WINI 2A1DB 4YT6H 3SORA 2ZDLA 3RLYH 4H6TA 2V0BA 1VCWA 1EJMA 1O37A 3ATLA 3RXOA 2ZP0H 2Q1JA 4A1XA 5G4BA 1IQHA 4INLA 1MKWH 5JHWC 2BLQA 2PKSB 1THPB 3FP6E 4JCNA 5FCKA 3RXJA 1O36A 5GDSH 2O9QA 3RXAA 2O8LA 1AVXA 4LZ4B 1GVZA 3ZZCA 2PKAB 1XUHA 1A5HA 2CMYA 1N6XA 2P95A 1O2IA 2OC7A 2RA0A 1GMDF 1MAYA 3BTME 1SI5H 3DHKH 3SV8A 5F8XA 2Y5HA 3N7OA 4CBNA 1GDNA 1BMLA 2H2ZA 4XOJA 2FX4A 1EQ9A 2JH0D 2QN5T 2BM2A 3P17H 4GSOA 4Y7AA 2BY6X 5EU8A 3HKIB 1NFUA 1H9HE 1FDPA 2Y82A 2ZDNA 1ARCA 1SGQE 2OBOA 2VIOA 4HFPB 3BEUA 2W26A 3LH1A 1ZSLA 4JMYA 2PKSC 4XBCA 3SN8A 2ZPSA 2BVXH 2FPZA 1YCPM 2G00A 4BOHA 2CHAB 2G52A 6CHAB 1ANDA 4K3JA 3P6ZB 2AYWA 1FQ3A 1QRXA 3HPTB 1O35A 3EDXB 3LU9B 1TNLA 2F9OA 3MO3A 3MMGA 2GVFA 1NRQH 4D7GA 1LHGH 1QURH 1TOMH 2BD9A 3TH2H 1NUBA 1F5LA 1EAXA 1UCYH 3UY9A 4ABBA 1OWHA 1YLDA 3RXRA 1MBQA 3TNSA 3BTKE 2XCFA 1CGII 1SLWB 1C5ZB 3DT0H 1HAXB 4ABFA 1W14U 1OKXA 7KMEH 1ANBA 3GY8A 1O5CB 4NFEA 1A0JA 2CHAC 1O32A 4BAQB 1EZSC 2FS8A 3GCTG 1G3BA 4X1SU 2FI4E 1O2ZA 2A4QA 1C1WH 1TQ7B 1AWHB 1UVUH 3DFLA 3T29A 2QXGA 3SI4H 2THFB 1EZUC 2A45B 4SGBI 2FOCA 1E35B 3M61U 2NU1E 4QT8C 3ZVBA 1RIWB 2QF3A 3E1XB 3V0XA 1T8OA 3TIUA 1P2KA 1O2PA 2J92A 1LO6A 1CQQA 1FI8A 1V6DA 2VU8E 4DY7B 4X8VH 1C5PA 2XBYA 2OY3A 2BX4A 1GJBB 2PTCE 3LJOA 2PHBA 3EE0B 3BIUH 1DLEA 3T2NA 2G81E 3BTTE 2NU4I 3EGKH 2FOHA 2Z7FE 1S0QA 2FP7B 1RIWC 1P57A 2A2QH 1OS8A 2BXUH 2WPHS 1O34A 2F9NA 1C5LH 3SQEE 1SGYI 4E05H 3F6UH 2N17A 2ZHWH 2ZGHA 1QBOA 4FUCA 1IAUA 1HAOH 5GWZA 1V2NT 4DG4A 1GJ9B 1DY9A 3HK6B 2SGPI 3MU1A 1PPFI 1LHEH 3BEFB 1WTHD 3A8BA 1IHSH 1P9UA 1UK4A 8KME2 4KTSA 3KN2A 3T5FH 3PLKA 2FOMB 1C2FA 1J15A 2F83A 1ESBA 1LPGB 3RMNH 4RN6A 1LHDH 1PJPA 1MKXK 4RKJB 1C2HA 1DITH 3FFGA 4AFUA 3RXKA 1AIXH 2FX6A 1P12E 1HJAB 2CJIA 1PYTD 1LVBA 1OVOA 3CS7A 1XVOA 4X6OA 2JKHA 3KF2A 4Q2KA 3SUDA 1O3OA 4DT7B 1Z8RA 3ODFA 1CSOE 3P92A 3PMAB 1XXFA 1DVAH 4UDWH 3VXFH 1NRSH 2RCEA 3LGIA 3OY5U 4X1QU 3KL6A 1TFXA 1TBQR 1C4V2 1GMCG 2G5NA 3TGJE 2PUQH 2P3TB 1TGSZ 1UTKA 5FX6A 4X6PA 5L6NH 1O5AB 1V2WT 1TBRH 3GY4A 1QJ6B 1PQ8A 1VGCB 4Y0ZE 4Z0KA 1ESTA 4WJG2 2EI8A 3UTUH 1EKBB 4NIWA 1HJAC 1Y3WA 1HJAI 1HAGE 2PKAA 2TPIZ 2XTTB 1Q3XA 5AVDA 1FY8E 3QGJA 2BY7X 2VGCC 1UVOA 1K1JA 1MTWA 4U30A 2EI7A 2OQUA 4FUBA 3JZ2B 1N8OC 3BTHE 3TITA 2VVUA 2PSXA 5IDKA 1O3IA 3VEQB 1K28D 3M7QA 1VR1H 1Z6JH 3UWJH 5L2YH 3BSQA 5EQSA 3SGBE 3S7KB 4B73A 5IYTA 1JIMA 3I77A 1XUGA 4B75A 3SV6A 1O3FA 2BY5X 1NZQH 2VIDA 5DO4H 2OUAA 3M5LA 1BB0B 3SU1A 1KXFA 4A7IB 3VB7A 3MOCA 2PW8H 3A7TA 3TLOA 1F5RA 4U2WA 3RC6A 4X1NU 2QC2A 3AW1A 1GBBA 3Q3KA 4INHA 1YKTA 1OOKB 2R3UA 3ITIA 1QJ7B 2BVRH 3LC5A 1C5XB 5DP5A 1Z71A 2PFEA 2BDCA 2BD7A 5EG4A 2HPPH 1SLXB 2VIWA 4CRGA 1JRSA 1S84A 4YOGA 3ZVAA 1UVFA 1KIGH 2FS9A
chains in the Genus database with same CATH superfamily
5C2ZA 2OD3B 1Z6EA 5BRRE 2D2DA 1P2JA 4WH6A 4X2XA 1AI8H 1S20A 1QZ8A 5HMAA 1V2OT 1K7VA 4THNH 4CHAB 3SV2H 2K0QA 2J98A 1RXPA 2ARPF 2M2AA 1GJ7B 2ZF0H 3O8CA 2VIVA 1T32A 2KX4A 3AVZA 2OZUA 4Q63A 3QTVH 5TCAA 3LPRA 1IY6A 3ATIA 2OD1A 2J95A 2P94A 1Z1IA 3MWIU 5HYOA 3CXLA 3BEIB 2UUYA 1BY2A 1AUTC 5FPSA 7GCHF 4GI3C 2JOPA 5C94A 4OGXA 2KCOA 3WW7A 2PLXA 1C2IA 5A2MH 4ZXYH 4Z1MD 3FZZA 1C2MA 5IK2D 1DUAA 1W0KD 2G5VA 4ABAA 3BV9B 2AH4X 1C2LA 5F6MA 2GKTI 1GL1A 1LVMA 2A20A 4NIVA 3TJVA 4BXWA 3QGNB 4BAOB 1TBZH 1HXFH 1YCPK 1AD8H 2GMTB 3VPKA 1GCTB 2FOAA 2XNIA 3FN8A 3H09A 2FTMA 4FU7A 1GI3A 4X8UH 4FVDA 4FXGH 2LNCA 1PQAA 2SGQI 4XSKU 1DT2A 4E1PA 1FMGA 1L4ZA 3QDZB 3FAOA 3KY9A 4K1EA 1C2JA 1C1PA 4MPWA 2BD8A 2OU2A 3VE5A 1MTUA 2VWMA 3K6ZA 3G01A 4IMQA 3LKWA 1BBRH 5TJXA 3TVJB 1PJUA 3V3MA 1Q9BA 1N6YA 1BOQA 2FXRA 2GCHG 3ZVFA 4X8TH 1WV7H 1SR5C 1AN1E 1MKWK 1NS3A 3PO1B 3A80A 1K7TA 3U8TH 4Y8XA 2F43B 2K9HA 2CXVA 5FBEA 1TGSI 1IQEA 1GHZA 1OMTA 3TK5A 2JA4A 2GMTC 1E38B 2ZFPH 1BJUA 1Y1BA 1GCTC 1XM1A 4B74A 3HGPA 1SGRE 1ZHRA 3SV7A 1ETTH 1MCTA 5AHGH 3WWBA 3ZZDA 2VWLA 1ARBA 4NWKA 4Q7XA 1MJAA 5J8CA 2BOHB 3GYMA 1BDAA 3M7TA 1P2MA 2BQWB 2NU2E 4R0IA 1PPGE 4OVOA 1P2IA 2FI5E 4NA9H 1BITA 2BD2A 3UUZA 2XW9A 4Q7YA 3SYJA 1EJAA 1ZRBA 5FPTA 2RA3A 4B1TA 2VVVA 3OX7U 2BDHA 1GI7B 2D26C 3PO1C 5FBIA 3S69A 1GDUA 3S9AA 3DCLA 1IHTH 1HAPH 1GI8B 4GLYA 1AUJA 2G51A 2QV1A 3A8CA 4BAMB 1CT4I 3URDA 4TPYA 1MBMA 4ZHLU 4YT7H 2VWNA 2GJGA 1PTQA 1A4WH 1FAKH 1G2MA 1RGQA 1GBJA 4XBBA 4AGKA 4BXSA 1UCYK 1SGDE 2JETB 1IQNA 1TBOA 1EUFA 3SZEA 5B6LA 1H8DH 3UGDA 4WMDA 1CGJE 1P2NA 1TRYA 3KQDA 5JBAS 4Y6DA 4O97A 1ABJH 5ETXA 2SGDE 2VVCA 2PTNA 4F4OC 2FWWA 2A0QB 1TX7A 2ZZUH 1QRZA 2N52A 5EX3A 2A32A 3SGQI 2AS9A 2BD3A 2IN2A 3A7VA 3PMJA 4ISNA 5KGOA 1SL3A 1OXGA 3A89A 3SUGA 1BTXA 4YTAA 1O38A 4JCVE 5FX5A 1O3LA 2OC1A 1TX8A 1QQUA 1HDTH 3RXEA 1DWBH 3S9BA 1A0LA 1AB9C 1UK2A 5ESTE 2ZU3A 2ORVA 1ZPZA 3E0PB 2RIJA 3ZZ5A 1SC8U 1L0ZA 2VB0A 1YTPA 3EA7A 3P8GA 2KCPA 2UUKB 2OC8A 2JETC 1TLDA 4D76A 2QGRA 3ZIAD 2ZO3H 2NU3I 3LGUA 4J1YA 4NCYA 1QGFA 3KQBA 4DGJA 5EW2H 1SHYA 5J8FA 3ELAH 4B6DA 4WWYA 4ISLA 4KP0A 1MQ6A 1C5OH 4E7NA 3U28C 1L1GA 2QXHA 2ZFRH 1BCUH 3TGKE 2R2WU 2AEIH 5EPYA 2BYAX 2BOKA 4UXJA 1B7XB 1AMHA 1LR9A 2RDLA 1NROH 2Y81A 2A2XH 2DE9A 4NSYA 2J9RA 1W3CA 5JBTA 2P6AC 1C1QA 3ZV9A 1AGJA 1HJ8A 1BMNH 5JYIA 1S81A 3K65B 3IWMA 2QQDA 1BMAA 3QK1A 1GGDB 1O3KA 5E0GA 3OVOA 2TGDA 1QIXB 1LHFH 4B6FA 1QHRB 2Z94A 3N7EA 5EQQA 1GJCB 2R2MB 1VDDA 4MPUA 1K22H 4UE7H 4E06H 2IJOB 1T4UH 1IQMA 3LGYA 3RXVA 1V2KT 3KHVA 2WHXA 4ZMAH 4WXIA 3R3GB 1SGFA 2A5AA 2DUCA 1QA0A 1UVSH 5H4IB 8LPRA 2BX3A 5PTPA 1KXAA 1D3DB 1YPLH 1HLTH 2WCYA 2AGEX 3A7YA 4O9VA 2F91A 2SGEE 3OXLA 3RLWH 4ABHA 3BG4B 1SGFG 1GHAF 3GDSA 1NBME 4Y8ZA 3RDZA 1S85A 5ABWA 1A5IA 1IQJA 1SSXA 1GL0E 3SNAA 2ZHQH 2V1CA 3EAJA 3PB1E 4DJZB 1BTUA 4K8YA 1HAVB 1PPZA 2GIVA 2ODPA 5K0HA 1XUFA 2ENNA 4OGYA 3P95A 1FPCH 3M37A 1W13U 3U98H 1O5EH 4F55A 5C3NA 1AO5A 1UTNA 1HPTA 3BTFE 5FXLA 2RDEA 4JZEH 1ORFA 2SNWA 2HVXA 3A85A 2SGFE 1FIWA 4CREA 3AAUA 1KBFA 3MNCA 2F3CE 3BG4C 4MTBA 3LGTA 1O2MA 5GCHG 3U8OH 1P9ZA 1DE7H 2PGBB 1O2VA 4IS5A 5E2PA 5GJ4B 1UMAH 1SHHB 3R0FA 2W7UA 4JYUH 1U6QA 1W0ZU 4Y76A 1GI4A 1GJ8B 1HB0B 4ISOA 5DP6A 2ALVA 4OS7A 1IQFA 1W8BH 1ACBE 1C1TA 3A7ZA 3ZVEA 3I29A 5DP8A 4X2YA 2WV4A 1YLNA 2FOFA 1IQGA 2OTTX 3QTOH 3S7HB 4HG6A 1BTPA 2CK3D 1Y3VA 1CT2E 2IOTA 4GCHG 1O31A 4AG2A 1Y1CA 1HDLA 3M3SA 2FYQA 2EI6A 1SGQI 1C5NH 4HI3A 2UVOA 2FLBH 2GT8A 4I32A 1E79D 1G3EA 1TPAE 3T25A 2CWGA 4E1RA 3AAVA 2BTCE 3PM3A 3QTLD 1GMCF 2H1UA 4A92A 1OYTH 1NRNH 1MUEB 5F8TA 1TB6H 5J4QA 1SGEI 2FDAA 2ZIQH 5E8EH 3K6YA 3L3TA 4OS4A 1H8HD 1A2CH 3Q76A 2NU0I 3D62A 5FPYA 1O3GA 2GCTB 1WGTA 5EQRA 1VCPA 1Y3YA 2B7DH 1YGCH 3KGPA 1O2NA 4TPIZ 2O8TA 5SGAE 2FI3E 1F0RA 5B6OA 1XUIA 3MH7A 1O2LA 2Z3DA 3VG8A 3SOSA 2ZI2H 1THSH 2KMRA 1EP6A 2Q6DA 3FP8E 4ZROA 2BHGA 5EX0A 3VB6A 3FZDA 6CHAC 3CP7A 3M3VA 3F2FA 2JH5D 2HNTC 5ESBA 4DT4A 1C1MA 1EAUA 1AWFH 3M5OA 2XBXA 5F8ZA 1RFHA 5E3QA 2XYAA 4CBOA 1A5GH 1V2UT 1QBVH 2F9VA 1ELGA 1Y59T 3PLPA 3UAIC 1CGIE 4YO9A 1ELBA 1OWEA 2C3SA 2SFAA 5EJLA 3RXIA 4AFSA 1CHOI 2AFQB 1VZQH 4OS5A 2P16A 1MJBA 1V2MT 1ZMJA 2BMGB 3HATH 2Q6FA 3SJ8A 3OY6U 2GCTC 4I86A 1UTQA 1SQRA 3OXGA 4MNVA 2XBWA 4YOIA 1BHXB 4IW4E 1EX3A 2DIPA 1G37A 2FLRH 1F92A 1HAZB 4AORA 2HPQH 1V3XA 3A7XA 2HNTF 2BD4A 3OTPA 1HRTH 2OBQA 1T7CA 3RXPA 1YP9A 1O3PB 2UWLA 5DPAA 4CRAA 1LQEA 4AYVB 2AERH 4IN2A 1BRCE 1K1LA 3VGCB 4NZQA 3GICB 2J9NA 4JZIA 1H0ZA 5DGJA 1G3DA 1TNGA 1ELFA 1FNIA 2GZ7A 4ABGA 3LONA 1VJ9U 2FOEA 3RXMA 2KM0A 3JZ1B 4Y7BA 2OLGA 4CRBA 1WTJA 4I8HA 4MNXA 3SW2B 1NRRH 3PMBB 1FX0B 5DN6D 1OWIA 4YXWD 3OAAD 2GX4A 2F9BH 1ESAA 1LTOA 2UUFB 2STBE 1SGPE 2XOKD 2GTBA 4LXBH 5CDFE 4YESB 1EAWA 3P8FA 1QJ1B 4CRFA 3OL0A 1H8ED 1XUKA 1H1BA 1V2ST 2HLDD 2NU4E 4XE4A 3DSOA 3KCGH 2ZG0H 1O2UA 1XKAC 1ZTJA 2VH0A 1C2EA 3VB4A 3NUMA 2B0FA 3VGCC 2ZFTA 1BBRK 4NIYA 2VINA 1F0TA 1P2QA 5I46H 2GGVB 2BZ6H 1CT0E 3UPEA 1CE5A 4KTCA 1YPGH 3A84A 4XDEA 2ZWLH 1OWKA 4FUDA 2OYAA 1INCA 2ERWA 4I8GA 3SU6A 4CH8B 5HXFA 1SGCA 2FNFX 1HYLA 1ELEE 1T8MA 1PPEE 1UVPA 3TO6A 1P0SH 2OTVA 1L4DA 1SOZA 1JRTA 3ATWA 1C5VA 2ZFSA 1TRNA 2ZHDA 1HAVA 3BTQE 3Q3YA 2ANYA 4RT0A 3GOXA 1K9OE 1C5WB 2BDAA 2QQEA 1G32B 1GMDG 2PSYA 1TIOA 2AIQA 5A0CA 3AK5A 4U32A 1HV7A 3U1JB 3RXUA 5C20A 1GVKB 3A88A 3RP2A 4FU8A 1GMHG 1UHBB 2H5DA 3D00A 1A3BH 4NIXA 1P09A 3PWCA 5GNDA 2GDDA 2C8XB 1GBTA 2ZDAH 2GCHF 4NGAH 3ESTA 3LDXH 5DP7A 2OCVB 4H6SB 1FLEE 1O5FL 3U69H 3BJIA 1NU9A 2NWNA 1LPKB 3TK6A 4WVPE 3QWCH 3VB5A 4AGJA 1WTGH 5EJZA 3OTJE 2N71A 1WCZA 4BANB 3SZNA 8ESTE 1FN6A 3SJKA 3BIVH 4K2YA 2C4FH 1MAXA 1O2TA 1TPOA 2WPIS 3AW0A 2YOLA 2ZU4A 5F53A 3RM0H 1TGCA 3MTYA 3SJIA 1GBCA 5CMXH 1C4U2 1DUEA 3OU0A 1RFNA 3DD2H 1DFPA 3GY2A 2P59A 4OS6A 1L1JA 4M7GA 4K69A 1AVGH 1LVOA 1VGCC 4WXVA 3HKJB 5HKKD 5DG6A 1UTLM 4DIHH 1A61H 1SLUB 1EB2A 1KMHB 3RXTA 1SBWA 3PYHA 1K7UA 1ZYOA 4BNRA 2BB4A 4A5TS 3ZZ7A 5C1UA 1O3BA 1YPJH 1D3TB 5FUWA 3NK8A 5LPRA 1YU6C 5EODA 1Y5AT 3DFJA 1LHCH 3LOXA 1A46H 2H9EH 1T8LA 1UTMA 2ZTXA 1TX6A 3RMOH 3RMLH 1SFIA 1U5KA 2ZTYA 4ASHA 4ESTE 5EJ1A 1CHOG 1B0EA 1QTFA 2LELA 2WPDD 4ABJA 3L33A 5J4SA 1EXFA 2AGGX 3TJUA 2QQ0A 2B8TA 3KIDU 2EA3A 1P10A 2AMQA 2PP6A 1ZGVA 2W7SA 3O8DA 1BUSA 1MD7A 2V53A 2Y7ZA 3PV4A 1LPZB 2H9HA 2Y6TA 4NSVA 2WYJA 4NA8A 4UFFH 3GY6A 3P70B 3PV5A 3SQHE 1EJNA 3FSYA 4YM9A 2ZTZA 1O2YA 4ZAEA 1KXBA 1ANCA 1TOCB 2ANMH 1W0JD 3U1IB 6GCHF 2RG3A 3UREA 4JK6A 1M8CA 3E16B 1TNHA 4YLUA 3T28A 1R79A 1OHHD 1KBEA 5E0HA 3A8DA 1FAXA 4Y71A 1DS2E 3RU4D 4ZKNU 1LR8A 2I6QA 2R0LA 2GZ8A 1PPHE 1ZJKA 3SNDA 3MU0A 2QYIA 3QLPH 2JXDA 3FVFB 4WMEA 1AFEH 1P2OA 2ZECA 4MNYA 2P3FH 1JMOH 4CHAC 1E34B 5JDUB 3E3TA 2QXIA 4DCDA 2A5IA 1B0FA 1FJSA 4JK5A 1OYQA 1J17T 1GI5A 4AFQA 4TYDA 2VBCA 5AF9H 2ZGBH 3FOAA 4AZ2B 4K1SA 5JPMH 2Y0MA 5K7RA 1GBKA 2ZHEH 3VB3A 1RS0A 1MZDA 4JYTA 5KECA 1P8VC 2Z9KA 1PCEA 2E73A 1TBNA 5HM2A 1HGTH 1O0DH 1Z8JB 3ZYDA 3DUXH 2ROWA 5JB8S 1HXEH 1KSNA 2ZU2A 4CH2B 1T8NA 1EPTA 1HJ9A 1M8BA 3GY7A 3URCA 1T4VH 2ZDKA 1TYNA 1BIOA 3W95A 3UQOA 1ZPCA 5EGMA 1YPMH 2WPLS 1ZSJA 2SGQE 1QCPA 4WMFA 1KLTA 7ESTE 5GXPA 1QFKH 1YPHE 3UQVA 2I6SA 2TGPZ 1FZZA 1XUJA 3M7UA 5A8YA 2ZCLP 2V1CC 2TGTA 4HGCA 1C1VH 2Z6BD 1Z7KA 1HPGA 3SU3A 3RXDA 3SNCA 1ZR0A 3CS0A 1WQVH 4ZKOU 3KQ5A 1J16A 1SGRI 4Y11E 1AY6H 1SGIB 1OWJA 1JOUB 2C8YB 3QX5H 5E2OA 2ORWA 3GS9A 4FVBA 2BDBA 5EXMA 1EP5A 2LP6A 2FOBA 1O5EL 2BZAA 2OQ5A 5HIYA 1AU8A 3PLBA 1ZHMA 5EXNA 1BRAA 3OXFA 1SB1H 1ELVA 1KDQA 1LDTT 5LPFA 1EB1H 3FO8D 4IC6A 1GBLA 3F3BA 5DP4A 2CGAA 1UHBA 3ZZ4A 4D9RA 1YC0A 2YMSB 2Y7XA 2KCAA 1V2JT 1ZOMA 2W6JD 2VWOA 3MI4A 2JYYA 1VITH 1QB1A 3PWBA 1CA8B 1G3CA 1SVPA 1C9TA 1OX1A 2EY4C 5GCHF 1ULMA 5C5OA 3UOUA 3Q77A 3RXLA 1MTNB 1ZPBA 2G4UA 3M5NA 1NO9H 4GAWA 4AOQA 1NXUA 1SGDI 2OVOA 1O3AA 1YYY1 2ODYB 5HGGA 1C5MD 4MPIA 1CGJI 1EOJA 5C5NA 1FYBA 3ENSB 2ZDMA 4TT3D 2TIOA 4PROA 2QY0B 5C0UA 5LH8A 1WU1A 1VITG 3F9FA 3MH5A 4YZUA 2G55A 1MABB 1GDQA 4L9MA 1MD8A 1A0HB 3SU0A 1PFXC 2H6MA 1F0SA 2STAE 3TJNA 2ZQ2A 2YMSC 1AZ8A 3EQ0H 2HVYB 1DM4B 2GKRI 5JBBS 4UONA 2J4IA 4GCHF 1CGHA 1GJ5H 1L1NA 3ATMA 5HQ8A 1XMNB 2WUCA 3BN9A 4AB8A 2BDIA 1ZZZA 4AX9H 3KYGA 4F49A 3SGQE 1OSSA 1CA0B 1TNKA 1TMUH 1H4WA 1JWTA 3RXQA 1K1OA 1SGNI 3RUOA 1G2LA 4F48B 3ZZ9A 4XRNA 1EFRD 4I8KA 3SHAH 1AKSA 3MNSA 1DSUA 1PQ7A 1BTHH 2WV9A 4Q80A 1TBQH 4ABIA 3E91A 1MCVA 2F9PA 2FZZA 1D6WA 3EA9A 3FP7E 4LK4A 4KGAA 4H4FA 3F2HA 2K1QA 1LKAA 4YLQH 3SUEA 1BTZA 3ZZAA 1GBAA 1HAHH 1MZAA 3RXGA 3GDUA 2E5RA 1TOTA 1O3CA 4R8TB 3K9XB 4AYYB 2ZDVH 4UFDH 2TRMA 3UNRA 2KAIA 2IPHA 1C9PA 1F7ZA 2JJ2D 1O2QA 2BD5A 1UCYE 3BF6H 2ZEBA 4CRDA 3PROA 1FV9A 1CA0C 2C8ZB 1O30A 2ZQ1A 3E90B 5EXLA 3GCTF 1K2I1 2LUYA 1W7GH 1MTSA 3MYWA 1P3EA 1FY4A 3MO9A 1GJAB 1ETSH 2L8EA 3MQKC 2UZ3A 1KTSB 2GDEH 2A7CA 3NWUA 2K8IA 1TNIA 2ZFQH 2ZC9H 5GIBA 2TBSA 2ZU1A 1Y8TA 4CR5A 3TK9A 3RU0A 3K2UA 1TBRR 1GI0A 3QZRA 2PUXB 4M9FA 4FUJA 2H5CA 3BG8A 1Z8GA 1YLCA 1HCGA 1LQDB 3GDVA 4ZHAA 3V13A 2G8TA 4K5ZA 2SGEI 1ELCA 1W7XH 1W3SA 4O03A 3TOAA 1AZZA 2Y5GA 1XA6A 1X4SA 2ZKSA 2J2UA 3U9AH 5DAEA 1GJDB 3HK3B 3ZZ8A 2RFKC 3PTBA 2L74A 5CHAB 1Y3XA 5FUYA 1ID5H 1GGDC 1SFQB 2B9LA 2OP9A 2ZCKP 3F9HA 1GJ4H 1O3DA 4RI0A 3ZVDA 2QE7D 1Y3UA 1PYTC 3BTEE 3HH2C 4FUHA 5FAHA 1DDJA 3UIRA 4MPVA 1DY8A 3UGIA 2ENZA 4X8SH 5T6FA 1BRBE 1UTPA 2W0TA 4IN1A 1FY5A 1J8AA 1BJVA 1KYNA 3MH4A 1W0YH 1UK3A 2A4RA 1V1HA 1BA8B 5JB9S 1N13A 3RXFA 2A5KA 9WGAA 2YNBA 1P04A 4Q7ZA 2JA1A 1IW4A 2F3CI 1PPCE 2WPMS 2WZQA 3KYFA 3UB0A 2BLOA 1FUJA 1UTJA 1WSSH 1XX9A 5CHAC 4BAHB 4RSPA 2CWHA 1LVYA 1BMMH 1OWDA 1QR3E 1BTYA 1GHXH 4Z6AH 1TIHA 2XCNA 3H7OA 1H9LB 4WY3A 1O2WA 8GCHG 1UTOA 2PGQB 2D1JA 3SBKA 1V2LT 1GHBG 2XRCA 3MU4A 5TCCA 2AMPA 3TNTA 1SG8B 2XC5A 1GBHA 1O2RA 5CHBA 4HGUA 4GVUA 5L30H 1C5YB 5DKMA 3AASA 3B4VC 1O2GH 3MU8A 5DSFA 1CT2I 3VFEA 2XWAA 4MPXA 1G36A 2GD4B 3KNXA 1NFYA 1QL7A 1IQIA 3QAHA 1GBEA 4NA7A 2UWPA 4K1TA 4X6NA 2OK5A 1UW7A 2Z3EA 1MMJN 1HUTH 2C90B 2SGAA 1OP0A 2WSSD 1S0RA 3RC4A 1GMHF 4B2CA 4K8BA 4UFEH 2HLCA 1HEVA 1O5BB 4NFFA 3ATKA 1WBGB 2Z9LA 3WY8A 1YBWA 2PV9B 5C17A 2QA9E 2ZFFH 4YOJA 1V2VT 3GCNA 2Z9JA 6LPRA 2GVIA 3BTWE 1FN8A 1EZQA 4IC5A 1C5UA 1AE8H 1ZHPA 3NZIA 2H9TH 3B8JA 4MDSA 4Y79A 3V12A 1HIAA 1SGEE 1SGTA 1NU7B 3LJJA 3V7TA 4OS1A 2GP9B 1LMWB 3M35A 3UWIA 3W1EA 2WGCA 3UGLA 1E37B 1P06A 4FUIA 2YQPA 2NU0E 5LPEA 4TWYA 3SGAE 2KFWA 1L2EA 4FU9A 1AQ7A 3F9EA 4JZFH 4A6LA 2AGIX 4X1RU 5EPNA 2BQ7B 1SQTA 2CF8H 1TPPA 4HZHA 1WDIA 2EEKA 2AMDA 1NTPA 1O2SA 4E7RG 3GISB 5KEDA 2ELIA 1ETRH 3STIA 4BTTB 4O3TA 2B0UC 2HNTE 4MNWA 2NU1I 4I8LA 4A24A 4ZXXH 5A8ZA 1FAQA 3UOPA 2G4TA 9LPRA 4BAKB 1F2SE 4I31A 1C1RA 4I8JA 5JFBA 1QY6A 2A7JA 1P03A 3RU4E 3T62A 3H7TA 5E0JA 4SGBE 1T31A 2F9UA 2HOBA 2QCYA 2F4LA 1UVTH 1Q31A 2WPJS 2KMQA 1CHOF 2A31A 3UR9A 1GJ6A 3E8LA 5AFZH 1TGBA 4X6MA 1DSTA 2VIPA 3F2GA 1GPZA 2O8MA 1TALA 5AFYH 5F03A 4DIIH 2TGAA 1JBUH 4ABEA 1LR7A 1O3NA 4DVAU 3GCHB 1EASA 3TH4H 5HM9A 2WV5A 4JYVH 1O3JA 3ZVGA 4CR9A 1OYVI 2Y5FA 2GV6A 2FTLE 4B71A 1WQSA 1MJ9A 1GHAG 2UUJB 1GBFA 1QB6A 1D3QB 1QL8A 9ESTA 1SGPI 1JIRA 1Z8IB 2HRVA 2ZGJA 4TWWA 2R3YA 1D4PB 1DOJA 1EPTB 3D23A 4ZH8A 1QB9A 4HTCH 3OEED 3LH3A 1ZMNA 3MO6A 2ZCHP 3LT3A 2WYGA 1P02A 1UVGA 4J2YB 3ZZBA 2ALPA 1SQOA 1TE0A 4B76A 4VGCB 1TURA 1K1NA 1SOTA 1VJAU 2V3HH 1RD3B 1E1QD 3UFFA 1CT0I 2ASUB 1SGYE 1G9IE 1SLVB 5JBCS 2ZGXH 2V3OH 3GCHC 3W94A 1BHXF 2ZNKH 2VRWB 2A4OA 1Z7KB 3SJ9A 3GYLB 3NPSA 1O3HA 1S6HA 3OFND 1DX5M 4P02A 4DOQA 2SGPE 1PPFE 2QF4A 2J38A 1TWXB 3TOBA 3CNRA 1EPTC 1A1RA 1N1LA 2ANKH 2M5TA 4ISIH 1CHGA 3IG6B 3DSGA 3GY3A 1CSOI 1QA7A 1HFDA 5A8XA 3C27B 1G30B 1O39A 1KDQB 2ZPRA 3CENA 2PQ8A 3HGNA 1AFQB 4VGCC 2JDID 3TJOA 2PR3A 2WUBA 1ZJDA 2GT7A 2W6ID 2KCXA 1BQYA 3ZV8A 4GUXA 1MU8B 1YY3A 7LPRA 1W11U 2VGCB 1V2TT 1IY5A 4I33A 2ULLA 3ZZ6A 2CN0H 6ESTA 3S9CA 1O2HA 1N8OB 3D49H 5DJ7A 2N1AB 1LKBA 4AG1A 3F1SB 4WF8A 3U8RH 1GCDA 2XWBI 1BBRE 3A87A 1NC6A 1QNJA 1TGNA 2QF5A 1ZRKA 2OXSA 5T6DA 1R0RI 1A7SA 2B5TB 5T1VA 3LGVA 3EE7A 4ABDA 1WUNH 3RC5A 1DPOA 2VIQA 1GI9B 3SEKC 1WYKA 3LGWA 1AFQC 4ACBA 3PTNA 2FIRH 1HBTH 1C1OA 2SNVA 2BVSH 3SGBI 2YUUA 2GKVE 1V2PT 1CBWB 4UXIA 1Z1JA 4Y10E 1UO6A 3KQEA 3OE7D 5A0AE 3MU5A 5C67A 3EYDA 5C0TA 5A0BA 4TY6A 3RU4T 2XC4A 1C2DA 3A7WA 1MQ5A 1BT7A 2BY9X 1KY9A 3E0NB 1FY1A 1TGTA 1FY3A 4B2AA 2C8WB 1AKSB 1MU6B 2JIZD 1EATA 1XKBC 4JZ1A 1DXWA 5CCMA 1KTTB 2J34A 1X7AC 1UJ1A 2FESH 3A86A 2BDYA 1DWDH 1K1MA 3UEJA 4GHQA 1MH0A 1NESE 3MNBA 1NM6A 1QBNA 2P93A 2VJ1A 4D7FA 1V1IA 3H5CB 3MHWU 4ACAA 1CBWC 2KAIB 2L6OA 4IGDA 5FHTA 1EZXC 3M5MA 3TGIE 2QQCA 2BY8X 1VITF 2CF9H 2QF0A 4SGAE 1IQKA 1C1SA 1YPEH 5EIYA 3B9FH 2FEQH 2PWXA 3RM2H 4ZKSU 1GI2A 4D9QA 1F0UA 2XC0A 1AVWA 1FPHH 4INKA 3SU2A 2O8UA 3T27A 2R9PA 2VH6A 2ZHFH 3C1KA 4AB9A 3L6PA 2JH6D 2W3KA 1M9UA 4A1VA 2JW6A 4AFZA 1H9IE 3GCOA 3DA9B 1TMTH 1ZLRA 2KZ4A 1DS2I 2BUSA 3SUFA 2D8WA 1WKXA 3PMHB 1RRKA 3EA8A 3OEHD 4DURA 3O8RA 3UR6A 2LPRA 5DP3A 2UWOA 1W4RA 1C5TA 2FMJA 4MVNA 4RT1A 2WPKS 4O3UA 1AHTH 2JP0A 3SJOA 3QWPA 4OM9A 1CE3A 1CU1A 4XD7D 4X1PU 3ODDA 3ZZ3A 1C2KA 1C1UH 2ILNA 4TY7A 1O2JA 2HWLB 5DK1A 3A8AA 3TPIZ 1BTWA 1A3EH 1NFWA 3VXEH 1DANH 3VDPA 4AC9A 3IITA 4RKOB 2C93B 2FO9A 1O5DH 1ABIH 3B23B 3WWFA 1NY22 1P3CA 3R5DA 3TU7H 1BMOA 4DW2U 2XNDD 1DLKB 4KTUA 2R0KA 4UXHA 4ZUHA 1DWCH 1ELTA 1WOFA 2A4GA 2P8OB 3P8NA 2HALA 1FIZA 1GHVH 1PPBH 2WVJA 2QAAA 1E0FD 3LC3A 3NRLA 5CE1A 4UFGH 2LB7A 3Q3XA 2M5XA 5CCLA 5HI7A 4OS2A 4MQAA 2VNTA 2J94A 2HGTH 2Z9GA 1AN1I 2W5EA 2GZ9A 1WAYB 4K60A 1YPHC 5DP9A 3A83A 1K21H 3SNBA 1P05A 1HAYB 1TRMA 4NWLA 1S83A 4X2VA 3RXHA 3SNEA 1ELDE 1C1NA 1E36B 4ISHH 2FOGA 4BTIB 2XXLA 1SPJA 3F9GA 1D6RA 1QQ4A 2CV3A 1CVWH 3SI3H 1GG6B 2B8OH 4ZKRU 1AE5A 3FANA 2QXJA 4DNCA 1GHYH 3TJQA 1DWEH 5C1YA 1KLJH 3UNSA 1CO7E 4B6EA 3MFJA 1C5SA 2P8OC 2QIQA 4NZLA 1SQAA 3SO3A 2NU2I 1MKXH 4FKDA 4I7YH 4FOUC 1C5QA 3NXPA 1O5GH 3BTGE 2BLVA 1X74A 1EAIA 2JZMA 1O3EA 1O5FH 1YPKH 2ODQA 3A81A 3OYPA 2X52A 3QZQA 1K1PA 4FUFA 1ELAA 2ZA5A 2ZPQA 1V2RT 4MLFB 4B2BA 3UFAA 1GI6A 3QN7A 2FM2A 1ZSKA 1TONA 1TQ0B 2GKVA 7WGAA 1O33A 4H42U 2V6NA 2EC9H 5LGOA 2L7XA 1GBMA 1GG6C 1Q2WA 3SV9A 3KEEA 3E2IA 2BLWA 1P9SA 2XBVA 1MT1A 3F68H 1C4Y2 1W10U 1F5KU 1ZGIA 4TSFD 1C2GA 2Y80A 1BUIA 2FODA 1ANEA 1HIAB 2KMPA 3SHCH 3MNXA 3TO9A 1AB9B 1CT4E 8GCHF 2SGDI 3R5CA 3STJA 4GHTA 3KQCA 4IMZA 1GHWH 1GHBF 4BTUB 1J14A 4XBDA 3QUMP 5T3HA 5GPIB 3ZYEA 4MG3A 4D8NA 1HNEE 1IOEA 1DS3I 4X0WU 1W12U 4CRCA 1XXDA 2W3IA 2A7HA 1RTLA 2KCYA 5T6GA 4UEHH 4Q4LA 1TABE 1PTRA 3QO6A 1ULNA 1QRWA 1TAWA 3T26A 1TA6A 1W2KH 1THRH 2CWFA 1K1IA 4NG9H 1VKYA 1EOLA 1GBDA 1MTNC 1D9IA 5FUXA 3RXCA 1KXDA 1O2KA 1S6FA 1NN6A 5FCRA 1WXRA 1Y5BT 1D3PB 1YWUA 1UUCA 4LZ1H 2FYRA 2Z3CA 1Y5UT 2ANWA 1RTKA 6GCHG 1SGNE 4UD9H 4AN7A 3MH6A 5E3RA 2O8WA 1KXEA 2NU3E 4ZHMU 1MTVA 7GCHG 1NFXA 1P01A 1IQLA 5I25A 1NT1A 4JZDH 1HAIH 4GPGA 1KXCA 1QL9A 1ZTKA 1GVLA 3ZVCA 1BZXE 5EW1H 3LIWA 3TH3H 4U01A 3FSXA 4LOYH 3SU4A 3M36A 2AHME 4FUGA 3RXBA 4FUEA 1GBIA 1O3MA 4Y0YE 1LCYA 1KLIH 1SMFE 1P11E 1BMFD 4WH8A 1GWAA 4ZCNA 3UNQA 4KELA 1FXYA 1UHAA 2IPQX 3RXSA 1TMBH 1TA2A 1YF4A 2GV7A 5EOKA 5A09A 1GI1A 2OC0A 3E59A 1NRPH 4IBLH 1P57B 1V2QT 3N99A 2YNAA 3O8BA 1FONA 3E6PH 4X2WA 1S5SA 1VCQA 5BPEA 3PV2A 1OPHB 1OMUA 4XFQA 4A1TA 1JXPA 2ZU5A 3I78A 1J9CH 3S0NA 1TUSA 1TNJA 1O2OA 1XVMA 2KMOA 1PQ5A 2BQ6B 1OP2A 1O2XA 3Q00A 5C1XA 1ULKA 1C5RA 2AIPA 2DKVA 3A82A 1B5GH 2ESTE 3D65E 2BDGA 2ZGCA 3RMMH 2OINA 3GOVB 3BTDE 3NKKA 1ZMLA 3GY5A 1OP8A 2Z9IA 4Y8YA 1H8IH 1S82A 1BRUP 1YCPH 1YM0A 2Q6GA 2DE8A 1DXPA 3NCLA 2BXTH 3SU5A 1DICA 2P3UB 1FY7A 1TPSA 1RTFB 2V35A 1KMAA 1RJXB 1ZTLA 3M3TA 4KKDA 2SGFI 3OSYA 1NPMA 2LEOA 3P8OA 5L2ZH 2WINI 3F0PA 3UOEA 2A1DB 4YT6H 3SORA 2ZDLA 3RLYH 4H6TA 2V0BA 1VCWA 1EJMA 1O37A 3ATLA 3RXOA 2ZP0H 2QPOA 2Q1JA 4A1XA 5G4BA 1IQHA 4INLA 1MKWH 5JHWC 3VDUA 2BLQA 2PKSB 1THPB 3FP6E 4JCNA 5HIZA 5FCKA 2J87A 3RXJA 1O36A 5GDSH 2O9QA 3RXAA 2O8LA 2RC4A 1AVXA 2JJ1D 4LZ4B 1GVZA 3ZZCA 2PKAB 1XUHA 1A5HA 2CMYA 1N6XA 2P95A 1O2IA 2OC7A 2J5UA 2RA0A 1GMDF 1MAYA 3BTME 1SI5H 3DHKH 3SV8A 5F8XA 2Y5HA 3N7OA 4CBNA 1GDNA 1BMLA 2H2ZA 4XOJA 2FX4A 5FUVA 1EQ9A 2JH0D 2QN5T 2BM2A 3P17H 4GSOA 4Y7AA 2BY6X 5EU8A 3HKIB 1NFUA 1H9HE 1FDPA 2Y82A 2ZDNA 1ARCA 1SGQE 2OBOA 2VIOA 4HFPB 3BEUA 2W26A 3LH1A 1ZSLA 4JMYA 2PKSC 4XBCA 3SN8A 2ZPSA 2BVXH 2FPZA 1YCPM 2G00A 4BOHA 2CHAB 2G52A 6CHAB 1ANDA 4K3JA 2ODDA 3P6ZB 2AYWA 1WGCA 2CJSC 1FQ3A 1QRXA 3HPTB 1O35A 3EDXB 3LU9B 1TNLA 2F9OA 3MO3A 3MMGA 2GVFA 1NRQH 4D7GA 1LHGH 1QURH 1TOMH 2BD9A 3TH2H 1NUBA 1F5LA 1EAXA 1UCYH 3UY9A 2J97A 4ABBA 1OWHA 1YLDA 3RXRA 1MBQA 3TNSA 1XX6A 3BTKE 2XCFA 1CGII 1SLWB 1C5ZB 3DT0H 1K0HA 1HAXB 4ABFA 1W14U 1OKXA 7KMEH 2YMSD 1ANBA 3GY8A 1O5CB 4NFEA 1XBTA 1A0JA 2CHAC 2J98B 1O32A 3FKSD 1EZSC 4BAQB 2FS8A 3GCTG 1G3BA 4X1SU 2FI4E 1O2ZA 2A4QA 1C1WH 1TQ7B 1AWHB 1UVUH 1S6LA 3DFLA 2QXGA 3SI4H 2THFB 3T29A 1EZUC 3PRBA 2A45B 3PDNA 4SGBI 2FOCA 3R5BA 1E35B 3M61U 3DSPA 2NU1E 4QT8C 3ZVBA 1RIWB 2QF3A 3E1XB 3V0XA 1T8OA 3TIUA 1P2KA 3N7DA 1O2PA 2J92A 1LO6A 1CQQA 1FI8A 1V6DA 2VU8E 4DY7B 4X8VH 1C5PA 2XBYA 5FL7D 2OY3A 2BX4A 1GJBB 2V7QD 2PTCE 3LJOA 2V3MA 2PHBA 3EE0B 3BIUH 1DLEA 3T2NA 2DB6A 2G81E 3BTTE 2KR7A 1Z2IA 2NU4I 3EGKH 2FOHA 2Z7FE 1S0QA 2FP7B 1RIWC 1P57A 2A2QH 1OS8A 2BXUH 2WPHS 1O34A 2F9NA 1C5LH 3SQEE 1P9GA 1SGYI 4P00A 4E05H 3F6UH 2N17A 2ZHWH 2ZGHA 1QBOA 4FUCA 1IAUA 1HAOH 5GWZA 1V2NT 4DG4A 1GJ9B 1DY9A 4FETA 3HK6B 2SGPI 3MU1A 1PPFI 1LHEH 3BEFB 1WTHD 1COWD 3A8BA 5E3PA 1IHSH 1P9UA 1UK4A 8KME2 4KTSA 3KN2A 3T5FH 3PLKA 3UEYA 2FOMB 1C2FA 1J15A 2F83A 1ESBA 1LPGB 3RMNH 1NBMD 4RN6A 1LHDH 1PJPA 4WP4A 1MKXK 4RKJB 1C2HA 3TO7A 1DITH 2X3TA 3FFGA 4AFUA 3RXKA 1AIXH 2FX6A 1P12E 1HJAB 2CJIA 1PYTD 1LVBA 1OVOA 3CS7A 1XVOA 4X6OA 2JKHA 3KF2A 4Q2KA 3SUDA 1O3OA 2IJD1 1Z8RA 3ODFA 4DT7B 1CSOE 3P92A 3PMAB 1XXFA 1DVAH 4UDWH 3VXFH 1NRSH 2RCEA 3LGIA 1FARA 3OY5U 4X1QU 3KL6A 1TFXA 1TBQR 1C4V2 1GMCG 2G5NA 3TGJE 2EQNA 2PUQH 2P3TB 1TGSZ 1UTKA 5FX6A 3FC3A 4X6PA 5L6NH 1O5AB 1V2WT 1TBRH 3GY4A 1QJ6B 1PQ8A 1VGCB 1SKYE 4Y0ZE 4Z0KA 1ESTA 4WJG2 2EI8A 3UTUH 1EKBB 4NIWA 1HJAC 1Y3WA 1HJAI 1HAGE 2PKAA 2TPIZ 2XTTB 1Q3XA 5AVDA 1FY8E 3QGJA 3R5AA 2BY7X 2VGCC 1UVOA 1K1JA 1MTWA 4U30A 2EI7A 2OQUA 4FUBA 3JZ2B 1N8OC 3PRDA 3BTHE 3TITA 2VVUA 2PSXA 5IDKA 1O3IA 4ASUD 3VEQB 1K28D 3M7QA 1VR1H 1Z6JH 3UWJH 5L2YH 3BSQA 5EQSA 3SGBE 3S7KB 4B73A 3MEKA 5IYTA 1JIMA 3I77A 1XUGA 4B75A 3SV6A 1O3FA 2BY5X 1NZQH 2VIDA 5DO4H 2OUAA 3M5LA 1BB0B 3SU1A 1KXFA 4A7IB 3VB7A 4AMLA 3MOCA 2PW8H 3A7TA 3TLOA 1F5RA 4U2WA 3RC6A 4X1NU 2QC2A 3AW1A 1GBBA 3Q3KA 4INHA 1YKTA 1OOKB 2R3UA 1E1RD 3ITIA 1QJ7B 2BVRH 3LC5A 1Y8FA 1C5XB 5DP5A 1Z71A 2PFEA 2BDCA 2BD7A 5EG4A 2HPPH 1SLXB 2VIWA 4CRGA 1JRSA 3F0OA 1S84A 4YOGA 3ZVAA 1UVFA 1KIGH 2FS9A
chains in the Genus database with same CATH topology
5C2ZA 2OD3B 1Z6EA 5BRRE 2D2DA 1P2JA 4WH6A 4X2XA 1AI8H 5HMAA 1V2OT 4THNH 4CHAB 3SV2H 1RXPA 2ARPF 1GJ7B 2ZF0H 3O8CA 2VIVA 1T32A 3AVZA 3QTVH 5TCAA 3LPRA 1IY6A 3ATIA 2OD1A 2J95A 2P94A 1Z1IA 3MWIU 5HYOA 3CXLA 3BEIB 2UUYA 1BY2A 1AUTC 5FPSA 7GCHF 4GI3C 2JOPA 4OGXA 2PLXA 1C2IA 5A2MH 4ZXYH 3FZZA 1C2MA 1DUAA 2G5VA 4ABAA 3BV9B 2AH4X 1C2LA 5F6MA 2GKTI 1GL1A 1LVMA 2A20A 4NIVA 3TJVA 4BXWA 3QGNB 4BAOB 1TBZH 1HXFH 1YCPK 1AD8H 2GMTB 3VPKA 1GCTB 2FOAA 2XNIA 4FU7A 2FTMA 1GI3A 4X8UH 4FVDA 4FXGH 2LNCA 1PQAA 2SGQI 4XSKU 1DT2A 4E1PA 1FMGA 1L4ZA 3QDZB 3FAOA 3KY9A 4K1EA 1C2JA 1C1PA 4MPWA 2BD8A 3VE5A 1MTUA 2VWMA 3K6ZA 3G01A 4IMQA 3LKWA 1BBRH 5TJXA 3TVJB 1PJUA 3V3MA 1N6YA 1BOQA 2FXRA 2GCHG 3ZVFA 4X8TH 1WV7H 1SR5C 1AN1E 1MKWK 1NS3A 3PO1B 3A80A 3U8TH 4Y8XA 2K9HA 2CXVA 5FBEA 1TGSI 1IQEA 1GHZA 1OMTA 3TK5A 2JA4A 2GMTC 1E38B 2ZFPH 1BJUA 1Y1BA 1GCTC 1XM1A 4B74A 3HGPA 1SGRE 1ZHRA 3SV7A 1ETTH 1MCTA 5AHGH 3ZZDA 2VWLA 1ARBA 4NWKA 4Q7XA 2BOHB 3GYMA 1BDAA 3M7TA 1P2MA 2BQWB 2NU2E 4R0IA 1PPGE 4OVOA 1P2IA 2FI5E 4NA9H 1BITA 2BD2A 3UUZA 2XW9A 4Q7YA 1EJAA 1ZRBA 5FPTA 2RA3A 4B1TA 2VVVA 3OX7U 2BDHA 1GI7B 2D26C 3PO1C 5FBIA 3S69A 1GDUA 3S9AA 1IHTH 1HAPH 1GI8B 4GLYA 1AUJA 2G51A 2QV1A 3A8CA 4BAMB 1CT4I 3URDA 4TPYA 1MBMA 4ZHLU 4YT7H 2VWNA 1PTQA 1A4WH 1FAKH 1G2MA 1RGQA 1GBJA 4XBBA 4AGKA 4BXSA 1UCYK 1SGDE 2JETB 1IQNA 1TBOA 1EUFA 1H8DH 3UGDA 4WMDA 1CGJE 1P2NA 1TRYA 3KQDA 5JBAS 4Y6DA 4O97A 1ABJH 5ETXA 2SGDE 2VVCA 2PTNA 4F4OC 2FWWA 2A0QB 1TX7A 2ZZUH 1QRZA 2N52A 5EX3A 2A32A 3SGQI 2AS9A 2BD3A 2IN2A 3A7VA 3PMJA 4ISNA 1SL3A 1OXGA 3A89A 3SUGA 1BTXA 4YTAA 1O38A 4JCVE 5FX5A 1O3LA 2OC1A 1TX8A 1QQUA 1HDTH 3RXEA 1DWBH 3S9BA 1A0LA 1AB9C 1UK2A 5ESTE 2ZU3A 2ORVA 1ZPZA 3E0PB 3ZZ5A 1SC8U 1L0ZA 2VB0A 1YTPA 3EA7A 3P8GA 2UUKB 2OC8A 2JETC 1TLDA 4D76A 2QGRA 2ZO3H 2NU3I 3LGUA 4J1YA 4NCYA 1QGFA 3KQBA 4DGJA 5EW2H 1SHYA 3ELAH 4B6DA 4WWYA 4ISLA 4KP0A 1MQ6A 1C5OH 4E7NA 1L1GA 2QXHA 2ZFRH 1BCUH 3TGKE 2R2WU 2AEIH 5EPYA 2BYAX 2BOKA 4UXJA 1B7XB 1AMHA 1LR9A 2RDLA 1NROH 2Y81A 2A2XH 2DE9A 4NSYA 2J9RA 1W3CA 5JBTA 2P6AC 1C1QA 3ZV9A 1AGJA 1HJ8A 1BMNH 5JYIA 1S81A 3K65B 3IWMA 2QQDA 1BMAA 3QK1A 1GGDB 1O3KA 5E0GA 3OVOA 2TGDA 1QIXB 1LHFH 1QHRB 2Z94A 5EQQA 1GJCB 2R2MB 1VDDA 4MPUA 1K22H 4UE7H 4E06H 2IJOB 1T4UH 1IQMA 3LGYA 3RXVA 1V2KT 3KHVA 4ZMAH 4WXIA 3R3GB 1SGFA 2A5AA 1QA0A 1UVSH 2DUCA 5H4IB 8LPRA 2BX3A 5PTPA 1KXAA 1D3DB 1YPLH 1HLTH 2WCYA 2AGEX 3A7YA 4O9VA 2F91A 2SGEE 3OXLA 3RLWH 4ABHA 3BG4B 1SGFG 1GHAF 3GDSA 3RDZA 4Y8ZA 1S85A 5ABWA 1A5IA 1IQJA 1SSXA 1GL0E 3SNAA 2ZHQH 2V1CA 3EAJA 3PB1E 4DJZB 1BTUA 4K8YA 1HAVB 1PPZA 2ODPA 5K0HA 1XUFA 2ENNA 4OGYA 3P95A 1FPCH 3M37A 1W13U 3U98H 1O5EH 5C3NA 1AO5A 1UTNA 1HPTA 3BTFE 5FXLA 4JZEH 1ORFA 2SNWA 2HVXA 3A85A 2SGFE 1FIWA 4CREA 3AAUA 1KBFA 3MNCA 2F3CE 3BG4C 4MTBA 3LGTA 1O2MA 5GCHG 3U8OH 1DE7H 2PGBB 1O2VA 4IS5A 5E2PA 5GJ4B 1UMAH 1SHHB 3R0FA 2W7UA 4JYUH 1U6QA 1W0ZU 4Y76A 1GI4A 1GJ8B 1HB0B 4ISOA 5DP6A 2ALVA 4OS7A 1IQFA 1W8BH 1ACBE 1C1TA 3A7ZA 3ZVEA 3I29A 5DP8A 4X2YA 2WV4A 2FOFA 1IQGA 2OTTX 3QTOH 3S7HB 1BTPA 1Y3VA 1CT2E 2IOTA 4GCHG 1O31A 4AG2A 1Y1CA 1HDLA 3M3SA 2FYQA 2EI6A 1SGQI 1C5NH 4HI3A 2FLBH 2GT8A 4I32A 1G3EA 1TPAE 3T25A 4E1RA 3AAVA 2BTCE 3PM3A 3QTLD 1GMCF 2H1UA 4A92A 1OYTH 1NRNH 1MUEB 5F8TA 1TB6H 5J4QA 1SGEI 2FDAA 2ZIQH 5E8EH 3K6YA 3L3TA 4OS4A 1A2CH 3Q76A 2NU0I 3D62A 5FPYA 1O3GA 2GCTB 5EQRA 1VCPA 1Y3YA 2B7DH 1YGCH 3KGPA 1O2NA 4TPIZ 2O8TA 5SGAE 2FI3E 1F0RA 5B6OA 1XUIA 3MH7A 1O2LA 2Z3DA 3SOSA 2ZI2H 1THSH 2KMRA 1EP6A 2Q6DA 3FP8E 4ZROA 2BHGA 5EX0A 3VB6A 3FZDA 6CHAC 3CP7A 3M3VA 2JH5D 2HNTC 5ESBA 1C1MA 1EAUA 1AWFH 3M5OA 2XBXA 5F8ZA 1RFHA 2XYAA 4CBOA 1A5GH 1V2UT 1QBVH 2F9VA 1ELGA 1Y59T 3PLPA 1CGIE 4YO9A 1ELBA 1OWEA 2C3SA 2SFAA 3RXIA 4AFSA 1CHOI 2AFQB 1VZQH 4OS5A 2P16A 1V2MT 1ZMJA 2BMGB 3HATH 2Q6FA 3SJ8A 3OY6U 2GCTC 3OXGA 1UTQA 4MNVA 2XBWA 4YOIA 1BHXB 4IW4E 1EX3A 2DIPA 1G37A 2FLRH 1F92A 1HAZB 4AORA 2HPQH 1V3XA 3A7XA 2HNTF 2BD4A 1HRTH 2OBQA 1T7CA 3RXPA 1YP9A 1O3PB 2UWLA 5DPAA 4CRAA 1LQEA 4AYVB 2AERH 4IN2A 1BRCE 1K1LA 3VGCB 4NZQA 3GICB 2J9NA 4JZIA 1H0ZA 5DGJA 1G3DA 1TNGA 1ELFA 1FNIA 2GZ7A 4ABGA 3LONA 1VJ9U 2FOEA 3RXMA 3JZ1B 4Y7BA 2OLGA 4CRBA 4I8HA 4MNXA 3SW2B 1NRRH 3PMBB 1OWIA 2GX4A 2F9BH 1ESAA 1LTOA 2UUFB 2STBE 1SGPE 4LXBH 2GTBA 4YESB 1EAWA 3P8FA 1QJ1B 4CRFA 3OL0A 1XUKA 1H1BA 1V2ST 2NU4E 4XE4A 3KCGH 2ZG0H 1O2UA 1XKAC 1ZTJA 2VH0A 1C2EA 3VB4A 3NUMA 2B0FA 3VGCC 2ZFTA 1BBRK 4NIYA 2VINA 1F0TA 1P2QA 5I46H 2GGVB 2BZ6H 1CT0E 3UPEA 1CE5A 4KTCA 1YPGH 3A84A 4XDEA 2ZWLH 1OWKA 4FUDA 2OYAA 1INCA 2ERWA 4I8GA 3SU6A 4CH8B 5HXFA 1SGCA 2FNFX 1HYLA 1ELEE 1T8MA 1PPEE 1UVPA 1P0SH 2OTVA 1L4DA 1SOZA 1JRTA 3ATWA 1C5VA 2ZFSA 1TRNA 2ZHDA 1HAVA 3BTQE 3Q3YA 2ANYA 3GOXA 1K9OE 1C5WB 2BDAA 2QQEA 1G32B 1GMDG 2PSYA 1TIOA 2AIQA 5A0CA 4U32A 1HV7A 3U1JB 3RXUA 5C20A 1GVKB 3A88A 3RP2A 4FU8A 1GMHG 1UHBB 2H5DA 3D00A 1A3BH 4NIXA 1P09A 3PWCA 2GDDA 2C8XB 1GBTA 2ZDAH 2GCHF 4NGAH 3ESTA 3LDXH 5DP7A 2OCVB 4H6SB 1FLEE 1O5FL 3U69H 3BJIA 1NU9A 2NWNA 1LPKB 3TK6A 4WVPE 3QWCH 3VB5A 4AGJA 1WTGH 3OTJE 2N71A 1WCZA 4BANB 3SZNA 8ESTE 1FN6A 3SJKA 3BIVH 4K2YA 2C4FH 1MAXA 1O2TA 1TPOA 2WPIS 3AW0A 2YOLA 2ZU4A 3RM0H 1TGCA 3MTYA 3SJIA 1GBCA 5CMXH 1C4U2 1DUEA 3OU0A 1RFNA 3DD2H 1DFPA 3GY2A 2P59A 4OS6A 1L1JA 4M7GA 4K69A