5CE1A

Crystal structure of serine protease hepsin in complex with inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
Knots found
sequence length
369
structure length
361
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASGLQLGVQAVVYHGGYLPFRPNSENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease hepsin
publication title Crystal Structure of Serine protease Hepsin in complex with Inhibitor
rcsb
source organism Homo sapiens
total genus 93
structure length 361
sequence length 369
other databases KnotProt 2.0: S -31
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 5ce1A01
3GDUA 3QUMP 4FXGH 4FUBA 4XDEA 4ABAA 1GDNA 2BY7X 4E7RG 3NK8A 1S85A 3QN7A 2ZNKH 1LTOA 5GXPA 2VGCB 1S6FA 2Y6TA 4NSVA 1GBFA 2FPZA 3RU4E 1Z8IB 1TALA 1XUHA 1C5WB 4ASHA 2H9HA 1EZQA 2OQ5A 2GZ8A 3I29A 1ZPCA 2PSYA 3C1KA 1C5XB 1P2JA 1TGNA 2AGEX 1GJDB 4BANB 4D9QA 1HJAB 1O2NA 1GCTB 4JCNA 1ABJH 5GJ4B 1TPOA 1V2JT 1YCPK 1KY9A 3M3VA 1P2OA 1CBWB 3IG6B 4Q80A 1GMHF 1HIAB 2CGAA 4NIYA 1O2OA 4B76A 3UNSA 2PTNA 1QA7A 3U9AH 3D62A 2P8OC 3FZZA 4ESTE 3UUZA 1INCA 1HLTH 1RD3B 2ZGXH 5L2ZH 1XXFA 2WPKS 1EASA 1FN8A 4FUHA 3HK6B 1HXFH 1YCPM 2BD9A 1QQUA 2G5NA 2F9VA 1ELAA 1DX5M 2BD2A 4MPWA 1PYTC 1H4WA 1Z1IA 2ALPA 3M61U 2PGQB 4X1NU 3MO6A 1K1LA 1GJBB 1KXCA 3ESTA 2Z7FE 1HAZB 3ZZBA 4K1SA 2HGTH 3TVJB 2G55A 1C5PA 1O2SA 4I7YH 2OCVB 1V2OT 2IPHA 4XSKU 2J9NA 1QHRB 1O5DH 1C2MA 2XC5A 1THSH 2IOTA 1LMWB 2QCYA 4NWLA 1MD8A 4DIHH 1RGQA 4NZQA 5C5NA 1UCYK 1JMOH 1BHXF 2FI5E 5ABWA 1V3XA 2ZP0H 1NFUA 4NFFA 1H9IE 1S5SA 2UWOA 3M5LA 5EW2H 1EKBB 4X6MA 1S0QA 1C4Y2 1GBHA 1KXBA 1C5SA 4ABJA 3SU3A 5T6FA 1A1RA 1Z8JB 1K1MA 1QB9A 1OWHA 1JRTA 2D1JA 3BTME 3BEIB 1N1LA 3UOUA 2GT8A 2XXLA 3D23A 3JZ2B 1GMDG 1O2KA 3HATH 3P70B 2P3TB 3F9EA 2W3IA 4Y7AA 4I8LA 1O3EA 5EQRA 4IBLH 4ZHAA 1VCPA 3S69A 1CHOF 3LJJA 3ZZDA 3CS0A 2Y80A 1GI9B 1LQDB 4E7NA 2A5KA 3GCTG 3OU0A 3R0FA 1G3EA 1DY8A 4MDSA 2ZFPH 2H5DA 1YYY1 1IQKA 4OS5A 3AW1A 2FDAA 1SLWB 2ZGCA 8GCHG 1TMBH 3E90B 2ZFFH 1C4U2 1PPZA 1BRAA 2A4RA 1BMMH 3DD2H 2HOBA 4FU7A 3PO1B 3SNAA 3LJOA 3T27A 1UK3A 1WQSA 2D2DA 1E34B 1GJ4H 2ZDNA 4FU9A 2G5VA 2HALA 3UR9A 1C2KA 3SORA 5J4SA 2AGGX 3QWCH 8ESTE 4CBOA 1Q3XA 2FESH 1KXFA 4WF8A 1RTKA 4GCHF 2ZHFH 2A5IA 4K3JA 1A7SA 3UIRA 2SGAA 1P8VC 3K2UA 2ZFRH 3MNCA 1S81A 4DVAU 4K60A 2ULLA 2TGDA 1EPTC 5EOKA 3QGNB 2ODPA 4I8KA 3FP7E 3M7UA 1O3KA 2FOFA 1DWDH 1DOJA 1P9SA 1WYKA 2FIRH 3M7QA 4KTCA 1ELFA 3EDXB 1U6QA 2FOBA 2Z9JA 1Y5AT 1IQIA 4WH6A 3SUFA 3S7HB 3VB3A 1NN6A 1LPZB 1ESTA 2OTTX 3ATIA 1ORFA 3PV4A 3Q3XA 3LGVA 3MO3A 1DLKB 1PYTD 1O3CA 3RMMH 1GBCA 4YOGA 1A2CH 1ELEE 1Y3YA 4ABIA 4OGXA 3NZIA 1MTSA 1YLDA 5A0BA 1UTOA 1TNHA 2V3HH 4YOJA 3KCGH 1C2FA 1QL8A 3P95A 2Q1JA 1T32A 1GBDA 2WYGA 4WH8A 1FAKH 1AHTH 2W7UA 1RFNA 1F0RA 3SNBA 1Z8GA 3PLBA 2A5AA 1OOKB 6GCHF 1XVMA 2AH4X 4JZFH 3EQ0H 2ZFTA 3GCOA 1EJNA 2GMTC 3MMGA 4ZAEA 4ABHA 3S7KB 1LKAA 2LPRA 1SGQE 2TGAA 1YBWA 1TQ7B 1CA0C 4ISHH 2O8WA 2OXSA 3OX7U 2C93B 1GCTC 3SUGA 1KYNA 1PPGE 1D9IA 4A7IB 4CR9A 1AVGH 2J92A 4WJG2 8LPRA 4AB9A 3ODFA 4AX9H 3LGUA 1V6DA 2G00A 3MYWA 3U69H 1MKWH 1CHGA 3VPKA 4IC6A 1ZJKA 1SOZA 1W7XH 1MMJN 2Z9KA 1UTNA 4GHTA 3A7WA 1MUEB 1O2MA 1FY1A 1WOFA 1ZTJA 5EXNA 2BY6X 2FOMB 1ZHPA 2ALVA 3A7YA 2XBXA 3MH7A 5CHAC 1GBKA 4UFGH 3RXSA 1GG6C 1UHBA 4AFSA 1K1OA 1DXWA 2OY3A 1O37A 5TCCA 2A7HA 1OXGA 2FI3E 1SMFE 1O2HA 4TPYA 1C5NH 1O3PB 3LONA 4YESB 1BRUP 2ZWLH 1QTFA 2JH0D 1NRQH 2KAIB 3UPEA 1AZ8A 2TRMA 4X2XA 1DM4B 3B23B 3FP6E 4FUFA 1VGCC 1CE5A 1YPMH 3HGPA 3IITA 3D49H 3LGTA 1GMHG 3ATKA 4X2YA 3RC5A 1NT1A 5A2MH 4VGCB 4AGKA 1V2QT 1TMUH 1QBOA 1ZRBA 3GDVA 1GGDB 3RLWH 2R3YA 2C8XB 3PLPA 1PQ7A 5SGAE 3SUDA 1FLEE 1QURH 3SNEA 4UDWH 4MNWA 1EXFA 1H9HE 2SGQE 1HAOH 1TBZH 3V0XA 1TNJA 2D26C 2P59A 2GP9B 4K5ZA 3VGCC 2QF3A 2BZ6H 3BTTE 4ABEA 2AIPA 1P10A 3C27B 2QV1A 3OY6U 2OP9A 3E1XB 4BTTB 1GBEA 7GCHF 1TONA 1EAIA 3T5FH 1TPAE 1O3DA 3GDSA 1WBGB 1F7ZA 3M5OA 1GHWH 3U1JB 5I46H 1SGDE 2BLOA 2VIQA 1CT0E 2QXHA 1W3CA 1NRSH 1F0UA 4GPGA 3QLPH 3A85A 1AFQB 5EW1H 1DY9A 1GI0A 4ZXYH 2JP0A 1O2IA 1RS0A 3QK1A 4Y76A 1B0FA 1BZXE 2GGVB 1NPMA 2QA9E 2W7SA 2OTVA 2H6MA 2ZGJA 5J4QA 4X2WA 1VITF 2FI4E 6CHAB 2JH5D 1IQHA 2B7DH 1K1IA 1VZQH 3Q3KA 1FNIA 1GBLA 2XC4A 3UOPA 4NWKA 1AD8H 3RXAA 1HAXB 1P12E 5DKMA 4X1QU 1O3JA 4Y71A 4UE7H 2FX6A 5K0HA 2ZO3H 1XKAC 2FTMA 3RXBA 4BNRA 4AN7A 1BCUH 1XUIA 1O2ZA 2ZHEH 2DE9A 1WCZA 1ZSKA 2XCFA 2FOGA 4ISIH 1KDQA 1F0TA 1ZGVA 2Z9LA 1MKXK 2GV6A 2AERH 3BG4B 1ZTKA 3RXEA 3DHKH 4Y0YE 1TQ0B 3RXKA 4CR5A 1MAXA 9LPRA 3VEQB 2B0FA 5T3HA 5JB8S 3CP7A 2OC1A 2PW8H 4UFFH 1N6YA 1Z8RA 3RXVA 3OYPA 1BITA 2WPJS 2CMYA 1Z71A 3MNBA 1IQNA 2ZIQH 1QCPA 1O2YA 4SGAE 1GJAB 2AGIX 2FOAA 1P2MA 3TITA 1HAHH 2ZHWH 3SV7A 1YF4A 2R9PA 1K1PA 1OWEA 1QJ7B 3RLYH 2GCHG 3UQOA 1BUIA 1L4ZA 2Z94A 1QFKH 1ANDA 1G30B 1C1VH 1H1BA 1SR5C 2GD4B 1RIWB 2PV9B 9ESTA 1HAVA 5ETXA 1Y8TA 1G3DA 3BV9B 4WY3A 1MTUA 1Z7KA 3MWIU 4IMZA 2HNTF 4CRGA 5FBEA 4DIIH 1NC6A 1K28D 1HNEE 3SGQE 3SOSA 1GHBF 1KLJH 2WINI 1AUJA 2BTCE 1KXEA 2BY5X 2CF9H 3DT0H 3GCHB 1QRXA 2H1UA 1JXPA 1UMAH 3LDXH 4KTUA 2BQ6B 3GY7A 1E37B 3SO3A 3O8DA 3H7OA 5JBCS 1C5YB 2PFEA 1MQ6A 4TWYA 3GCNA 1QBNA 2VB0A 1XUFA 1LO6A 2DE8A 4PROA 1GMCG 1TIOA 1JIMA 3MTYA 2VJ1A 1C2HA 1CQQA 1YPLH 4YZUA 1ELDE 1UTPA 1NRNH 1SOTA 1W11U 5JFBA 2PKAA 3B9FH 4X0WU 1HAYB 3KEEA 4NA9H 1BTUA 1PPHE 1O5EL 3M3SA 2VIOA 1IQGA 3TPIZ 2VU8E 1P57B 5H4IB 1OP8A 1QL7A 1XUKA 1YPKH 5DJ7A 1CSOE 3LGWA 2GCTB 1TRMA 1GHAF 1PQAA 3FZDA 1OWKA 1DT2A 2R0KA 3O8RA 1C2JA 1XVOA 1BT7A 4RN6A 3W94A 1F0SA 3MFJA 4MTBA 4A5TS 2VVCA 2I6QA 1A5GH 3TNSA 4AFUA 3MH4A 4O97A 5EPNA 2PLXA 1BIOA 5G4BA 1C2DA 5EGMA 2BDYA 4VGCC 5BPEA 4ZHMU 2FOHA 1MTWA 4WMDA 5JBBS 2J38A 2PKSC 1V2VT 1TX6A 2JA4A 1GGDC 1NZQH 1SQAA 4I33A 4Q2KA 1S6HA 3PROA 3RXHA 4LZ4B 1O3FA 1TAWA 1UVSH 4WVPE 4AGJA 1V2KT 2H9TH 4QT8C 1YPHC 1HIAA 2TGTA 5IDKA 1DWBH 2BX3A 3PYHA 4RKJB 4XBDA 2HPPH 4MLFB 2OYAA 2GZ9A 2HNTC 2OD3B 3TJNA 2RA3A 2BZAA 1KLTA 3A8DA 3O8CA 5JPMH 2WPLS 2YNBA 1THRH 1SLUB 1FV9A 2STBE 3P8OA 1W7GH 2PUXB 1DVAH 3BTKE 1ETTH 2BOKA 2CF8H 4FUJA 1AY6H 5LGOA 3KQDA 3MU4A 1P03A 5DP4A 2XBVA 3F9FA 4I32A 3ZVFA 4B73A 4DW2U 3AAVA 1GHVH 1YP9A 2ZDKA 1EZUC 4Y7BA 3T2NA 1SGYE 1B0EA 4AG1A 1W12U 1O3HA 1F5KU 1G2MA 3STIA 4UD9H 1YC0A 5A8XA 3A84A 1O2RA 1Y59T 1AO5A 5I25A 5A8YA 1BB0B 1FY8E 1Z6EA 1FY3A 1GI3A 1N6XA 1WU1A 1UVUH 1W8BH 1ARBA 4GVUA 4ABDA 1DSUA 2OINA 2J94A 2BM2A 4I31A 1ZZZA 1TNGA 2SNVA 3S0NA 3U98H 3ZZ3A 3VB6A 1KSNA 2A7CA 1A4WH 2XW9A 1EZXC 1TB6H 1NTPA 2WUBA 1BTHH 1GI7B 3RXPA 4JMYA 3S9CA 2ODQA 2BDIA 1E38B 5GCHG 2HLCA 3P17H 2EA3A 3URDA 4JZ1A 4Z0KA 1TOMH 3MNXA 5HYOA 3A7TA 7GCHG 2QF0A 2WUCA 1O2VA 4ABFA 3ZVCA 1O38A 1V2ST 4X6PA 4ABBA 1EP6A 2O9QA 3I78A 1C1PA 1FY5A 3A7XA 1C5VA 1PQ8A 1TBRH 1C5UA 1Q2WA 1G37A 1TGSZ 1W0YH 1V2LT 2YOLA 3ATWA 1BBRH 3L6PA 1C2LA 4AZ2B 3F68H 4O03A 1NFWA 1MU6B 1UK4A 1YGCH 1P04A 1C1OA 5AHGH 1BY2A 3VXEH 3BF6H 2VIPA 3ODDA 3PTBA 3TK9A 4HI3A 3UREA 2Y81A 2YNAA 5LPRA 5C1YA 1BBRE 2QY0B 2FEQH 3FP8E 2WPMS 2ZHQH 1C5QA 1QRWA 1OP0A 3ZZAA 4CHAC 4IMQA 3TK6A 1IQLA 2W26A 2NU0E 1OWDA 2PUQH 2V6NA 5FHTA 2F83A 1WTHD 3DFJA 3PWBA 2GX4A 1UJ1A 6ESTA 1KXAA 4X6OA 4XBCA 5AFYH 3DFLA 5HM9A 4NIVA 1HAPH 2UUYA 1O5CB 2ZGHA 5TCAA 1G9IE 3SU0A 1FUJA 1E0FD 1HUTH 3SNDA 5L6NH 1O3LA 1Y3XA 1JBUH 1H8IH 5FAHA 3LC3A 3HKIB 3BN9A 3AASA 1MBMA 1P2NA 2JETC 2ZGBH 1BMNH 1AVXA 2W3KA 2ZQ1A 1W14U 2SGPE 3EA8A 4OGYA 2OUAA 3K6ZA 2BY8X 1J14A 1O39A 2F91A 1GHZA 1F5RA 1G32B 2GDDA 1O5GH 2O8UA 2PGBB 1OPHB 1J9CH 2CHAC 3QTVH 1P06A 5LPFA 4BAKB 3SQHE 2R2MB 1CU1A 4IN1A 2FO9A 3PMJA 2ZKSA 4Q7YA 1O2TA 4H42U 1ELBA 3M7TA 3HPTB 1L1NA 3OTJE 5EU8A 2Z9IA 5BRRE 4DY7B 1TX8A 4YT6H 3P92A 4TY7A 2ZFQH 1N8OC 4AYYB 3RP2A 4KKDA 4FU8A 3ZZ9A 1MTNC 1VITH 1MAYA 1MQ5A 2VH6A 3TH4H 5FCKA 1GI2A 1O3OA 4DG4A 3HK3B 3KN2A 4OS7A 3GISB 1P05A 4LK4A 1ESAA 3HKJB 4UFDH 3VFEA 4JK6A 4UEHH 1HGTH 1C9PA 4B75A 4MPUA 2F9OA 3M37A 2P16A 1CGJE 1S82A 2BY9X 1AU8A 4NSYA 4X1PU 1XXDA 2XRCA 3SU4A 1UTJA 4WXVA 1GI8B 4INKA 1HPGA 1C5MD 3K6YA 3RC4A 3RXIA 7ESTE 1GBBA 1C2IA 2VGCC 1HJ8A 5A0CA 2VNTA 4WXIA 1T4UH 2B8OH 1OSSA 4CBNA 2BD7A 1TNLA 5FX6A 1HAGE 2ANKH 4J1YA 1GI4A 4DT7B 4FVDA 4NG9H 3TJUA 2Y5HA 4JYTA 1M9UA 1K2I1 2Z6BD 3BIVH 3SV9A 1QJ6B 1HJAC 2ANYA 1ELGA 1S84A 2BXUH 3ZZ8A 3SI3H 2ZZUH 2EC9H 5DP6A 3A82A 1CBWC 3N7OA 3GICB 4B71A 1C1SA 3NKKA 2RDLA 2ZHDA 4A6LA 1SHHB 3ELAH 1L2EA 3A8AA 5DP3A 1H8DH 2TBSA 2ZU4A 3QDZB 1HDTH 4NZLA 2XBYA 1OWJA 3M36A 1C1MA 1LPGB 1AFEH 1ZMLA 4D8NA 2KAIA 1AB9B 2ZG0H 2BVSH 1MU8B 3V12A 2QYIA 1LPKB 3L3TA 1ETSH 1T31A 1S0RA 2GTBA 2DUCA 5E8EH 1OP2A 4K69A 3UTUH 3PMHB 1A5IA 2NU1E 4Q7ZA 3T25A 3BTGE 2HWLB 3MI4A 3UR6A 4BAHB 5FPTA 4CRBA 2A4GA 3V7TA 1YPHE 4ISNA 4X6NA 1SGFG 1O2PA 1ZTLA 3PTNA 1O5FH 5C5OA 1EOLA 2A32A 2HNTE 3PM3A 1TLDA 5AF9H 1GI5A 1GHXH 1RTFB 3NUMA 1O33A 3K9XB 3LIWA 3LU9B 2AEIH 3GYLB 2FYQA 2SGFE 3T62A 2Q6GA 2RG3A 1UHBB 1GVKB 2A1DB 2G4TA 2Y7ZA 1V2RT 1A0HB 4FUIA 1C2EA 3W95A 3TGKE 3RXRA 4ZHLU 1SQTA 3VXFH 1ABIH 2VVVA 3A88A 4U01A 1SGNE 1F92A 1GBIA 4NA7A 2I6SA 1SC8U 3FVFB 2P3FH 5FPYA 1NRRH 3ZVAA 5T6DA 2BD8A 1BTPA 1NU9A 1ELVA 2P3UB 1LDTT 4K1TA 4NGAH 3PMBB 5F6MA 1TRYA 1LHCH 1ETRH 2QC2A 4X8VH 3MH5A 2ZTYA 4JZEH 3A80A 1UTLM 3G01A 2BDHA 1UK2A 2FX4A 2HRVA 1GBMA 3SU1A 4K2YA 2H5CA 1C2GA 1THPB 3T29A 3TLOA 1ZSLA 1C1UH 2O8TA 1ZRKA 1WTGH 5DPAA 1QB1A 1EUFA 3LT3A 5EODA 1C5TA 2J95A 1HV7A 1ZLRA 2VH0A 1RJXB 2ZC9H 1YKTA 4B2CA 1TPPA 3RXDA 2QGRA 3PO1C 4ZKRU 1AI8H 3E91A 2SNWA 4DCDA 3MNSA 2P8OB 2GDEH 1PQ5A 1TBQH 2C90B 5JDUB 1PFXC 1QBVH 2NU3E 2STAE 2C4FH 2ANWA 1C1QA 2ZU2A 1C5LH 2ASUB 4HTCH 2UUFB 2P93A 5EPYA 2A4OA 3LC5A 2EI6A 3P8FA 2XCNA 2GKVE 1SGEE 4Y10E 3E16B 4A1VA 2QXIA 2ZEBA 4DJZB 4DOQA 1O3AA 2FLBH 1GMDF 4CH8B 3RXQA 1OX1A 2SGDE 1CHOG 1QGFA 3EA9A 4FUDA 1DS2E 5ESBA 2CV3A 1ZSJA 4NA8A 1BTZA 3ITIA 3KF2A 3KQEA 1EAWA 4TY6A 3SV6A 4AYVB 5A09A 3GY4A 1CT2E 2BLWA 3GCTF 5JBAS 1O2XA 2FP7B 3EGKH 2Y5GA 5FXLA 3QGJA 1RXPA 1SGRE 1FJSA 7LPRA 4Y8ZA 3RUOA 3GY3A 1NFYA 3A87A 1LVOA 2CXVA 4ZUHA 1AZZA 3NWUA 4ZKOU 2ZCHP 8GCHF 1EX3A 5DGJA 1KIGH 4FUEA 4RKOB 6LPRA 1O35A 2NWNA 2GZ7A 5DG6A 4BAQB 2G52A 1HB0B 3ZVBA 2VIDA 4ABGA 3BEFB 5DP5A 1C1TA 2M5TA 4H6TA 2ZCKP 1Y5UT 4GCHG 1QIXB 1ZYOA 1TOCB 3VB5A 1ELCA 2OC7A 5C20A 2FODA 2ZU3A 2IN2A 1LHDH 1ESBA 2OC8A 3KGPA 1O3IA 1QR3E 1SGPE 1IQFA 5L2YH 1VJ9U 1TABE 1FAXA 2HVXA 1C5OH 4E06H 1LVYA 1XX9A 5HMAA 3MU8A 1GWAA 1ZJDA 2ZF0H 4OS6A 4A1XA 1C1WH 1CA8B 2K1QA 1IHTH 2Q6FA 5AFZH 4E05H 1O2WA 3Q77A 1QRZA 3URCA 2GT7A 3RC6A 3LPRA 1UO6A 2ZPQA 2PR3A 2OBOA 5JBTA 3SV2H 1P57A 4AOQA 3BIUH 1WAYB 1GBAA 1CVWH 1QA0A 3ZZ6A 1NROH 2ZDLA 4MPVA 3AAUA 1AKSB 1BA8B 1CT4E 4X8TH 1BRCE 1PPCE 2B5TB 3UNQA 3ZZ4A 3A7ZA 5E2PA 4DURA 1UVTH 1ZMNA 1PJPA 2R0LA 4GHQA 3UQVA 2ZI2H 3RMLH 4YLQH 6GCHG 1HYLA 1S83A 1A46H 1FONA 4FUCA 2FOCA 4F4OC 3A7VA 1NY22 3UY9A 4X8UH 4BTIB 1EJMA 1J17T 5F8TA 2CN0H 3BTQE 4AB8A 4A92A 1YCPH 1TGBA 3SJIA 3TK5A 1QB6A 1EPTB 3GOVB 4BXSA 1V2MT 1Y5BT 2A45B 1BHXB 4JZDH 1X7AC 1TWXB 3GY2A 3BTFE 3TIUA 1TMTH 2WYJA 2BMGB 2G8TA 4A1TA 2PKAB 1NU7B 1B7XB 1MH0A 3NCLA 5IYTA 3RM2H 5CE1A 1C5ZB 1J8AA 1SFQB 1TX7A 3T28A 1E35B 1RRKA 2AMQA 1GJ9B 1ACBE 1D4PB 1GL1A 4D76A 1HAIH 4AG2A 2SFAA 1P01A 1FN6A 2EEKA 4X1RU 4K1EA 3GYMA 1KLIH 3LGIA 1JWTA 3KIDU 2Y5FA 4ZROA 1BTXA 2Q6DA 2Z3CA 5HM2A 1SI5H 1O3NA 1O3BA 2UUKB 1L1GA 4ZKNU 3A89A 1J15A 2OLGA 3TJOA 1IOEA 1FI8A 1YPEH 1ZMJA 1EB2A 2GMTB 5T6GA 1UTMA 4ZXXH 1UCYH 3CS7A 1W13U 1CA0B 2FLRH 3ATMA 4OS2A 1B5GH 4Y79A 5C67A 3PLKA 2AMDA 1FIWA 1BMAA 2WV5A 4FUGA 1AFQC 4NIWA 3OSYA 3SJKA 3SUEA 5K7RA 1TPSA 4I8GA 4XE4A 1UCYE 3OY5U 4YTAA 5L30H 3KQBA 4R0IA 2F3CE 3HGNA 2WPIS 4GUXA 4O9VA 5HXFA 2BB4A 1P2QA 6CHAC 3SJ8A 2FZZA 3MU0A 3DA9B 2QN5T 4I8HA 4D9RA 1K1NA 3A8CA 3S9AA 3F9HA 4ISLA 5ESTE 2ZDVH 1DFPA 1SHYA 1FXYA 5CHAB 1FIZA 5JYIA 3U8OH 3VB7A 3SQEE 1GG6B 1P09A 1P2IA 1O31A 1Z1JA 2Z3EA 3E0NB 4B2AA 4HGCA 1GPZA 4UONA 1MZDA 4H6SB 1OYTH 3UNRA 3MO9A 2XBWA 3KNXA 4TWWA 1L1JA 1QQ4A 2THFB 1MZAA 3SGBE 1AMHA 1EATA 2VWOA 3BG4C 1JIRA 3Q3YA 2XYAA 2IJOB 2ZDAH 1WV7H 4X8SH 4CH2B 1VGCB 1GL0E 2A4QA 5F8XA 1XUGA 3TU7H 5C1XA 3BEUA 3U8RH 1TNKA 3SW2B 1VCWA 1HXEH 2AFQB 2OBQA 4INHA 1YM0A 1QL9A 8KME2 1NS3A 1C1NA 1A5HA 1O2QA 1VITG 2BQWB 1O5FL 1O2JA 3LKWA 1KTTB 3E8LA 5B6OA 3RMNH 1G3BA 1T8NA 2PTCE 1EOJA 1O0DH 3WY8A 2TPIZ 1BTYA 2ZCLP 3ZVGA 1BJUA 1RIWC 1BOQA 1E36B 4IS5A 3RM0H 3VGCB 2R2WU 1HCGA 1V2UT 4MPXA 2BD5A 2VIVA 3Q76A 4U2WA 4F49A 4Y6DA 1SLVB 2WV4A 1FPHH 3ZYEA 2TGPZ 1MD7A 3GCHC 3SGAE 2XWBI 3ZVDA 5E2OA 1DWCH 4JYVH 4J2YB 2XC0A 1SSXA 2ZPRA 4TYDA 4JZIA 1BDAA 4CRAA 4Z6AH 2ZPSA 4Y0ZE 1FZZA 1WQVH 3F9GA 4O3TA 1D3DB 1GHYH 1FMGA 5FBIA 1O5EH 5DO4H 2W5EA 1LCYA 3LH3A 4KTSA 2BHGA 3EYDA 3UWIA 1DE7H 1TYNA 4IGDA 4BAMB 1BMLA 1UVOA 1V2NT 4CRFA 1K22H 1BBRK 5EQSA 1KXDA 3TGIE 2ODYB 4B1TA 4OS4A 4YLUA 3RDZA 4LZ1H 1GJ5H 4ZKSU 1SG8B 3RXUA 1EP5A 3AVZA 5DP9A 1SB1H 2GCHF 1AIXH 1HBTH 3IWMA 1Y3UA 4XBBA 2BD4A 3P8NA 2GCTC 5EG4A 1GHBG 2Y82A 5C3NA 2Z9GA 1O3MA 1T8LA 1LKBA 1HFDA 2QAAA 3SZNA 3S9BA 3A83A 2A2XH 5DP7A 3SU5A 3QO6A 4Y11E 4YM9A 3FAOA 3RU4T 1EB1H 1DSTA 4NIXA 1GCDA 2PWXA 1WUNH 3BTWE 3V13A 3TGJE 2F9NA 2F9PA 1ID5H 2UUJB 2FOEA 3BTEE 3SN8A 3TH3H 3SV8A 1J16A 5E0JA 3I77A 3RXCA 5F03A 4GLYA 3RMOH 5FCRA 4U30A 5GIBA 1KTSB 2BDCA 4M7GA 3ATLA 3FFGA 1SBWA 2V3OH 2ZECA 1GMCF 3SNCA 2TIOA 1AE8H 2B9LA 2C8YB 2WPHS 1UTQA 4H4FA 5AVDA 2G51A 1TGTA 4FVBA 3A81A 1K1JA 3SBKA 2A7JA 3EE0B 1VJAU 1CGHA 1GJ6A 3QX5H 5DP8A 1GVLA 1ANCA 4K8BA 2FWWA 1O32A 1Z6JH 1ZHRA 2RA0A 2BYAX 3F6UH 4NCYA 1GHAG 2BDBA 3F1SB 2VINA 3KQCA 5C2ZA 1AN1E 4O3UA 3GY5A 3B8JA 3Q00A 1SVPA 5PTPA 2FS9A 5TJXA 2JKHA 3KL6A 3M5MA 3T26A 2BLQA 5A0AE 2F9BH 4OS1A 2BVXH 1ARCA 4YO9A 1NRPH 1OKXA 1GJ7B 2FYRA 1UTKA 5CMXH 1SGCA 1O3GA 2JOPA 3JZ1B 1IQMA 2GVFA 3ZYDA 2UWPA 3SJOA 3GY8A 3RXGA 3MU5A 1K21H 4K8YA 1DANH 1Q31A 5HGGA 3MOCA 1T8MA 4AFQA 1C4V2 1L4DA 1P11E 3H5CB 4Q7XA 3P6ZB 3TH2H 1SQOA 1ELTA 2F9UA 2QXGA 5LH8A 1JRSA 2QXJA 3CENA 2R3UA 3QZQA 3R3GB 2P94A 4ZMAH 1GI1A 1SPJA 4ISOA 1MBQA 1A3EH 1HJ9A 2ZFSA 1T7CA 3K65B 3QTOH 2H9EH 3ZVEA 3H7TA 5EQQA 3UFAA 4ZH8A 1O2LA 2EI8A 3EAJA 1C9TA 1HRTH 3RXFA 2ZA5A 1NO9H 3SU2A 1FQ3A 1RTLA 1SL3A 1MCTA 1P3CA 3AW0A 4BTUB 1O2GH 1O2UA 2AIQA 1OS8A 1LVBA 1DLEA 3NXPA 5F8ZA 4BXWA 1V2WT 2FTLE 1EAXA 1T4VH 2J2UA 2EI7A 1TA6A 1EJAA 1LVMA 4KP0A 1MKWK 7KMEH 2VWNA 2ZTXA 4BAOB 1F2SE 1VR1H 1ANBA 2PKSB 1GBJA 1TFXA 1ZPBA 5DK1A 1P02A 1NESE 1G36A 1GBTA 3KHVA 2FS8A 3NPSA 4I8JA 3ENSB 1CO7E 1ANEA 5GPIB 2G4UA 1O5AB 2RCEA 2BVRH 3A8BA 1DUAA 1AE5A 1ZPZA 1T8OA 3RXTA 1DWEH 1WSSH 3RXLA 1D3QB 1MKXH 2H2ZA 2ZQ2A 1H9LB 3L33A 2BXTH 2VIWA 2V0BA 3MU1A 1K9OE 5JB9S 2BLVA 5GCHF 2V35A 1XKBC 3M35A 1TRNA 3QZRA 1P2KA 1D6WA 2BX4A 1XUJA 2PHBA 4HFPB 1Y3WA 3ZZ7A 1A3BH 4WWYA 3MH6A 4INLA 2PSXA 3RXOA 3ZZ5A 1BTWA 1NFXA 2FM2A 3BG8A 4GAWA 1EQ9A 1O36A 2ZDMA 1F5LA 2GV7A 2P95A 1MTVA 2UWLA 4MG3A 1AVWA 1FDPA 2G81E 1TNIA 5E0HA 5GDSH 2QIQA 1P9UA 2XNIA 4MNVA 1LHGH 1GVZA 4MNYA 1SGTA 4CRCA 3PMAB 1AWFH 4YT7H 1G3CA 3TJVA 1AWHB 4B2BA 3BTHE 2AS9A 4AFZA 4LXBH 4KELA 2BDAA 1OYQA 4U32A 3BSQA 2O8LA 5GWZA 4TPIZ 3LH1A 4X1SU 1JOUB 3SHAH 4MNXA 2OC0A 4IN2A 1IQJA 2LNCA 1TE0A 2BOHB 4CRDA 2HPQH 1D3PB 1XM1A 5EXMA 3ZZCA 1LQEA 5EXLA 1GDQA 1QNJA 3PB1E 3ZV9A 2NU2E 2BD3A 2ILNA 1ZOMA 3RU4D 3MHWU 1Y3VA 1GDUA 3PWCA 3U8TH 2Z3DA 4X2VA 1SGFA 5FPSA 4D7FA 1PPBH 1TA2A 3LGYA 1KDQB 1DPOA 1BJVA 1LHFH 1DUEA 1PPFE 2BDGA 4HZHA 5E0GA 1DICA 4THNH 3SHCH 4Y8XA 3E3TA 1MCVA 2J34A 2ESTE 4R8TB 3A86A 1DDJA 4IC5A 1LHEH 1XMNB 3LOXA 1G2LA 1ZHMA 2ZU5A 1OWIA 5A8ZA 1IQEA 4MVNA 1V2TT 2VVUA 1C5RA 2Y7XA 2C8ZB 4B74A 4SGBE 1PPEE 1V2PT 2XTTB 4CHAB 1AQ7A 1GI6A 2ZU1A 3ZV8A 1BQYA 3RXJA 1IAUA 3RXMA 1AKSA 3O8BA 2A2QH 4JYUH 4BOHA 2ZTZA 1FPCH 1DITH 1QY6A 2FMJA 2VWMA 4JK5A 1O5BB 1SFIA 1HAVB 2A0QB 1AB9C 1EAUA 3TNTA 3SJ9A 3V3MA 4Y8YA 4DGJA 1YPGH 1SLXB 3GY6A 1EPTA 1TGCA 2JETB 4WMEA 1W10U 2AYWA 2ANMH 3SU6A 1D3TB 2VWLA 4YOIA 1EZSC 4KGAA 4UFEH 1ZGIA 1SGIB 1DXPA 4NFEA 3FANA 1FY4A 1IHSH 1W2KH 4D7GA 1GJCB 1YLCA 1YPJH 4WMFA 4XOJA 2CHAB 5C1UA 4LOYH 3VB4A 1L0ZA 1A0JA 1O30A 4MQAA 3E0PB 2NU4E 4IW4E 2JH6D 2CJIA 4GSOA 3P8GA 3M3TA 1QJ1B 5LPEA 3D65E 1C1RA 2C8WB 1UVPA 1ZR0A 1W0ZU 1A61H 1P3EA 2A31A 3STJA 1A0LA 1D6RA 2OQUA 1N8OB 4RSPA 4XFQA 3DUXH 5FX5A 4AORA 4CREA 3U1IB 1GJ8B 1MTNB 2XWAA 2BQ7B 1AUTC 1P0SH 2O8MA 1CGIE 3M5NA 1AGJA 3EA7A 3BTDE 1NM6A 3UWJH 2D8WA 2FXRA 2C3SA 2SGEE 1VCQA 2AMPA 3E6PH 1BRBE 1O34A 2J4IA 3SI4H
chains in the Genus database with same CATH superfamily
3GDUA 3QUMP 4FXGH 4FUBA 4XDEA 4ABAA 1GDNA 2BY7X 4E7RG 3NK8A 1S85A 3QN7A 2ZNKH 1LTOA 5GXPA 2VGCB 1S6FA 2Y6TA 4NSVA 1GBFA 2FPZA 3RU4E 1Z8IB 1TALA 1XUHA 1C5WB 4ASHA 2H9HA 1EZQA 4F55A 2OQ5A 2GZ8A 3I29A 1ZPCA 2PSYA 3C1KA 1C5XB 1P2JA 1TGNA 2AGEX 1GJDB 4BANB 4D9QA 1HJAB 1O2NA 1GCTB 4JCNA 1ABJH 5GJ4B 1TPOA 1V2JT 1YCPK 1KY9A 3M3VA 1P2OA 1CBWB 3IG6B 4Q80A 1GMHF 1HIAB 2CGAA 4NIYA 1O2OA 4B76A 3UNSA 2PTNA 1QA7A 3U9AH 3D62A 2P8OC 3FZZA 4ESTE 3UUZA 1INCA 1HLTH 1RD3B 2ZGXH 5L2ZH 4XRNA 1XXFA 2WPKS 1EASA 1FN8A 4FUHA 3HK6B 1HXFH 1YCPM 2BD9A 1QQUA 2G5NA 2F9VA 1ELAA 1DX5M 2BD2A 4MPWA 1PYTC 1H4WA 4P00A 3DSGA 1Z1IA 2ALPA 3M61U 2PGQB 4X1NU 3MO6A 1K1LA 1GJBB 1KXCA 3ESTA 5EJ1A 5C0TA 2Z7FE 1HAZB 5HIYA 3ZZBA 4K1SA 2HGTH 3TVJB 2G55A 1C5PA 1O2SA 4I7YH 2OCVB 1V2OT 2IPHA 4XSKU 2J9NA 3UB0A 1QHRB 1O5DH 1C2MA 2XC5A 1THSH 2KM0A 2IOTA 1LMWB 2QCYA 2F4LA 4NWLA 1MD8A 1W0JD 4DIHH 1RGQA 4NZQA 5C5NA 1UCYK 1JMOH 1BHXF 2FI5E 5ABWA 1V3XA 2ZP0H 1NFUA 4NFFA 1H9IE 1S5SA 2UWOA 2RFKC 3M5LA 5EW2H 1EKBB 4X6MA 1S0QA 1C4Y2 1GBHA 1KXBA 1C5SA 4ABJA 3SU3A 5T6FA 1A1RA 1Z8JB 1K1MA 1QB9A 1OWHA 1JRTA 2D1JA 3BTME 3BEIB 1W0KD 1N1LA 3UOUA 2GT8A 2XXLA 3D23A 3JZ2B 1GMDG 1O2KA 3HATH 3P70B 2P3TB 3F9EA 4M9FA 2W3IA 4Y7AA 4I8LA 1O3EA 5EQRA 4IBLH 4ZHAA 1VCPA 3OAAD 3S69A 1CHOF 3LJJA 3ZZDA 3CS0A 2Y80A 3EE7A 1GI9B 1LQDB 4E7NA 2A5KA 1H8ED 3GCTG 3OU0A 3R0FA 1G3EA 1YLNA 1DY8A 4MDSA 2ZFPH 2H5DA 1YYY1 1IQKA 4OS5A 3AW1A 2FDAA 1SLWB 2ZGCA 8GCHG 1TMBH 3E90B 2ZFFH 1C4U2 1PPZA 1BRAA 2A4RA 1BMMH 3DD2H 2HOBA 4FU7A 1S6LA 3PO1B 3SNAA 3LJOA 3F2GA 3T27A 1UK3A 1WQSA 2D2DA 4ACAA 1E34B 1GJ4H 2ZDNA 4FU9A 2G5VA 2HALA 3UR9A 1C2KA 3SORA 5J4SA 2AGGX 3QWCH 8ESTE 4CBOA 1Q3XA 2FESH 1KXFA 4WF8A 1RTKA 4GCHF 2ZHFH 2A5IA 4K3JA 1A7SA 3UIRA 2SGAA 1P8VC 3K2UA 3NRLA 2ZFRH 3MNCA 1S81A 4DVAU 5DN6D 4K60A 2ULLA 2TGDA 1EPTC 5EOKA 3QGNB 2ODPA 4I8KA 3FP7E 3M7UA 1O3KA 2FOFA 1DWDH 1DOJA 1P9SA 1WYKA 1FX0B 2FIRH 3M7QA 4KTCA 1ELFA 3EDXB 1U6QA 2W6JD 2FOBA 2Z9JA 1Y5AT 1IQIA 4WH6A 3SUFA 3S7HB 3VB3A 1NN6A 1LPZB 1ESTA 2OTTX 3ATIA 1ORFA 2AHME 3PV4A 3Q3XA 3LGVA 3MO3A 1DLKB 1PYTD 1O3CA 3RMMH 1GBCA 4YOGA 1A2CH 1ELEE 1Y3YA 4ABIA 4OGXA 3NZIA 1MTSA 1YLDA 1E79D 5A0BA 3H09A 1UTOA 1TNHA 2V3HH 4YOJA 2LP6A 3KCGH 1C2FA 1QL8A 3P95A 2Q1JA 1T32A 1GBDA 2WYGA 4WH8A 1FAKH 1AHTH 2W7UA 1RFNA 1F0RA 3SNBA 1Z8GA 3PLBA 2A5AA 1OOKB 6GCHF 1XVMA 2AH4X 4JZFH 3EQ0H 2ZFTA 3GCOA 1EJNA 2GMTC 3MMGA 4ZAEA 4ABHA 3S7KB 1LKAA 2LPRA 1SGQE 2TGAA 1YBWA 1TQ7B 1CA0C 4ISHH 2O8WA 2OXSA 3OX7U 2C93B 1GCTC 2JJ1D 3SUGA 1KYNA 2GJGA 1PPGE 1D9IA 4A7IB 4CR9A 1AVGH 2J92A 4WJG2 4RT1A 8LPRA 4AB9A 3ODFA 4AX9H 3LGUA 1V6DA 2G00A 3MYWA 3U69H 1MKWH 1CHGA 3VPKA 4IC6A 1ZJKA 1SOZA 1W7XH 4HG6A 1MMJN 2Z9KA 1UTNA 4GHTA 3KYGA 3A7WA 1MUEB 1O2MA 1FY1A 1WOFA 1ZTJA 5EXNA 2BY6X 2FOMB 1ZHPA 2ALVA 3A7YA 3PRDA 2XBXA 3MH7A 5CHAC 1GBKA 4UFGH 3RXSA 1GG6C 1UHBA 4AFSA 1K1OA 1DXWA 2OY3A 1O37A 5TCCA 2A7HA 1OXGA 2FI3E 1SMFE 1O2HA 4TPYA 1C5NH 1O3PB 3LONA 4YESB 1BRUP 2ZWLH 1QTFA 2JH0D 1NRQH 2KAIB 3UPEA 1AZ8A 2TRMA 2V3MA 4X2XA 4XD7D 1DM4B 3B23B 3FP6E 4FUFA 4B6FA 1VGCC 1CE5A 1YPMH 3HGPA 3IITA 3D49H 3GS9A 3LGTA 1GMHG 3WW7A 3ATKA 4X2YA 3RC5A 1NT1A 5A2MH 4VGCB 4AGKA 1V2QT 1TMUH 3F3BA 1QBOA 1ZRBA 3GDVA 1GGDB 3RLWH 2R3YA 2C8XB 3PLPA 1PQ7A 5SGAE 3SUDA 1FLEE 1QURH 3SNEA 4UDWH 4MNWA 1EXFA 1H9HE 2SGQE 1HAOH 1TBZH 3V0XA 1TNJA 2D26C 2P59A 2GP9B 4K5ZA 3VGCC 2QF3A 2BZ6H 3BTTE 3F0PA 4ABEA 2AIPA 1P10A 3C27B 2QV1A 3OY6U 2OP9A 3E1XB 4BTTB 1GBEA 7GCHF 1TONA 1EAIA 3T5FH 1TPAE 1O3DA 3GDSA 1WBGB 1F7ZA 3M5OA 1GHWH 3U1JB 5I46H 1SGDE 2BLOA 2VIQA 1CT0E 2QXHA 1W3CA 1NRSH 1F0UA 4GPGA 3QLPH 3A85A 1AFQB 5EW1H 2QE7D 1DY9A 1GI0A 4ZXYH 2JP0A 1O2IA 1RS0A 3QK1A 4Y76A 1B0FA 1BZXE 2GGVB 1NPMA 2QA9E 2W7SA 2OTVA 2H6MA 2ZGJA 5J4QA 4X2WA 1VITF 2FI4E 6CHAB 2JH5D 1IQHA 2B7DH 1K1IA 1VZQH 3Q3KA 1FNIA 1GBLA 2XC4A 3UOPA 4NWKA 1AD8H 3RXAA 1HAXB 1P12E 5DKMA 4X1QU 1O3JA 4Y71A 4UE7H 2FX6A 5K0HA 2ZO3H 4RI0A 1XKAC 2FTMA 3RXBA 4BNRA 4AN7A 1BCUH 1XUIA 1O2ZA 2ZHEH 2DE9A 1WCZA 1ZSKA 2XCFA 2FOGA 4ISIH 1KDQA 1F0TA 1ZGVA 2Z9LA 1MKXK 2GV6A 2AERH 3BG4B 1ZTKA 3RXEA 3DHKH 4Y0YE 2WHXA 1TQ0B 3RXKA 4CR5A 1MAXA 9LPRA 3VEQB 2B0FA 5T3HA 3DSPA 5JB8S 3CP7A 2OC1A 2PW8H 4UFFH 1N6YA 4B6EA 1Z8RA 3RXVA 3OYPA 1BITA 2WPJS 2CMYA 1Z71A 3MNBA 1IQNA 2ZIQH 1QCPA 1O2YA 4SGAE 1GJAB 2AGIX 3OTPA 5C17A 2FOAA 1P2MA 3TITA 1HAHH 2ZHWH 3SV7A 1EFRD 1YF4A 2R9PA 1K1PA 1OWEA 1QJ7B 3RLYH 2GCHG 3UQOA 1BUIA 1L4ZA 2Z94A 1QFKH 1ANDA 1G30B 1C1VH 1H1BA 1SR5C 2J5UA 2GD4B 1RIWB 2PV9B 9ESTA 1HAVA 5ETXA 1Y8TA 5C94A 2K8IA 3UAIC 1G3DA 3BV9B 4WY3A 1MTUA 1Z7KA 3MWIU 4IMZA 2HNTF 4CRGA 5FBEA 4DIIH 1NC6A 1K28D 3WWFA 1HNEE 3SGQE 3SOSA 1GHBF 1KLJH 2WINI 1AUJA 2BTCE 1KXEA 2BY5X 2CF9H 3DT0H 3GCHB 1QRXA 2H1UA 1JXPA 1UMAH 3LDXH 4KTUA 2BQ6B 3GY7A 1E37B 3SO3A 3O8DA 3H7OA 5JBCS 1C5YB 2PFEA 1MQ6A 4TWYA 3GCNA 1QBNA 1WDIA 2VB0A 1XUFA 1LO6A 2DE8A 4PROA 1GMCG 1TIOA 1JIMA 3MTYA 2VJ1A 1C2HA 1CQQA 1YPLH 4YZUA 1ELDE 1UTPA 1NRNH 1SOTA 1W11U 5JFBA 2PKAA 3B9FH 3SZEA 4X0WU 1HAYB 3KEEA 4NA9H 1BTUA 1PPHE 1O5EL 3M3SA 2VIOA 1IQGA 3PV2A 3TPIZ 2VU8E 1P57B 5FL7D 5H4IB 1OP8A 1QL7A 1XUKA 1YPKH 5DJ7A 1CSOE 3LGWA 2GCTB 1TRMA 1GHAF 1PQAA 3FZDA 1OWKA 1DT2A 2R0KA 3O8RA 1C2JA 1XVOA 1BT7A 4RN6A 3W94A 1F0SA 3MFJA 4MTBA 4A5TS 2VVCA 2I6QA 1A5GH 2PP6A 3TNSA 4AFUA 3MH4A 4O97A 5EPNA 2PLXA 1BIOA 5G4BA 1C2DA 5EGMA 2BDYA 4VGCC 5BPEA 4ZHMU 2FOHA 1MTWA 4WMDA 5JBBS 5KECA 2J38A 2PKSC 1V2VT 1TX6A 2JA4A 1GGDC 2KCAA 1NZQH 1SQAA 4I33A 4Q2KA 3FN8A 1S6HA 3PROA 3RXHA 4LZ4B 1O3FA 1TAWA 1UVSH 4WVPE 4AGJA 1V2KT 2H9TH 4QT8C 1YPHC 3F2FA 1HIAA 2TGTA 5IDKA 1DWBH 2BX3A 3PYHA 4RKJB 4XBDA 2HPPH 4MLFB 2OYAA 2GZ9A 2HNTC 2OD3B 3TJNA 2RA3A 2BZAA 1KLTA 2YMSD 3A8DA 3O8CA 5JPMH 2WPLS 2YNBA 1THRH 1SLUB 1FV9A 2STBE 3P8OA 1W7GH 2PUXB 1DVAH 3BTKE 1ETTH 2BOKA 2CF8H 4FUJA 1AY6H 5LGOA 3KQDA 3MU4A 1P03A 5DP4A 2XBVA 3F9FA 4I32A 3ZVFA 4B73A 4DW2U 3AAVA 1GHVH 1YP9A 2ZDKA 1EZUC 4Y7BA 2EQNA 3T2NA 1SGYE 1B0EA 4AG1A 1W12U 1O3HA 1F5KU 1G2MA 3STIA 4UD9H 1YC0A 5A8XA 3A84A 1O2RA 1Y59T 1AO5A 5I25A 5A8YA 1BB0B 1FY8E 1Z6EA 1FY3A 1GI3A 1N6XA 1WU1A 1UVUH 1W8BH 1ARBA 4GVUA 4ABDA 1DSUA 2OINA 2J94A 2BM2A 4I31A 3WWBA 1ZZZA 1TNGA 2SNVA 3S0NA 3U98H 1E1RD 3ZZ3A 3VB6A 1KSNA 2A7CA 1A4WH 2XW9A 1EZXC 1TB6H 1NTPA 2WUBA 1BTHH 1GI7B 3RXPA 4JMYA 2WPDD 3S9CA 2ODQA 2BDIA 1E38B 5GCHG 2HLCA 3P17H 2EA3A 3URDA 4JZ1A 4Z0KA 1TOMH 3MNXA 5HYOA 3AK5A 3A7TA 7GCHG 2QF0A 2WUCA 1O2VA 4TSFD 4ABFA 3ZVCA 1O38A 1V2ST 4TT3D 4X6PA 4ABBA 1EP6A 2O9QA 3I78A 1C1PA 1FY5A 3A7XA 1C5VA 1PQ8A 3N7DA 1TBRH 1C5UA 1Q2WA 1G37A 1TGSZ 1W0YH 1V2LT 2YOLA 3ATWA 1BBRH 2JIZD 1C2LA 3L6PA 4AZ2B 3F68H 4O03A 1NFWA 1MU6B 1UK4A 1YGCH 1P04A 1C1OA 5AHGH 1BY2A 3VXEH 3BF6H 2VIPA 3ODDA 3PTBA 3TK9A 4HI3A 3UREA 2V7QD 2Y81A 2YNAA 5LPRA 5C1YA 1BBRE 2QY0B 2FEQH 3FP8E 2WPMS 2ZHQH 1C5QA 1QRWA 1OP0A 3ZZAA 4CHAC 4IMQA 3TK6A 1IQLA 2W26A 2NU0E 1OWDA 2PUQH 2V6NA 5FHTA 2F83A 1WTHD 3DFJA 3PWBA 2GX4A 1UJ1A 6ESTA 1KXAA 4X6OA 4XBCA 5AFYH 3N7EA 3DFLA 5HM9A 1H8HD 4NIVA 1HAPH 2UUYA 1O5CB 2ZGHA 5TCAA 1G9IE 3SU0A 1FUJA 1E0FD 1HUTH 3SNDA 5EIYA 5L6NH 1O3LA 1Y3XA 1JBUH 1H8IH 5FAHA 3LC3A 3HKIB 3BN9A 3AASA 1MBMA 1P2NA 3PRBA 2JETC 2ZGBH 1BMNH 1AVXA 2W3KA 2ZQ1A 1W14U 2SGPE 3EA8A 4OGYA 2OUAA 3K6ZA 2BY8X 1YY3A 1J14A 1O39A 2F91A 1GHZA 1F5RA 1G32B 2GDDA 2OK5A 1O5GH 2O8UA 2PGBB 1OPHB 1J9CH 2CHAC 3QTVH 1P06A 5LPFA 4BAKB 3SQHE 2R2MB 1CU1A 4IN1A 2FO9A 3PMJA 2ZKSA 4Q7YA 1O2TA 4H42U 1ELBA 3M7TA 3HPTB 1L1NA 3OTJE 5EU8A 2Z9IA 5BRRE 4DY7B 1TX8A 4YT6H 3P92A 4TY7A 2ZFQH 1N8OC 4AYYB 3RP2A 4KKDA 4FU8A 1WXRA 3ZZ9A 1MTNC 1VITH 1MAYA 1MQ5A 2VH6A 3TH4H 5FCKA 1GI2A 1O3OA 4DG4A 3HK3B 3KN2A 4OS7A 3GISB 1P05A 4LK4A 1ESAA 3HKJB 4UFDH 3VFEA 4JK6A 1MABB 4UEHH 1HGTH 1C9PA 4B75A 4MPUA 2F9OA 2YMSB 2P16A 1CGJE 1S82A 2BY9X 1AU8A 3M37A 4NSYA 1XXDA 2XRCA 4X1PU 3SU4A 1UTJA 4WXVA 1GI8B 4INKA 1HPGA 1C5MD 3K6YA 3RC4A 3RXIA 2RDEA 7ESTE 1GBBA 1C2IA 2VGCC 1HJ8A 5A0CA 2VNTA 4WXIA 1T4UH 2B8OH 1OSSA 4CBNA 3DCLA 5CDFE 2BD7A 1TNLA 5FX6A 1HAGE 2ANKH 4J1YA 1GI4A 4DT7B 4FVDA 4NG9H 3TJUA 3CNRA 2Y5HA 4JYTA 1M9UA 1K2I1 2Z6BD 3BIVH 3SV9A 1QJ6B 1HJAC 2ANYA 1ELGA 1S84A 2BXUH 3ZZ8A 3SI3H 2ZZUH 2EC9H 5DP6A 3A82A 1CBWC 3N7OA 3GICB 4B71A 1C1SA 3NKKA 2RDLA 2ZHDA 4A6LA 1SHHB 3ELAH 1L2EA 3A8AA 5DP3A 1H8DH 2TBSA 2ZU4A 3QDZB 1HDTH 4NZLA 2XBYA 1OWJA 3M36A 1C1MA 1LPGB 5HIZA 1AFEH 1ZMLA 2J98B 4D8NA 2KAIA 5KEDA 1AB9B 2ZG0H 2BVSH 1MU8B 3V12A 2QYIA 1LPKB 3FKSD 3L3TA 1ETSH 1T31A 4Z1MD 1S0RA 2GTBA 2DUCA 5E8EH 1OP2A 4K69A 3UTUH 3PMHB 1A5IA 2NU1E 4Q7ZA 3T25A 3BTGE 2HWLB 3MI4A 3UR6A 4BAHB 5FPTA 4CRBA 2A4GA 3V7TA 1YPHE 4ISNA 4X6NA 1SGFG 1O2PA 1ZTLA 3PTNA 1O5FH 5C5OA 1EOLA 3VG8A 2A32A 2HNTE 3PM3A 1TLDA 5AF9H 1GI5A 1GHXH 1RTFB 3NUMA 1O33A 3K9XB 3LIWA 3LU9B 4ZCNA 2AEIH 3GYLB 3OFND 2FYQA 2SGFE 3T62A 2Q6GA 2RG3A 1UHBB 1GVKB 2A1DB 2G4TA 2Y7ZA 1V2RT 4OM9A 1A0HB 4FUIA 1C2EA 3W95A 3TGKE 3RXRA 4ZHLU 1SQTA 2VBCA 3VXFH 1ABIH 2VVVA 3A88A 4U01A 1SGNE 1F92A 1GBIA 4NA7A 2I6SA 1SC8U 3FVFB 2P3FH 5FPYA 1NRRH 3ZVAA 5T6DA 2BD8A 1BTPA 1NU9A 1ELVA 2P3UB 1LDTT 4K1TA 4NGAH 3PMBB 5F6MA 1TRYA 1LHCH 1ETRH 5EJLA 2QC2A 4X8VH 3MH5A 2ZTYA 4JZEH 3A80A 1UTLM 3G01A 2BDHA 2JJ2D 1UK2A 2FX4A 2HRVA 1GBMA 3SU1A 4K2YA 2H5CA 1C2GA 1THPB 3T29A 3TLOA 1ZSLA 1C1UH 2O8TA 1ZRKA 1WTGH 5DPAA 1QB1A 1EUFA 3LT3A 5EODA 1C5TA 1YWUA 2J95A 1HV7A 1ZLRA 2VH0A 1RJXB 2ZC9H 1YKTA 4B2CA 1TPPA 3RXDA 2QGRA 3PO1C 4ZKRU 1AI8H 3E91A 2SNWA 4DCDA 2XOKD 3MNSA 2P8OB 2IPQX 2GDEH 1PQ5A 1TBQH 2C90B 5JDUB 3OEHD 1PFXC 1QBVH 2NU3E 2CK3D 2STAE 2C4FH 2ANWA 1C1QA 2ZU2A 1C5LH 2ASUB 4HTCH 2UUFB 2P93A 5EPYA 2A4OA 3LC5A 2EI6A 3P8FA 2XCNA 2GKVE 1SGEE 4Y10E 3E16B 2J97A 2QXIA 2ZEBA 4A1VA 4DJZB 4DOQA 1O3AA 2FLBH 1GMDF 4CH8B 3RXQA 1OX1A 2SGDE 1CHOG 1QGFA 3EA9A 4FUDA 1DS2E 5ESBA 2CV3A 1ZSJA 4NA8A 1BTZA 3ITIA 3KF2A 3KQEA 1EAWA 4TY6A 3SV6A 4AYVB 5A09A 3GY4A 1CT2E 2BLWA 3GCTF 5JBAS 1O2XA 2FP7B 3EGKH 2Y5GA 5FXLA 3QGJA 1RXPA 1SGRE 1FJSA 7LPRA 4Y8ZA 3RUOA 3GY3A 1NFYA 3A87A 1LVOA 2CXVA 4ZUHA 1AZZA 2JDID 3NWUA 4ZKOU 2ZCHP 8GCHF 1EX3A 5DGJA 1KIGH 4FUEA 4RKOB 6LPRA 1O35A 2NWNA 2GZ7A 5DG6A 4BAQB 2G52A 1HB0B 3ZVBA 2VIDA 4ABGA 3BEFB 5DP5A 1C1TA 2M5TA 4H6TA 2ZCKP 1Y5UT 4GCHG 1QIXB 1ZYOA 5KGOA 3W1EA 1TOCB 3VB5A 1ELCA 2OC7A 5C20A 2FODA 2ZU3A 2IN2A 1LHDH 1ESBA 2OC8A 3KGPA 1O3IA 1QR3E 1SGPE 1IQFA 5L2YH 1VJ9U 1TABE 1FAXA 2HVXA 1COWD 4ACBA 1C5OH 4E06H 1LVYA 1XX9A 5HMAA 3MU8A 1GWAA 1ZJDA 2ZF0H 4OS6A 4A1XA 1C1WH 1CA8B 2K1QA 1IHTH 3F2HA 2Q6FA 5AFZH 4E05H 1O2WA 3Q77A 1QRZA 3URCA 2GT7A 3RC6A 3LPRA 1UO6A 2ZPQA 2PR3A 2OBOA 2L74A 5JBTA 3SV2H 1P57A 4AOQA 3BIUH 1WAYB 1GBAA 1CVWH 1QA0A 3ZZ6A 1NROH 2ZDLA 4MPVA 3AAUA 1AKSB 1BA8B 1CT4E 4X8TH 1BRCE 1PPCE 2B5TB 3UNQA 3ZZ4A 3A7ZA 5E2PA 4DURA 1UVTH 1ZMNA 1PJPA 2R0LA 4GHQA 3UQVA 2ZI2H 3RMLH 4YLQH 6GCHG 1HYLA 1S83A 1A46H 1FONA 4FUCA 2FOCA 4F4OC 3A7VA 1NY22 3UY9A 4X8UH 4BTIB 1EJMA 1J17T 5F8TA 2CN0H 3BTQE 4AB8A 4A92A 1YCPH 1TGBA 3SJIA 3TK5A 1QB6A 1EPTB 3GOVB 4Q4LA 4BXSA 1V2MT 1Y5BT 2A45B 1BHXB 4JZDH 1X7AC 1TWXB 3GY2A 3BTFE 3TIUA 1TMTH 2WYJA 2BMGB 2G8TA 4A1TA 2PKAB 1NU7B 1B7XB 1MH0A 3NCLA 5IYTA 3RM2H 5CE1A 4RT0A 1C5ZB 1J8AA 1SFQB 1TX7A 3T28A 1E35B 1RRKA 2AMQA 1GJ9B 1ACBE 1D4PB 1GL1A 4D76A 1HAIH 4AG2A 2SFAA 1P01A 3KQ5A 1FN6A 2EEKA 4X1RU 4K1EA 4YXWD 3GYMA 1UW7A 1KLIH 3LGIA 1JWTA 3KIDU 2Y5FA 4ZROA 1BTXA 2Q6DA 2Z3CA 5HM2A 1SI5H 1O3NA 2L6OA 1O3BA 2UUKB 1L1GA 4ZKNU 3A89A 1J15A 2OLGA 2LELA 3TJOA 1IOEA 1FI8A 1YPEH 1ZMJA 1EB2A 2GMTB 5T6GA 1UTMA 4ZXXH 1UCYH 3CS7A 4FOUC 1OHHD 1W13U 1CA0B 2FLRH 3ATMA 4OS2A 1B5GH 4Y79A 5C67A 3PLKA 2AMDA 1FIWA 1BMAA 2WV5A 4FUGA 1AFQC 4NIWA 3OSYA 3SJKA 3SUEA 5K7RA 1TPSA 4I8GA 4XE4A 1UCYE 3OY5U 4YTAA 2XNDD 5L30H 3KQBA 4R0IA 2F3CE 3HGNA 2WPIS 4FETA 4GUXA 4O9VA 3PV5A 5HXFA 2BB4A 1P2QA 6CHAC 3SJ8A 2FZZA 3MU0A 2WSSD 3DA9B 2QN5T 4I8HA 4D9RA 1K1NA 3A8CA 3S9AA 3F9HA 4ISLA 5ESTE 2ZDVH 1DFPA 1SHYA 1FXYA 5CHAB 1FIZA 5JYIA 3U8OH 3VB7A 3SQEE 5C0UA 1GG6B 1P09A 1P2IA 1O31A 2QF5A 1VKYA 1Z1JA 2Z3EA 3E0NB 4B2AA 4HGCA 1GPZA 4UONA 1MZDA 2KCYA 1OYTH 4H6SB 3MO9A 3UNRA 2XBWA 3KNXA 4TWWA 1L1JA 1QQ4A 2THFB 1MZAA 3SGBE 1AMHA 4AC9A 1EATA 2VWOA 3BG4C 1JIRA 3Q3YA 2XYAA 2IJOB 2KR7A 2ZDAH 1WV7H 4X8SH 4CH2B 1VGCB 3OEED 1GL0E 2A4QA 5F8XA 1XUGA 1BMFD 2M2AA 3TU7H 5C1XA 3BEUA 3U8RH 1TNKA 3SW2B 5GNDA 1VCWA 1HXEH 2AFQB 2OBQA 4INHA 1YM0A 1QL9A 8KME2 1QZ8A 1NS3A 1C1NA 1A5HA 1O2QA 1VITG 2BQWB 1O5FL 1O2JA 3LKWA 2KCOA 1KTTB 3E8LA 5B6OA 3RMNH 1G3BA 1T8NA 2PTCE 1EOJA 1O0DH 3WY8A 2TPIZ 1BTYA 2ZCLP 3ZVGA 1BJUA 1RIWC 1BOQA 1E36B 4IS5A 3RM0H 3VGCB 2QF4A 2R2WU 2KFWA 2WZQA 1HCGA 1V2UT 4MPXA 2BD5A 2VIVA 3Q76A 4U2WA 4F49A 4Y6DA 1SLVB 2WV4A 1FPHH 3ZYEA 2TGPZ 1MD7A 3GCHC 3SGAE 2XWBI 3ZVDA 5E2OA 1DWCH 4JYVH 4J2YB 2XC0A 1SSXA 2ZPRA 4TYDA 4JZIA 3F0OA 1BDAA 4CRAA 4Z6AH 2ZPSA 4Y0ZE 1FZZA 1WQVH 2IJD1 3F9GA 4O3TA 1D3DB 1GHYH 1FMGA 5FBIA 1O5EH 5DO4H 2W5EA 1LCYA 3LH3A 4KTSA 2BHGA 3EYDA 3UWIA 1DE7H 1TYNA 2W6ID 4IGDA 4BAMB 1BMLA 1UVOA 1V2NT 4CRFA 1K22H 1BBRK 5IK2D 5EQSA 1KXDA 3TGIE 2ODYB 4B1TA 2KZ4A 2WV9A 4OS4A 4YLUA 3RDZA 4LZ1H 1GJ5H 4ZKSU 1SG8B 3RXUA 1EP5A 3AVZA 5DP9A 1SB1H 2GCHF 1AIXH 1HBTH 3IWMA 1Y3UA 4XBBA 3FO8D 2BD4A 3P8NA 2GCTC 5EG4A 1GHBG 2Y82A 5C3NA 2Z9GA 1O3MA 1T8LA 1LKBA 1HFDA 2QAAA 3OE7D 3SZNA 3S9BA 3A83A 2A2XH 5DP7A 2F43B 3SU5A 3QO6A 4Y11E 4YM9A 3FAOA 3RU4T 1EB1H 1DSTA 4NIXA 4ASUD 1GCDA 2PWXA 1WUNH 3BTWE 3V13A 3TGJE 2F9NA 2F9PA 1ID5H 2UUJB 2FOEA 3BTEE 3SN8A 3TH3H 3SV8A 1J16A 5E0JA 3I77A 3RXCA 5F03A 4GLYA 3RMOH 5FCRA 4U30A 5GIBA 1KTSB 2BDCA 4M7GA 3ATLA 3FFGA 1SBWA 2V3OH 2ZECA 1GMCF 3SNCA 2TIOA 1AE8H 1KMHB 2B9LA 2C8YB 2WPHS 1UTQA 4H4FA 5AVDA 2G51A 1TGTA 4FVBA 3A81A 1K1JA 3SBKA 2A7JA 3EE0B 1VJAU 1CGHA 1GJ6A 3QX5H 5DP8A 1GVLA 1ANCA 4K8BA 2FWWA 1O32A 1Z6JH 1ZHRA 2J98A 2BYAX 2RA0A 5EJZA 3F6UH 4NCYA 1GHAG 2BDBA 3F1SB 2EY4C 2VINA 5B6LA 3KQCA 5C2ZA 1AN1E 4O3UA 3GY5A 3B8JA 3N99A 3Q00A 1SVPA 5PTPA 2FS9A 5TJXA 2JKHA 3KL6A 3M5MA 3T26A 2BLQA 5A0AE 2F9BH 1NBMD 2BVXH 4OS1A 1ARCA 4YO9A 1NRPH 1OKXA 1GJ7B 2FYRA 1UTKA 5CMXH 1SGCA 1O3GA 2JOPA 3JZ1B 1IQMA 2GVFA 3ZYDA 2UWPA 5HKKD 3SJOA 3GY8A 3RXGA 3MU5A 1K21H 4K8YA 1DANH 4F48B 1Q31A 5HGGA 3MOCA 1T8MA 4AFQA 1C4V2 1L4DA 1P11E 3H5CB 4Q7XA 3P6ZB 3TH2H 1SQOA 1ELTA 2F9UA 2QXGA 5LH8A 1JRSA 2QXJA 3CENA 2R3UA 3QZQA 3R3GB 2P94A 4ZMAH 1GI1A 1SPJA 4ISOA 1MBQA 1A3EH 1HJ9A 2ZFSA 1T7CA 3K65B 3QTOH 2H9EH 3ZVEA 3H7TA 5EQQA 3UFAA 4ZH8A 4DT4A 1O2LA 1SKYE 2EI8A 3EAJA 1C9TA 1HRTH 3RXFA 2ZA5A 1NO9H 3SU2A 1FQ3A 1RTLA 1SL3A 1MCTA 1P3CA 3AW0A 4BTUB 1O2GH 1O2UA 2AIQA 1OS8A 1LVBA 1DLEA 3NXPA 5F8ZA 4BXWA 1V2WT 2FTLE 4Q63A 1EAXA 1T4VH 2J2UA 2EI7A 1TA6A 3FOAA 1EJAA 1SQRA 1LVMA 4KP0A 1MKWK 7KMEH 2VWNA 2ZTXA 4BAOB 1F2SE 1VR1H 3SYJA 1ANBA 2PKSB 1GBJA 1TFXA 1ZPBA 5DK1A 1P02A 1NESE 1G36A 1GBTA 3KHVA 2FS8A 3NPSA 4I8JA 3ENSB 1CO7E 1ANEA 5GPIB 2G4UA 1O5AB 2RCEA 2BVRH 3A8BA 1DUAA 1AE5A 1ZPZA 1T8OA 3RXTA 1DWEH 1WSSH 3RXLA 1D3QB 1MKXH 2H2ZA 2ZQ2A 1H9LB 3L33A 2BXTH 2VIWA 2V0BA 3MU1A 1K9OE 5JB9S 2BLVA 5GCHF 2V35A 1XKBC 3M35A 1TRNA 3QZRA 1P2KA 5DSFA 1D6WA 2BX4A 1XUJA 2PHBA 4HFPB 1Y3WA 3ZZ7A 1A3BH 2K0QA 4WWYA 1K0HA 3MH6A 4INLA 2PSXA 3RXOA 5F53A 3ZZ5A 1BTWA 1NFXA 2FM2A 3BG8A 4GAWA 1EQ9A 1O36A 2ZDMA 3ZIAD 1F5LA 2GV7A 2P95A 1MTVA 2UWLA 4MG3A 1AVWA 1FDPA 2G81E 1TNIA 5E0HA 5GDSH 2QIQA 1P9UA 2XNIA 4MNVA 1LHGH 1GVZA 4MNYA 1SGTA 4CRCA 3PMAB 1AWFH 4YT7H 1G3CA 3TJVA 1AWHB 4B2BA 2KX4A 3BTHE 4I86A 2AS9A 4AFZA 4LXBH 4KELA 2BDAA 1OYQA 1NBME 4U32A 3BSQA 2O8LA 5GWZA 4TPIZ 3LH1A 4X1SU 1JOUB 3SHAH 4MNXA 2OC0A 4IN2A 1IQJA 2LNCA 1TE0A 2BOHB 4CRDA 2HPQH 1D3PB 1XM1A 5EXMA 3ZZCA 1LQEA 5EXLA 1GDQA 1QNJA 3PB1E 3ZV9A 2NU2E 5CHBA 2BD3A 2ILNA 1ZOMA 3RU4D 3MHWU 1Y3VA 1GDUA 3PWCA 3U8TH 2Z3DA 2YMSC 4X2VA 1SGFA 5FPSA 4D7FA 1PPBH 1TA2A 3KYFA 3LGYA 1KDQB 1DPOA 1BJVA 1LHFH 1DUEA 1PPFE 2BDGA 4HZHA 5E0GA 1DICA 4THNH 3SHCH 4Y8XA 1E1QD 1MCVA 2J34A 2ESTE 3E3TA 4R8TB 3A86A 1DDJA 4IC5A 1LHEH 1XMNB 3LOXA 1G2LA 1ZHMA 2ZU5A 1OWIA 5A8ZA 1IQEA 4MVNA 1V2TT 2VVUA 1C5RA 2Y7XA 2C8ZB 4B74A 4SGBE 1PPEE 1V2PT 2XTTB 4CHAB 1AQ7A 1GI6A 2ZU1A 3ZV8A 1BQYA 3RXJA 5T1VA 2HVYB 1IAUA 3RXMA 1AKSA 3O8BA 2A2QH 4JYUH 4BOHA 2ZTZA 1FPCH 1DITH 1QY6A 2FMJA 2VWMA 4JK5A 1O5BB 1SFIA 1HAVB 2A0QB 1AB9C 1EAUA 3TNTA 3SJ9A 3V3MA 4Y8YA 4DGJA 1YPGH 1SLXB 3GY6A 1EPTA 1TGCA 2JETB 4WMEA 1W10U 2AYWA 2ANMH 3SU6A 1D3TB 2VWLA 3DSOA 4YOIA 1EZSC 4KGAA 4UFEH 1ZGIA 1SGIB 2HLDD 1DXPA 4NFEA 3FANA 3MQKC 1FY4A 1IHSH 1W2KH 4D7GA 1GJCB 1YLCA 1YPJH 4WMFA 4XOJA 2CHAB 5C1UA 4LOYH 3VB4A 1L0ZA 1A0JA 1O30A 4MQAA 3E0PB 2NU4E 4IW4E 2JH6D 2CJIA 4GSOA 3P8GA 3M3TA 1QJ1B 5LPEA 3D65E 1C1RA 2C8WB 1UVPA 1ZR0A 1W0ZU 1A61H 1P3EA 2A31A 3STJA 1A0LA 1D6RA 2OQUA 1N8OB 4RSPA 4XFQA 3DUXH 5FX5A 4AORA 4CREA 3U1IB 1GJ8B 1MTNB 2XWAA 2BQ7B 1AUTC 1P0SH 2O8MA 1CGIE 2KCPA 3M5NA 1AGJA 3EA7A 3BTDE 1NM6A 3UWJH 4P02A 2D8WA 2FXRA 2C3SA 2SGEE 1VCQA 2AMPA 3E6PH 1BRBE 1O34A 2J4IA 3U28C 3SI4H
chains in the Genus database with same CATH topology
3GDUA 3QUMP 4FXGH 4FUBA 4XDEA 4ABAA 1GDNA 2BY7X 4E7RG 3NK8A 1S85A 3QN7A 2ZNKH 1LTOA 5GXPA 2VGCB 1S6FA 2Y6TA 4NSVA 1GBFA 2FPZA 3RU4E 1Z8IB 1TALA 1XUHA 1C5WB 4ASHA 2H9HA 1EZQA 2OQ5A 2GZ8A 3I29A 1ZPCA 2PSYA 3C1KA 1C5XB 1P2JA 1TGNA 2AGEX 1GJDB 4BANB 4D9QA 1HJAB 1O2NA 1GCTB 4JCNA 1ABJH 5GJ4B 1TPOA 1V2JT 1YCPK 1KY9A 3M3VA 1P2OA 1CBWB 3IG6B 4Q80A 1GMHF 1HIAB 2CGAA 4NIYA 1O2OA 4B76A 3UNSA 2PTNA 1QA7A 3U9AH 3D62A 2P8OC 3FZZA 4ESTE 3UUZA 1INCA 1HLTH 1RD3B 2ZGXH 5L2ZH 1XXFA 2WPKS 1EASA 1FN8A 4FUHA 3HK6B 1HXFH 1YCPM 2BD9A 1QQUA 2G5NA 2F9VA 1ELAA 1DX5M 2BD2A 4MPWA 1PYTC 1H4WA 1Z1IA 2ALPA 3M61U 2PGQB 4X1NU 3MO6A 1K1LA 1GJBB 1KXCA 3ESTA 2Z7FE 1HAZB 3ZZBA 4K1SA 2HGTH 3TVJB 2G55A 1C5PA 1O2SA 4I7YH 2OCVB 1V2OT 2IPHA 4XSKU 2J9NA 1QHRB 1O5DH 1C2MA 2XC5A 1THSH 2IOTA 1LMWB 2QCYA 4NWLA 1MD8A 4DIHH 1RGQA 4NZQA 5C5NA 1UCYK 1JMOH 1BHXF 2FI5E 5ABWA 1V3XA 2ZP0H 1NFUA 4NFFA 1H9IE 1S5SA 2UWOA 3M5LA 5EW2H 1EKBB 4X6MA 1S0QA 1C4Y2 1GBHA 1KXBA 1C5SA 4ABJA 3SU3A 5T6FA 1A1RA 1Z8JB 1K1MA 1QB9A 1OWHA 1JRTA 2D1JA 3BTME 3BEIB 1N1LA 3UOUA 2GT8A 2XXLA 3D23A 3JZ2B 1GMDG 1O2KA 3HATH 3P70B 2P3TB 3F9EA 2W3IA 4Y7AA 4I8LA 1O3EA 5EQRA 4IBLH 4ZHAA 1VCPA 3S69A 1CHOF 3LJJA 3ZZDA 3CS0A 2Y80A 1GI9B 1LQDB 4E7NA 2A5KA 3GCTG 3OU0A 3R0FA 1G3EA 1DY8A 4MDSA 2ZFPH 2H5DA 1YYY1 1IQKA 4OS5A 3AW1A 2FDAA 1SLWB 2ZGCA 8GCHG 1TMBH 3E90B 2ZFFH 1C4U2 1PPZA 1BRAA 2A4RA 1BMMH 3DD2H 2HOBA 4FU7A 3PO1B 3SNAA 3LJOA 3T27A 1UK3A 1WQSA 2D2DA 1E34B 1GJ4H 2ZDNA 4FU9A 2G5VA 2HALA 3UR9A 1C2KA 3SORA 5J4SA 2AGGX 3QWCH 8ESTE 4CBOA 1Q3XA 2FESH 1KXFA 4WF8A 1RTKA 4GCHF 2ZHFH 2A5IA 4K3JA 1A7SA 3UIRA 2SGAA 1P8VC 3K2UA 2ZFRH 3MNCA 1S81A 4DVAU 4K60A 2ULLA 2TGDA 1EPTC 5EOKA 3QGNB 2ODPA 4I8KA 3FP7E 3M7UA 1O3KA 2FOFA 1DWDH 1DOJA 1P9SA 1WYKA 2FIRH 3M7QA 4KTCA 1ELFA 3EDXB 1U6QA 2FOBA 2Z9JA 1Y5AT 1IQIA 4WH6A 3SUFA 3S7HB 3VB3A 1NN6A 1LPZB 1ESTA 2OTTX 3ATIA 1ORFA 3PV4A 3Q3XA 3LGVA 3MO3A 1DLKB 1PYTD 1O3CA 3RMMH 1GBCA 4YOGA 1A2CH 1ELEE 1Y3YA 4ABIA 4OGXA 3NZIA 1MTSA 1YLDA 5A0BA 1UTOA 1TNHA 2V3HH 4YOJA 3KCGH 1C2FA 1QL8A 3P95A 2Q1JA 1T32A 1GBDA 2WYGA 4WH8A 1FAKH 1AHTH 2W7UA 1RFNA 1F0RA 3SNBA 1Z8GA 3PLBA 2A5AA 1OOKB 6GCHF 1XVMA 2AH4X 4JZFH 3EQ0H 2ZFTA 3GCOA 1EJNA 2GMTC 3MMGA 4ZAEA 4ABHA 3S7KB 1LKAA 2LPRA 1SGQE 2TGAA 1YBWA 1TQ7B 1CA0C 4ISHH 2O8WA 2OXSA 3OX7U 2C93B 1GCTC 3SUGA 1KYNA 1PPGE 1D9IA 4A7IB 4CR9A 1AVGH 2J92A 4WJG2 8LPRA 4AB9A 3ODFA 4AX9H 3LGUA 1V6DA 2G00A 3MYWA 3U69H 1MKWH 1CHGA 3VPKA 4IC6A 1ZJKA 1SOZA 1W7XH 1MMJN 2Z9KA 1UTNA 4GHTA 3A7WA 1MUEB 1O2MA 1FY1A 1WOFA 1ZTJA 5EXNA 2BY6X 2FOMB 1ZHPA 2ALVA 3A7YA 2XBXA 3MH7A 5CHAC 1GBKA 4UFGH 3RXSA 1GG6C 1UHBA 4AFSA 1K1OA 1DXWA 2OY3A 1O37A 5TCCA 2A7HA 1OXGA 2FI3E 1SMFE 1O2HA 4TPYA 1C5NH 1O3PB 3LONA 4YESB 1BRUP 2ZWLH 1QTFA 2JH0D 1NRQH 2KAIB 3UPEA 1AZ8A 2TRMA 4X2XA 1DM4B 3B23B 3FP6E 4FUFA 1VGCC 1CE5A 1YPMH 3HGPA 3IITA 3D49H 3LGTA 1GMHG 3ATKA 4X2YA 3RC5A 1NT1A 5A2MH 4VGCB 4AGKA 1V2QT 1TMUH 1QBOA 1ZRBA 3GDVA 1GGDB 3RLWH 2R3YA 2C8XB 3PLPA 1PQ7A 5SGAE 3SUDA 1FLEE 1QURH 3SNEA 4UDWH 4MNWA 1EXFA 1H9HE 2SGQE 1HAOH 1TBZH 3V0XA 1TNJA 2D26C 2P59A 2GP9B 4K5ZA 3VGCC 2QF3A 2BZ6H 3BTTE 4ABEA 2AIPA 1P10A 3C27B 2QV1A 3OY6U 2OP9A 3E1XB 4BTTB 1GBEA 7GCHF 1TONA 1EAIA 3T5FH 1TPAE 1O3DA 3GDSA 1WBGB 1F7ZA 3M5OA 1GHWH 3U1JB 5I46H 1SGDE 2BLOA 2VIQA 1CT0E 2QXHA 1W3CA 1NRSH 1F0UA 4GPGA 3QLPH 3A85A 1AFQB 5EW1H 1DY9A 1GI0A 4ZXYH 2JP0A 1O2IA 1RS0A 3QK1A 4Y76A 1B0FA 1BZXE 2GGVB 1NPMA 2QA9E 2W7SA 2OTVA 2H6MA 2ZGJA 5J4QA 4X2WA 1VITF 2FI4E 6CHAB 2JH5D 1IQHA 2B7DH 1K1IA 1VZQH 3Q3KA 1FNIA 1GBLA 2XC4A 3UOPA 4NWKA 1AD8H 3RXAA 1HAXB 1P12E 5DKMA 4X1QU 1O3JA 4Y71A 4UE7H 2FX6A 5K0HA 2ZO3H 1XKAC 2FTMA 3RXBA 4BNRA 4AN7A 1BCUH 1XUIA 1O2ZA 2ZHEH 2DE9A 1WCZA 1ZSKA 2XCFA 2FOGA 4ISIH 1KDQA 1F0TA 1ZGVA 2Z9LA 1MKXK 2GV6A 2AERH 3BG4B 1ZTKA 3RXEA 3DHKH 4Y0YE 1TQ0B 3RXKA 4CR5A 1MAXA 9LPRA 3VEQB 2B0FA 5T3HA 5JB8S 3CP7A 2OC1A 2PW8H 4UFFH 1N6YA 1Z8RA 3RXVA 3OYPA 1BITA 2WPJS 2CMYA 1Z71A 3MNBA 1IQNA 2ZIQH 1QCPA 1O2YA 4SGAE 1GJAB 2AGIX 2FOAA 1P2MA 3TITA 1HAHH 2ZHWH 3SV7A 1YF4A 2R9PA 1K1PA 1OWEA 1QJ7B 3RLYH 2GCHG 3UQOA 1BUIA 1L4ZA 2Z94A 1QFKH 1ANDA 1G30B 1C1VH 1H1BA 1SR5C 2GD4B 1RIWB 2PV9B 9ESTA 1HAVA 5ETXA 1Y8TA 1G3DA 3BV9B 4WY3A 1MTUA 1Z7KA 3MWIU 4IMZA 2HNTF 4CRGA 5FBEA 4DIIH 1NC6A 1K28D 1HNEE 3SGQE 3SOSA 1GHBF 1KLJH 2WINI 1AUJA 2BTCE 1KXEA 2BY5X 2CF9H 3DT0H 3GCHB 1QRXA 2H1UA 1JXPA 1UMAH 3LDXH 4KTUA 2BQ6B 3GY7A 1E37B 3SO3A 3O8DA 3H7OA 5JBCS 1C5YB 2PFEA 1MQ6A 4TWYA 3GCNA 1QBNA 2VB0A 1XUFA 1LO6A 2DE8A 4PROA 1GMCG 1TIOA 1JIMA 3MTYA 2VJ1A 1C2HA 1CQQA 1YPLH 4YZUA 1ELDE 1UTPA 1NRNH 1SOTA 1W11U 5JFBA 2PKAA 3B9FH 4X0WU 1HAYB 3KEEA 4NA9H 1BTUA 1PPHE 1O5EL 3M3SA 2VIOA 1IQGA 3TPIZ 2VU8E 1P57B 5H4IB 1OP8A 1QL7A 1XUKA 1YPKH 5DJ7A 1CSOE 3LGWA 2GCTB 1TRMA 1GHAF 1PQAA 3FZDA 1OWKA 1DT2A 2R0KA 3O8RA 1C2JA 1XVOA 1BT7A 4RN6A 3W94A 1F0SA 3MFJA 4MTBA 4A5TS 2VVCA 2I6QA 1A5GH 3TNSA 4AFUA 3MH4A 4O97A 5EPNA 2PLXA 1BIOA 5G4BA 1C2DA 5EGMA 2BDYA 4VGCC 5BPEA 4ZHMU 2FOHA 1MTWA 4WMDA 5JBBS 2J38A 2PKSC 1V2VT 1TX6A 2JA4A 1GGDC 1NZQH 1SQAA 4I33A 4Q2KA 1S6HA 3PROA 3RXHA 4LZ4B 1O3FA 1TAWA 1UVSH 4WVPE 4AGJA 1V2KT 2H9TH 4QT8C 1YPHC 1HIAA 2TGTA 5IDKA 1DWBH 2BX3A 3PYHA 4RKJB 4XBDA 2HPPH 4MLFB 2OYAA 2GZ9A 2HNTC 2OD3B 3TJNA 2RA3A 2BZAA 1KLTA 3A8DA 3O8CA 5JPMH 2WPLS 2YNBA 1THRH 1SLUB 1FV9A 2STBE 3P8OA 1W7GH 2PUXB 1DVAH 3BTKE 1ETTH 2BOKA 2CF8H 4FUJA 1AY6H 5LGOA 3KQDA 3MU4A 1P03A 5DP4A 2XBVA 3F9FA 4I32A 3ZVFA 4B73A 4DW2U 3AAVA 1GHVH 1YP9A 2ZDKA 1EZUC 4Y7BA 3T2NA 1SGYE 1B0EA 4AG1A 1W12U 1O3HA 1F5KU 1G2MA 3STIA 4UD9H 1YC0A 5A8XA 3A84A 1O2RA 1Y59T 1AO5A 5I25A 5A8YA 1BB0B 1FY8E 1Z6EA 1FY3A 1GI3A 1N6XA 1WU1A 1UVUH 1W8BH 1ARBA 4GVUA 4ABDA 1DSUA 2OINA 2J94A 2BM2A 4I31A 1ZZZA 1TNGA 2SNVA 3S0NA 3U98H 3ZZ3A 3VB6A 1KSNA 2A7CA 1A4WH 2XW9A 1EZXC 1TB6H 1NTPA 2WUBA 1BTHH 1GI7B 3RXPA 4JMYA 3S9CA 2ODQA 2BDIA 1E38B 5GCHG 2HLCA 3P17H 2EA3A 3URDA 4JZ1A 4Z0KA 1TOMH 3MNXA 5HYOA 3A7TA 7GCHG 2QF0A 2WUCA 1O2VA 4ABFA 3ZVCA 1O38A 1V2ST 4X6PA 4ABBA 1EP6A 2O9QA 3I78A 1C1PA 1FY5A 3A7XA 1C5VA 1PQ8A 1TBRH 1C5UA 1Q2WA 1G37A 1TGSZ 1W0YH 1V2LT 2YOLA 3ATWA 1BBRH 3L6PA 1C2LA 4AZ2B 3F68H 4O03A 1NFWA 1MU6B 1UK4A 1YGCH 1P04A 1C1OA 5AHGH 1BY2A 3VXEH 3BF6H 2VIPA 3ODDA 3PTBA 3TK9A 4HI3A 3UREA 2Y81A 2YNAA 5LPRA 5C1YA 1BBRE 2QY0B 2FEQH 3FP8E 2WPMS 2ZHQH 1C5QA 1QRWA 1OP0A 3ZZAA 4CHAC 4IMQA 3TK6A 1IQLA 2W26A 2NU0E 1OWDA 2PUQH 2V6NA 5FHTA 2F83A 1WTHD 3DFJA 3PWBA 2GX4A 1UJ1A 6ESTA 1KXAA 4X6OA 4XBCA 5AFYH 3DFLA 5HM9A 4NIVA 1HAPH 2UUYA 1O5CB 2ZGHA 5TCAA 1G9IE 3SU0A 1FUJA 1E0FD 1HUTH 3SNDA 5L6NH 1O3LA 1Y3XA 1JBUH 1H8IH 5FAHA 3LC3A 3HKIB 3BN9A 3AASA 1MBMA 1P2NA 2JETC 2ZGBH 1BMNH 1AVXA 2W3KA 2ZQ1A 1W14U 2SGPE 3EA8A 4OGYA 2OUAA 3K6ZA 2BY8X 1J14A 1O39A 2F91A 1GHZA 1F5RA 1G32B 2GDDA 1O5GH 2O8UA 2PGBB 1OPHB 1J9CH 2CHAC 3QTVH 1P06A 5LPFA 4BAKB 3SQHE 2R2MB 1CU1A 4IN1A 2FO9A 3PMJA 2ZKSA 4Q7YA 1O2TA 4H42U 1ELBA 3M7TA 3HPTB 1L1NA 3OTJE 5EU8A 2Z9IA 5BRRE 4DY7B 1TX8A 4YT6H 3P92A 4TY7A 2ZFQH 1N8OC 4AYYB 3RP2A 4KKDA 4FU8A 3ZZ9A 1MTNC 1VITH 1MAYA 1MQ5A 2VH6A 3TH4H 5FCKA 1GI2A 1O3OA 4DG4A 3HK3B 3KN2A 4OS7A 3GISB 1P05A 4LK4A 1ESAA 3HKJB 4UFDH 3VFEA 4JK6A 4UEHH 1HGTH 1C9PA 4B75A 4MPUA 2F9OA 3M37A 2P16A 1CGJE 1S82A 2BY9X 1AU8A 4NSYA 4X1PU 1XXDA 2XRCA 3SU4A 1UTJA 4WXVA 1GI8B 4INKA 1HPGA 1C5MD 3K6YA 3RC4A 3RXIA 7ESTE 1GBBA 1C2IA 2VGCC 1HJ8A 5A0CA 2VNTA 4WXIA 1T4UH 2B8OH 1OSSA 4CBNA 2BD7A 1TNLA 5FX6A 1HAGE 2ANKH 4J1YA 1GI4A 4DT7B 4FVDA 4NG9H 3TJUA 2Y5HA 4JYTA 1M9UA 1K2I1 2Z6BD 3BIVH 3SV9A 1QJ6B 1HJAC 2ANYA 1ELGA 1S84A 2BXUH 3ZZ8A 3SI3H 2ZZUH 2EC9H 5DP6A 3A82A 1CBWC 3N7OA 3GICB 4B71A 1C1SA 3NKKA 2RDLA 2ZHDA 4A6LA 1SHHB 3ELAH 1L2EA 3A8AA 5DP3A 1H8DH 2TBSA 2ZU4A 3QDZB 1HDTH 4NZLA 2XBYA 1OWJ