5CE1A

Crystal structure of serine protease hepsin in complex with inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
Knots found
sequence length
369
structure length
361
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASGLQLGVQAVVYHGGYLPFRPNSENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease hepsin
publication title Crystal Structure of Serine protease Hepsin in complex with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 361
sequence length 369
other databases KnotProt 2.0: S -31
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 5ce1A01
1PFXC 4UEHH 1XUFA 2A7JA 4D9QA 1SB1H 1NZQH 2AGGX 1G2LA 5FBIA 3SU5A 3LGUA 2NU3E 1ZSLA 2OC1A 2VIQA 1P2NA 1EATA 5DP3A 4WH8A 2FS9A 1V2JT 3ATIA 2FI5E 1KTSB 4D7GA 1ELFA 3GICB 1GBIA 1O2VA 2AIQA 2PUQH 3CS7A 1C1TA 1H9IE 1WQVH 1HCGA 9LPRA 1SOTA 2PKAB 4KGAA 4ZKRU 2NU4E 1MKWK 2B7DH 2BZAA 3GCOA 3ZV8A 1THSH 2UWOA 2XCFA 1FAXA 1DDJA 1BBRE 3MYWA 1Y5UT 1EXFA 2ULLA 1C1WH 3LONA 1MQ5A 1KLIH 1TGTA 2GCHG 3SJ9A 5L30H 5F6MA 1S82A 2H1UA 4DGJA 3UNQA 2UWPA 1GMHG 3BF6H 1FN8A 2A1DB 4FUIA 1ZMNA 1ZSJA 2Z9LA 2G4TA 5EG4A 1SVPA 1GGDB 5HM9A 4NIXA 1G37A 1SC8U 3MH7A 3SQHE 3ZZCA 4FU7A 3PMJA 1GBFA 2FYRA 3F6UH 1BZXE 5AFZH 2P8OC 1GI7B 1Y3XA 3RXFA 3SV7A 4I8KA 4YOIA 1O2RA 1TMTH 1O2TA 1CT4E 2A4RA 1DSTA 2BDHA 2ZGCA 1YM0A 1BUIA 1YCPM 1UVTH 3TK5A 4INKA 4AX9H 1HAVA 4X8UH 1DT2A 1Y8TA 1QGFA 1C1NA 2PLXA 2FOGA 2BDAA 2PTNA 1MD8A 1IHSH 1NFXA 2OY3A 3E0NB 3EAJA 5HGGA 4ZKNU 1DUEA 1GBBA 3NPSA 3UUZA 1ETSH 1VJAU 1GBDA 3ZZ5A 2F9NA 1MQ6A 1CA0B 4XBBA 1XVMA 5BPEA 4YOJA 5E0HA 1CVWH 4YO9A 1IQKA 3NK8A 3RMMH 1FDPA 1TGCA 1YLCA 1ZTLA 3KL6A 3R0FA 4GPGA 1NESE 1TNLA 1B5GH 3SGAE 1EQ9A 5DGJA 3PMHB 4JCNA 2CF9H 3RLWH 1GBAA 1F0TA 3QK1A 1DPOA 2ZDNA 1MTNB 4Z0KA 1OWKA 1TGNA 4IMQA 1C2EA 1SLVB 4AYVB 2F9UA 6CHAB 1FY1A 2AFQB 4X2XA 4X6OA 1ZHMA 5EODA 3SU6A 3GDSA 3K6YA 4ISHH 3A85A 4K8BA 2Y5HA 2GMTC 3I29A 1HJAC 3RLYH 3LGTA 3ODDA 4IS5A 2PSYA 4R0IA 1FMGA 2ZFQH 5DP8A 4CH8B 3RXEA 4INLA 4ISLA 1TIOA 1SL3A 1O39A 4AZ2B 4Y7BA 2Z3DA 4BNRA 1ELVA 2VIWA 1V2WT 3BG4C 1T32A 1A4WH 4K1TA 3MWIU 3SNEA 1MZDA 4LZ1H 1WQSA 3U1IB 5HMAA 1A5HA 1ANDA 1B0EA 1K1JA 1NFUA 5FX5A 5LH8A 3UOUA 3UR9A 5JB9S 2ZDMA 1C1SA 3PLPA 3GCHB 1VGCC 2GCTB 2JETB 2JKHA 1P3CA 2GZ8A 1YBWA 5FPYA 3FZZA 1HJ8A 1SGTA 4I8JA 4JZEH 1ETRH 3A83A 4A1TA 1CHOG 4NG9H 1IQIA 1ARCA 1XXFA 2A45B 4JK6A 1A2CH 3W94A 1LMWB 1S0RA 2J92A 2FODA 3GY5A 2BZ6H 2V6NA 3MH5A 1ZPCA 3RMNH 2ZU2A 2ANMH 3D62A 1SLXB 1FJSA 1BMAA 3SNCA 2Q6GA 4R8TB 3ZZAA 4MPXA 6GCHF 3K65B 4DT7B 1V2UT 1YPGH 4ABFA 5TJXA 1SOZA 3TGJE 1W14U 3IG6B 3EGKH 2BLWA 3B23B 1F92A 1H9LB 1MTWA 5F8ZA 4OS2A 1QHRB 1DWDH 2FDAA 4OGXA 5L6NH 1BT7A 3ESTA 1NRQH 5ETXA 4UFGH 1GG6C 2WINI 4ISIH 3TVJB 1CT0E 1C5QA 1O3AA 2SGEE 1BOQA 1DS2E 3KQEA 5FX6A 1WCZA 1KDQB 2EEKA 1XUKA 1XUJA 1PPCE 1SGCA 1SFQB 1CGIE 3A7VA 1BJUA 2BQ7B 4OS1A 4FU8A 4ZMAH 4HZHA 1VCQA 4LK4A 4H42U 4X1SU 1ELTA 2AGIX 2FOHA 1NPMA 1GHYH 5G4BA 4BXSA 1Z7KA 1MCVA 3LJOA 1OKXA 3A88A 1GBMA 3LOXA 2H5DA 5EPYA 4FUBA 1GHBF 2AYWA 3ELAH 4UONA 1DSUA 1IOEA 2BD2A 5GCHG 1UVUH 3U69H 4A1XA 1MMJN 3EQ0H 5A0BA 1O3NA 2ZTYA 3BN9A 3T25A 4YT7H 1SGFG 8GCHG 1ARBA 1FN6A 2XNIA 3MU1A 2C3SA 4X6MA 1GI5A 2VNTA 2OTTX 4O9VA 2SGFE 2P8OB 4IW4E 2CHAB 3RM2H 3V7TA 5E2PA 1ZPBA 2VJ1A 4BTUB 2VIPA 3LPRA 1MKXK 4WMDA 2BXTH 1P57A 4X1PU 2A7HA 2UUJB 3P92A 3ITIA 1L1NA 4MLFB 1N6XA 1O34A 2OXSA 1EAWA 1X7AC 1VR1H 1O36A 2TGDA 4JZDH 2HLCA 4XDEA 2WPHS 4WH6A 2VVUA 1V2TT 2SGPE 1C5OH 1UMAH 2J9NA 2WPLS 3T29A 9ESTA 3ZVDA 3EA9A 3SV9A 1OOKB 3T27A 3F9EA 1C4V2 4K5ZA 1KY9A 4DW2U 1O2IA 2B0FA 1V2RT 2A31A 2GDDA 2QY0B 1O3HA 4ZUHA 3LGWA 1SGPE 3P95A 1GMCF 1QJ7B 1P9SA 2OQUA 2VH0A 2Z3CA 3B8JA 4A5TS 1SPJA 1K28D 1TBRH 1W7GH 1A61H 2HPPH 3URDA 1SGEE 3VXFH 1AD8H 3A84A 4A92A 4RSPA 4CR9A 1QL8A 5GXPA 3T28A 1UHBB 2BVSH 2OD3B 1FAKH 4WVPE 3L33A 1PYTC 5JFBA 3HATH 4H4FA 3CS0A 1TQ7B 3DUXH 4GCHF 1OX1A 3PO1B 1A3EH 1L0ZA 1TLDA 1GBHA 1AWFH 2KAIB 3M61U 1T7CA 3KF2A 2GMTB 1AE8H 1AN1E 4ZKSU 1HJAB 1UTLM 4UFEH 1O2LA 1O37A 1QURH 1JBUH 3BTQE 5J4SA 1UK4A 1WTGH 2O8MA 1NM6A 1QBVH 4J1YA 8ESTE 2ZGJA 1GGDC 3SJ8A 3A8BA 2A4GA 2BQ6B 2ASUB 3FP6E 3N7OA 3U98H 1O3OA 5A09A 3BG4B 5J4QA 1O3JA 2P3TB 3ZVEA 1F5LA 1G32B 4TWYA 3NZIA 1AKSA 1O5FH 3KQDA 2NWNA 4NZLA 4NSVA 1RD3B 1ELEE 4JYUH 1T31A 1GJBB 1UJ1A 1O3GA 3GOVB 1O5FL 4BXWA 2RDLA 2XYAA 1G36A 2OC0A 3OYPA 3RM0H 1C2DA 1O33A 2OQ5A 1GHAG 4BAMB 1O38A 2ZU5A 3ZZ3A 3RU4E 3MNBA 4CHAB 1F0UA 1YPKH 1W2KH 3F9GA 2FM2A 1CO7E 1GWAA 5ESBA 3ZZ9A 2ZIQH 3E91A 1G2MA 3ATMA 1LQEA 1L2EA 3Q00A 1NFYA 1SSXA 3NUMA 4U01A 3SW2B 3TIUA 2BYAX 1FY8E 1KXAA 4BANB 1DXPA 3UQOA 1HXFH 3WY8A 2YNBA 2QXJA 3ZYEA 1XXDA 2G8TA 6LPRA 1QFKH 1HUTH 2OYAA 4X8SH 3TJNA 2XC0A 1F0SA 1UCYH 1FLEE 1L4ZA 1THPB 5AFYH 1PPEE 5EQRA 2NU0E 1CGJE 1TX6A 1TFXA 1HV7A 1DY9A 1PPHE 4I33A 4LXBH 4Y71A 1ACBE 1IQNA 1ZJDA 1EOLA 3P8NA 1OSSA 2RCEA 1OP0A 1GDQA 2RG3A 1PPFE 2Y81A 1JOUB 1MUEB 2A5IA 3TK6A 4BAHB 3MU5A 3SO3A 3S0NA 1MTNC 2HNTF 5CHAC 1S83A 1C2HA 3GDUA 3HKIB 3ZV9A 1UTNA 1AFEH 5E0GA 1UK3A 1MZAA 1G3BA 2FZZA 2GTBA 2OINA 2WPKS 3B9FH 4WY3A 1FV9A 1F2SE 2PSXA 3M36A 1FNIA 3STIA 5A8ZA 1GVZA 1QNJA 1SQTA 1THRH 3M3SA 2STBE 2CMYA 3PMBB 3BV9B 1H4WA 1GJ4H 5T6DA 2WYJA 1O3BA 3UQVA 1PPBH 5C5OA 3KN2A 4IBLH 1H1BA 2ZU3A 2H5CA 2LNCA 1TPSA 3M35A 2BX3A 4K69A 5A0AE 2QGRA 1O2XA 3MI4A 4ABEA 2D8WA 2PGQB 3PWCA 1AZ8A 1AU8A 1E37B 1TB6H 4SGBE 4KTCA 4RKOB 1N1LA 3UREA 1HAIH 3ATWA 1TWXB 2FOBA 1C5WB 2BLQA 2BY7X 4DIHH 1BRAA 3P70B 3SU3A 2GCTC 1P04A 1TE0A 3SU4A 2DUCA 3O8CA 1AHTH 1HAZB 4AYYB 1DOJA 2BY8X 2BD8A 4I7YH 2SGDE 1ZRKA 4B74A 1ESBA 3VB5A 1GDUA 2ZGXH 3M5NA 5E2OA 2VIVA 5LPEA 1LPGB 2BQWB 3RXJA 3RMOH 5JBCS 2H9HA 1HJ9A 1HBTH 1EP5A 1DVAH 1A1RA 1KXCA 1LCYA 2P95A 1TALA 4AGKA 2ZFSA 5C1UA 1QL7A 3D49H 2A2XH 3GYLB 3E8LA 1AFQC 3MHWU 5EW1H 3LU9B 1J9CH 4X2WA 2P93A 1E0FD 1T4VH 1AVGH 4NWLA 4FUEA 1G3EA 2ZGHA 2PR3A 3V12A 1ANBA 1HYLA 1J8AA 1O2UA 1WSSH 3A7XA 1ELCA 1NC6A 2ZC9H 1VITF 3O8BA 2Z7FE 2BMGB 1TMUH 3UR6A 3PYHA 3SU1A 2CJIA 3SZNA 4IGDA 3GY3A 1AO5A 3H7TA 4JYVH 1QA0A 1GJ7B 1C9TA 4Y0YE 4X1NU 2QXGA 3NXPA 1S81A 4Y10E 1TYNA 4H6TA 1P09A 3A8DA 1WU1A 3M3TA 5HM2A 2XWBI 4YM9A 5A8YA 2HNTE 3RXVA 1C2JA 4JYTA 3I78A 3SNBA 2SGQE 3M3VA 1P2JA 1LDTT 1O5BB 1O2OA 4CRGA 2HGTH 3TGKE 2OLGA 3GCTF 5L2ZH 2GDEH 1BIOA 1V2NT 4FXGH 1C5YB 1FIZA 1BDAA 4ABAA 4KTSA 2A5AA 4KELA 3QWCH 1SGYE 4J2YB 2Y7ZA 2ZGBH 3ZZDA 3UY9A 1TONA 1P11E 2ZHQH 1O5CB 2BM2A 3NKKA 1YYY1 3SI4H 4CH2B 2CHAC 1AUJA 2P16A 1KSNA 4I8HA 1NU7B 2XBXA 2XTTB 1RTFB 1JWTA 1V2ST 1A7SA 4ABIA 1N8OC 3A7YA 2V0BA 1DANH 4K1SA 1SGFA 3U8RH 2M5TA 1XVOA 2O8UA 1TNGA 1GMDG 2O8TA 1UO6A 1VCWA 3PM3A 4HI3A 2BDCA 1NRPH 1O3MA 3A7WA 1ZJKA 1HNEE 4GHQA 2ZCLP 5ESTE 1HDTH 4CRFA 3LH1A 5GIBA 1TABE 2FMJA 1P2MA 4XFQA 2Y6TA 2ZDKA 1J14A 1C1RA 1B0FA 4CRBA 1J17T 1LHFH 1MKWH 2H6MA 3BEUA 1C4Y2 1RXPA 5FXLA 1ZMJA 4DURA 1O2PA 2FS8A 1Z8IB 4GUXA 3HK6B 3SJIA 1RIWB 2ZQ2A 1S6FA 1FUJA 3S7KB 4D7FA 2ZFRH 4INHA 1UVOA 3E3TA 4ZXXH 4OS6A 1UTMA 5C1XA 3QZRA 4AG1A 5CHAB 1C5UA 3P8FA 1NTPA 2QN5T 3PO1C 4I8GA 2O8WA 3RXSA 5DP6A 1H8DH 3TLOA 2ZPSA 4AN7A 1RTKA 4Q7YA 1NRRH 1TMBH 3LGYA 1C5LH 3OSYA 1O31A 1IQEA 2IPHA 3PWBA 5C2ZA 1EB1H 2FESH 1QRXA 1RTLA 1FZZA 2EI8A 3OX7U 1C5TA 2CN0H 3ZZ6A 2P94A 2F9PA 2H9EH 2R3UA 1P02A 1YPEH 1HAHH 4NCYA 2Y80A 2QCYA 4A7IB 1EKBB 1L4DA 2Z9IA 1L1JA 1LTOA 4ZHMU 5DKMA 5C5NA 1LPKB 1PQ5A 1RRKA 1VJ9U 3ZZBA 3GDVA 4B76A 3SBKA 2PKAA 1D6WA 2D1JA 3PLBA 3UWIA 2BLVA 2UWLA 2XXLA 2TPIZ 4JMYA 4CREA 2ILNA 2O8LA 1QRZA 3VFEA 5I46H 1BMLA 1NROH 4U2WA 1DLEA 1KLJH 4MVNA 4TY6A 1NO9H 3VGCB 4DY7B 4X6PA 1SLUB 4TY7A 4CHAC 3RXPA 3T62A 4LOYH 1QB1A 1ZYOA 4XBCA 1SMFE 4BAOB 2G5VA 3DHKH 3LJJA 3LC5A 2FI4E 3PTNA 1ELBA 2R9PA 2WPIS 2FOCA 1SGQE 1BQYA 3RC5A 4X2YA 4XSKU 4CRCA 3ZVGA 1IQLA 1GI4A 4CR5A 2BD4A 1CQQA 2RA0A 2STAE 3NWUA 1AFQB 4AORA 3S9CA 2VWNA 3AW1A 4NZQA 1C5SA 3TITA 1BJVA 3GY8A 1GHBG 3MTYA 2F83A 1UTPA 1V2KT 1WUNH 1W3CA 1GHWH 1O5DH 2ZTZA 1BMNH 2F9OA 3A87A 2FIRH 5T6GA 1MD7A 4O97A 3R3GB 3RXLA 2GV6A 3M5MA 1D6RA 2AMPA 1LO6A 2ZU4A 4FUFA 3BTHE 4HFPB 4Y6DA 1CHOF 4MNXA 5GJ4B 2ZO3H 3RXDA 1WV7H 2C8XB 4IMZA 3SORA 1DUAA 5AVDA 2BDBA 1HAYB 1SHYA 2AMQA 3MU4A 1EZXC 2ZEBA 3UWJH 1C5RA 4DIIH 3SJOA 1C5NH 4X8TH 1W7XH 7GCHF 1O2HA 5EPNA 1C9PA 1XKBC 1VZQH 1C1QA 2ZNKH 3MU0A 1E38B 1PPGE 3FZDA 1AQ7A 3LT3A 2AERH 2C8YB 1TA6A 5BRRE 1K1IA 2HALA 1W12U 2BOKA 2W26A 4WWYA 2G55A 1O2SA 2VH6A 4NIWA 3OU0A 1GCDA 3W95A 1EPTB 2ZHWH 1GMCG 1Q31A 4YLUA 1ZSKA 2A5KA 2ZI2H 3GY7A 1TQ0B 3SUEA 5DP5A 4JZFH 3QTVH 2QF3A 1IQHA 2EA3A 2P59A 4Q7ZA 1N8OB 3Q76A 1DLKB 1EX3A 1LVOA 1PQ7A 2BDIA 3MO6A 3RXTA 2TBSA 4A6LA 1AMHA 2NU2E 1CBWC 2DE9A 2H9TH 5JBBS 1WOFA 3E6PH 1JMOH 3VB7A 2ZFPH 1ZGVA 1O2MA 1TNKA 1HFDA 2GV7A 4GCHG 2ANYA 5EXLA 1B7XB 1ZLRA 2BDYA 1DWEH 3KQBA 3RC6A 2GX4A 1KXBA 1A46H 3GISB 3ZVFA 1BCUH 1YLDA 3TJVA 1CE5A 1O3DA 3RP2A 2P3FH 1MTVA 1SGDE 2GZ7A 1TGSZ 1YPHC 5EW2H 1Z1JA 1MU6B 1FPHH 1NRNH 3VB3A 3V0XA 4AFQA 1GJ9B 8GCHF 3RMLH 3BIVH 4Y8ZA 1P05A 2ZU1A 1MAXA 1P2QA 1W8BH 1ELDE 1GJ6A 4ISOA 3TU7H 5SGAE 3SGQE 1O2YA 4FUDA 4AGJA 4U32A 1GJCB 2IN2A 5LGOA 1BRBE 2TGTA 2OTVA 1OWEA 5GPIB 1ZHPA 1N6YA 2XBWA 4NIYA 2PKSC 2GGVB 1TOMH 5FPTA 3F1SB 3QZQA 2VIOA 1BTPA 2BY6X 1BTYA 1LVMA 3ATKA 2CF8H 2VVCA 2GD4B 2W7SA 4B71A 1P06A 2VWOA 1MU8B 3F68H 4X6NA 4XE4A 5L2YH 4ZROA 4NGAH 2TIOA 2OC8A 2BY9X 4Y76A 1LHGH 3A7TA 3Q3XA 4QT8C 1C5PA 1UCYK 1NN6A 1H9HE 2D2DA 4X8VH 1EJAA 1BTXA 2FPZA 4NA8A 1KDQA 7KMEH 1WAYB 3CENA 4JK5A 1KXEA 5E8EH 1HAPH 1UTJA 1ZOMA 4MPWA 4NA7A 1KXFA 3RXHA 4DJZB 2A0QB 5F03A 3P8GA 1G3DA 1O0DH 2BB4A 4K60A 2GZ9A 5TCAA 1F0RA 1DE7H 1PJPA 1TAWA 1TA2A 1BBRH 5TCCA 3I77A 5JYIA 3STJA 4K3JA 2ANKH 1IQFA 1C2GA 2WUBA 2B8OH 3BSQA 1BTUA 2R0KA 4FUCA 1MBQA 1W0ZU 4Y7AA 3ZYDA 2FEQH 1GI3A 1V6DA 1GI6A 1DITH 1K22H 1TPPA 3QO6A 1BITA 4GVUA 5T6FA 3SN8A 3QUMP 1UVSH 1OWHA 2K1QA 3TJUA 5AF9H 1ETTH 4Y8XA 1GI2A 2R0LA 3A89A 1C5MD 3U1JB 1GCTC 1K9OE 1QB6A 1FXYA 1O2QA 2FOEA 2Z3EA 4MPVA 3SUDA 3Q3YA 1O3LA 4BAQB 3UNSA 3QDZB 1TNIA 1RIWC 3UTUH 3LC3A 3RXBA 1XUHA 2WV5A 3SI3H 2OC7A 3EA8A 4M7GA 4ISNA 2PFEA 5C20A 4MNVA 3SU0A 3PLKA 3MNCA 1T8OA 4B73A 1P2IA 1GJAB 3EYDA 4UFDH 4BOHA 1QIXB 2J94A 1P10A 4H6SB 1UTQA 1LPZB 1XUIA 1YC0A 4K2YA 2G5NA 1DWBH 3GY2A 3AAVA 2FTMA 2GVFA 1O3IA 3RXGA 2W3KA 1DXWA 1ANCA 3H7OA 4I32A 2XC5A 5FAHA 2P3UB 3A7ZA 4GHTA 4O3TA 4ZAEA 2HOBA 2HWLB 4FUJA 3RXKA 1RGQA 3QGJA 4DCDA 2QF0A 3DA9B 2C8WB 3SUFA 1UHBA 3LIWA 1HRTH 2V3HH 1IHTH 2ZCKP 4Q7XA 1O5GH 1TRYA 4U30A 2QV1A 2AIPA 1YKTA 1O30A 5DP7A 3LDXH 5EXNA 1ZMLA 2XWAA 2BLOA 4YLQH 1GI0A 5A0CA 2FP7B 3MNSA 3FP7E 3BIUH 3OTJE 2YNAA 3PROA 1S5SA 2KAIA 2OP9A 1C5XB 4F4OC 3ZVBA 3RDZA 4IC6A 2FX6A 3AVZA 3FVFB 2UUKB 3S7HB 3VGCC 4OS4A 1RJXB 3TK9A 1AZZA 1A5IA 2QAAA 1WYKA 1HAVB 2XC4A 1SGNE 4OS7A 2UUYA 3BTEE 1SHHB 3RXQA 2BDGA 3ZVCA 4HGCA 2ESTE 4JZIA 4UD9H 2BTCE 3F9FA 2XBVA 2QYIA 2J38A 2SFAA 3UNRA 3O8RA 2FOAA 1GJDB 4Y79A 4CBNA 1CBWB 2D26C 1J16A 2ZPRA 2Q1JA 3DFLA 4NIVA 1O3PB 2FWWA 2F91A 3BTGE 1EOJA 1Y5BT 3TPIZ 4DVAU 3RU4T 5F8TA 3KNXA 2ZA5A 5F8XA 1YPJH 3LKWA 3V13A 2JOPA 1GBLA 1QJ6B 4K1EA 2FO9A 4XBDA 1C2LA 3M7TA 3VXEH 5JB8S 3BTKE 2ZZUH 4MG3A 1LHDH 1EUFA 3A8AA 1V2OT 4GSOA 1C2MA 2ZP0H 1XX9A 2AS9A 3RXAA 3GCTG 3GYMA 3FFGA 2ODYB 1GJ8B 1ID5H 3ZVAA 3TGIE 4E7RG 1O2JA 2WV4A 1HB0B 2R2MB 1P2KA 1JRSA 1TX7A 1O3FA 2Z9JA 1BHXB 3T26A 1AI8H 1CHGA 4AB9A 1EAUA 1ESAA 2PKSB 3SV6A 1K1PA 1GHXH 3P8OA 1KYNA 1DICA 4LZ4B 4TPIZ 1LQDB 3PMAB 1C2IA 1HXEH 3RC4A 1GL1A 3HK3B 5C3NA 1GI1A 1QBOA 1TGBA 4JZ1A 1YCPH 1G30B 1ZTJA 3CP7A 1AVXA 3RUOA 1HAGE 1H8IH 2YOLA 1EAIA 4UDWH 5K0HA 2GT7A 4X1RU 2ZHEH 4X2VA 3PTBA 1BY2A 4AFSA 2QXIA 3QN7A 1PQAA 4RKJB 1MTUA 3HPTB 3OY5U 4CRAA 3PB1E 4MPUA 3BTDE 1EPTC 2HRVA 3FAOA 1TNJA 1O2NA 2JH0D 2NU1E 1S0QA 4Z6AH 3MFJA 2I6QA 5CE1A 3QX5H 2ZQ1A 2Y7XA 4MNWA 1C4U2 1JXPA 1K1MA 1XKAC 1ZRBA 3G01A 4FU9A 4FUGA 4ABDA 1GBCA 1UCYE 2ZDVH 4YZUA 5A8XA 3AASA 1P3EA 1YGCH 1T8NA 1V2QT 3TH2H 2OBQA 1QRWA 2ALVA 1AB9C 3MH4A 4YT6H 3RXOA 3A82A 3V3MA 1ABIH 2VINA 5GDSH 2ZDAH 3TH4H 2A2QH 1A3BH 2GCHF 2LPRA 3BTME 2VGCB 1P9UA 1GMHF 1NS3A 1GCTB 2B5TB 3MMGA 4GAWA 1S85A 2ZDLA 4MDSA 5FCRA 1CGHA 1SLWB 3BEIB 2Y5FA 1GBJA 1C2KA 1HIAB 3TJOA 2C8ZB 1AGJA 3SNDA 2GKVE 4Y8YA 1PPZA 4D9RA 2GP9B 5GWZA 1W10U 1Y3UA 3E0PB 3KGPA 1V3XA 3BTFE 2ZG0H 3MO9A 1Z8JB 2Q6DA 1EZSC 2ZFTA 3E1XB 5HYOA 2ZFFH 5ABWA 4MTBA 1O5AB 2QXHA 2VWLA 2J95A 2A4OA 4VGCC 4MNYA 2BD5A 1A0JA 1GMDF 3U8TH 4ABJA 1BRCE 2PTCE 2XRCA 3EA7A 1GHZA 1K1NA 2R2WU 1FY5A 5FCKA 5FPSA 4B2BA 1ZZZA 1EAXA 1JIRA 3K2UA 4BAKB 2FXRA 1OXGA 2BVXH 1GBTA 2AGEX 3PV4A 4AFUA 1YF4A 4XOJA 4FUHA 1INCA 2C90B 1IQGA 3AAUA 3TNTA 4WMEA 3UFAA 2CXVA 1YPMH 1QQ4A 1OYTH 5DJ7A 1WTHD 1QY6A 1L1GA 1Z1IA 1C1UH 2PHBA 3BTTE 1GL0E 2BY5X 5EQQA 3P6ZB 1XM1A 5DK1A 3FP8E 4ASHA 6GCHG 2XW9A 2BHGA 1LKAA 1P57B 1LHCH 4AG2A 1GPZA 1TOCB 3SOSA 1SFIA 1GDNA 4SGAE 3RU4D 4FVDA 3DT0H 1P01A 1OWIA 1Y3YA 2EI6A 4NA9H 1OPHB 2FOFA 1Z6JH 2OBOA 1OYQA 1K2I1 2ZHDA 1V2LT 1DFPA 1ELAA 1P0SH 2ANWA 5JBAS 3DFJA 3SV2H 1T8MA 2EC9H 2WPJS 1W0YH 3KQCA 2C4FH 4YESB 3A81A 2VB0A 5DP9A 1W11U 4AOQA 2FX4A 2RA3A 1GI8B 2AMDA 4GLYA 1QTFA 1JIMA 4ZH8A 2ZWLH 3D65E 4CBOA 5CMXH 3QTOH 4TYDA 3SGBE 1OWJA 4ESTE 1OP2A 3URCA 1C1VH 1F5KU 4TWWA 7GCHG 4UE7H 1P12E 1AVWA 3MOCA 2JH6D 2VVVA 3F9HA 4OS5A 2BOHB 2V35A 1YPLH 4CRDA 1QA7A 1U6QA 1ZGIA 1ESTA 2ODQA 4WF8A 1D3DB 1VCPA 2WPMS 5FHTA 2Z9GA 1E35B 1ZPZA 3S69A 1Z8RA 2WYGA 4NFEA 3BTWE 3L6PA 1P8VC 2ZCHP 2SNVA 3A86A 1PQ8A 4B75A 2EI7A 2QIQA 3MNXA 4DOQA 3OY6U 4MQAA 3P17H 3SUGA 2Z6BD 3UPEA 3T5FH 3A80A 1KTTB 4NFFA 4O03A 1FPCH 2FI3E 1HIAA 2B9LA 3SHCH 2A4QA 1TPAE 5JPMH 3VPKA 1GBKA 2F3CE 3MH6A 2F9VA 1ZHRA 1OP8A 1AE5A 1UVPA 3LGIA 3ENSB 1C1MA 1AKSB 1AUTC 1K1LA 4I31A 3LGVA 5K7RA 3HKJB 4WXIA 1CA8B 3QGNB 1BTHH 2BXUH 5B6OA 1KXDA 1TRMA 1Y3VA 1D3QB 1QJ1B 3M7UA 1P2OA 5JDUB 2FYQA 3T2NA 1AIXH 1D3PB 2HVXA 4FVBA 3KEEA 3E90B 1YP9A 2TGPZ 1E36B 5DO4H 1O2GH 1ZTKA 1Y59T 1C2FA 5EGMA 1CSOE 1ABJH 4ABGA 4PROA 1V2VT 4D76A 1HPGA 1KIGH 1O2ZA 4YOGA 1IQJA 2R3YA 2ZHFH 1EZUC 2AH4X 4K8YA 4X0WU 2CGAA 1LVBA 1O5EH 1TRNA 1D3TB 4ZKOU 4ZHAA 4E05H 2PGBB 3SU2A 1O5EL 6ESTA 3QLPH 3C1KA 1QCPA 1AB9B 1F7ZA 1SQOA 3UOPA 1BMMH 3VB4A 2XBYA 2THFB 2HPQH 2WUCA 1MAYA 5GCHF 1SR5C 1PYTD 3IITA 3TNSA 5FBEA 1EJNA 1C5ZB 4RN6A 2FLRH 1S6HA 2TRMA 1CU1A 2OUAA 1J15A 3SHAH 3ZZ8A 1F5RA 5AHGH 1UTOA 4ZXYH 1FY3A 3D23A 1O32A 4F49A 1C5VA 2F9BH 4BTTB 1ZR0A 1W13U 2SGAA 1BBRK 5EXMA 1G9IE 1TBZH 3S9BA 4BTIB 5LPFA 5LPRA 7LPRA 4OGYA 3KCGH 2PWXA 1XMNB 8KME2 2A7CA 2CV3A 3EE0B 5I25A 1XUGA 1MTSA 4NWKA 4VGCB 1LKBA 1Q2WA 3AW0A 3ZZ4A 5EU8A 1Z71A 2G4UA 1JRTA 1P03A 4D8NA 1MKXH 1SG8B 1T4UH 4UFFH 1EJMA 1D4PB 4AFZA 2PUXB 3DD2H 3U9AH 1OWDA 3E16B 5IDKA 2ZECA 1BTWA 5T3HA 4KP0A 8LPRA 1O3EA 3JZ1B 4WJG2 1C1OA 4AB8A 4B1TA 1O3CA 3VEQB 3KHVA 4B2AA 1E34B 3VB6A 1ANEA 5EOKA 4HTCH 4A1VA 2JA4A 1O2KA 1BA8B 2G81E 2DE8A 2A32A 2W3IA 2HNTC 1Z8GA 2JP0A 1O35A 1Y3WA 3GY6A 1CT2E 5JBTA 3FANA 1TNHA 2V3OH 3HGPA 1DM4B 4I8LA 3UIRA 4ABHA 4KKDA 1GHVH 1FQ3A 5PTPA 1A0HB 1BHXF 3C27B 1VGCB 4DG4A 2BD7A 2J4IA 4ABBA 2VGCC 1EPTA 2AEIH 3KIDU 1GVLA 3M5OA 4THNH 2W7UA 1NT1A 5IYTA 1Q3XA 1V2PT 1C1PA 1QR3E 1Z6EA 2FTLE 1FIWA 4ZHLU 3SNAA 3EDXB 3S9AA 1AY6H 3NCLA 5EQSA 3A8CA 1T8LA 2UUFB 1EP6A 3BG8A 2W5EA 1CA0C 1UTKA 4NSYA 5C67A 1NRSH 3RXIA 5HXFA 1QBNA 4Y11E 1DY8A 2VIDA 1MCTA 1WBGB 3ATLA 1QB9A 5DPAA 3MU8A 2I6SA 1GHAF 1NU9A 1LHEH 2TGAA 1HAOH 2FOMB 1O2WA 3K9XB 1UK2A 2VWMA 1BB0B 2OCVB 1NY22 3ZZ7A 2Q6FA 2IOTA 1GI9B 3IWMA 1TPOA 1G3CA 1SGIB 5E0JA 3L3TA 4Q80A 3U8OH 2Z9KA 1EB2A 6CHAC 1S84A 1SGRE 1GG6B 1FI8A 2ZTXA 2PW8H 1FONA 1LVYA 2FLBH 3GY4A 4YTAA 4E06H 1BRUP 2G51A 3Q77A 2Y5GA 2J2UA 2GT8A 1GJ5H 1HAXB 1TX8A 2PV9B 3GCNA 2Z94A 1EZQA 1O3KA 2IJOB 2J34A 3RXRA 3M37A 2BD9A 1QQUA 4WXVA 3SQEE 2XCNA 3H5CB 1IAUA 2BD3A 4X1QU 5DG6A 1VITH 3M7QA 2QA9E 1HGTH 1BTZA 1SI5H 5DP4A 1A0LA 1RFNA 1QL9A 1GVKB 1VITG 4IN1A 2ODPA 3O8DA 2SNWA 3GCHC 4KTUA 3RXUA 1AWHB 2JETC 1YPHE 1K21H 2C93B 1A5GH 2QC2A 1D9IA 1SQAA 3SJKA 5A2MH 3TH3H 1KLTA 1SBWA 3ODFA 4IN2A 4WMFA 3RXMA 2BVRH 1MBMA 7ESTE 1K1OA 1YCPK 1NFWA 3MO3A 4Y0ZE 2ALPA 2H2ZA 2VU8E 1RS0A 2ZPQA 2ZKSA 1IQMA 3BEFB 2G52A 1DX5M 2BX4A 4B2CA 1EASA 2G00A 4E7NA 1MH0A 1DWCH 2Y82A 2ZF0H 4TPYA 1ORFA 3SV8A 1ELGA 2O9QA 1TBQH 1Y5AT 1GBEA 3JZ2B 5H4IB 3Q3KA 4Q2KA 3M5LA 1V2MT 4O3UA 2JH5D 1M9UA 1FY4A 3HGNA 4IC5A 3RXCA 1HLTH 3K6ZA 1OS8A 5C1YA 3LH3A
chains in the Genus database with same CATH superfamily
1PFXC 4UEHH 1XUFA 2A7JA 4D9QA 2KM0A 1SB1H 1NZQH 2AGGX 1G2LA 5FBIA 3SU5A 3LGUA 2NU3E 4B6EA 1ZSLA 2OC1A 2VIQA 1P2NA 1EATA 5DP3A 4WH8A 2FS9A 1V2JT 3ATIA 2FI5E 1KTSB 2OK5A 1ELFA 3GICB 4D7GA 1GBIA 1O2VA 2AIQA 2PUQH 3CS7A 1C1TA 1H9IE 1WQVH 1HCGA 1SQRA 9LPRA 1SOTA 2PKAB 4KGAA 4ZKRU 2NU4E 1MKWK 2B7DH 2BZAA 3GCOA 3ZV8A 1THSH 2UWOA 2XCFA 1FAXA 1DDJA 1BBRE 3MYWA 3SZEA 1Y5UT 1EXFA 2ULLA 1C1WH 3LONA 1MQ5A 1KLIH 1TGTA 2GCHG 3SJ9A 5L30H 5F6MA 1S82A 2H1UA 4DGJA 3UNQA 2UWPA 1GMHG 3BF6H 1FN8A 2A1DB 4FUIA 1ZMNA 1ZSJA 2Z9LA 3KYGA 2G4TA 5EG4A 1SVPA 1GGDB 5HM9A 4NIXA 1G37A 1SC8U 3MH7A 3SQHE 4ZCNA 3ZZCA 4FU7A 3PMJA 1GBFA 2FYRA 3F6UH 1BZXE 5AFZH 2P8OC 1GI7B 1Y3XA 3RXFA 3SV7A 4I8KA 4YOIA 1O2RA 1TMTH 1O2TA 1CT4E 2A4RA 1DSTA 2BDHA 2ZGCA 1YM0A 1BUIA 1YCPM 1UVTH 3TK5A 4INKA 4AX9H 3F3BA 1HAVA 4X8UH 1DT2A 1Y8TA 1QGFA 1C1NA 2PLXA 2FOGA 2BDAA 2PTNA 1MD8A 1IHSH 1NFXA 2OY3A 3E0NB 3EAJA 5HGGA 4ZKNU 1DUEA 1GBBA 3NPSA 3UUZA 1ETSH 2KR7A 1VJAU 1GBDA 3ZZ5A 2F9NA 1MQ6A 1CA0B 4XBBA 1XVMA 5BPEA 4YOJA 5E0HA 1CVWH 4YO9A 1IQKA 3NK8A 3RMMH 1FDPA 2WPDD 1TGCA 1YLCA 1ZTLA 3KL6A 3R0FA 4GPGA 1NESE 1TNLA 1B5GH 2QF4A 1EQ9A 3SGAE 5DGJA 3PMHB 4JCNA 2CF9H 3RLWH 1GBAA 1F0TA 3QK1A 1DPOA 2ZDNA 3GS9A 1MTNB 4Z0KA 1OWKA 1TGNA 4IMQA 1C2EA 1SLVB 4AYVB 2F9UA 6CHAB 1FY1A 2AFQB 4X2XA 4X6OA 1ZHMA 5EODA 3SU6A 3GDSA 3K6YA 4ISHH 5DN6D 3A85A 4K8BA 2Y5HA 2GMTC 3I29A 1HJAC 3RLYH 3LGTA 3ODDA 4IS5A 2PSYA 4R0IA 1FMGA 2ZFQH 5DP8A 1VKYA 4CH8B 3RXEA 4INLA 4ISLA 1TIOA 1SL3A 1O39A 4AZ2B 4Y7BA 2Z3DA 4BNRA 1ELVA 2VIWA 1V2WT 3BG4C 1T32A 1A4WH 4K1TA 3MWIU 3SNEA 1MZDA 4LZ1H 1WQSA 3U1IB 5HMAA 1A5HA 1ANDA 1B0EA 5IK2D 1K1JA 1NFUA 5FX5A 3DSOA 5LH8A 3PV5A 3UOUA 3UR9A 5JB9S 2ZDMA 1C1SA 3PLPA 3GCHB 2GJGA 1VGCC 2GCTB 2JETB 2JKHA 1P3CA 2GZ8A 1YBWA 5FPYA 3FZZA 1HJ8A 1SGTA 4I8JA 4JZEH 1ETRH 3A83A 4A1TA 1CHOG 4NG9H 1IQIA 1ARCA 1XXFA 4FOUC 2A45B 4JK6A 1A2CH 3W94A 1LMWB 1S0RA 2J92A 2FODA 3GY5A 2BZ6H 1UW7A 2V6NA 3MH5A 1ZPCA 3RMNH 2ZU2A 2ANMH 3D62A 1SLXB 1FJSA 1BMAA 3SNCA 2Q6GA 4R8TB 3ZZAA 4MPXA 6GCHF 3K65B 4DT7B 1V2UT 1YPGH 4ABFA 5TJXA 1SOZA 3TGJE 1W14U 3IG6B 3EGKH 2BLWA 3B23B 1F92A 1H9LB 1MTWA 5F8ZA 4OS2A 1QHRB 1DWDH 2FDAA 4OGXA 5L6NH 1BT7A 3ESTA 1NRQH 5ETXA 4UFGH 1GG6C 2WINI 4ISIH 1EFRD 3TVJB 1CT0E 1C5QA 1O3AA 2SGEE 1BOQA 1DS2E 3KQEA 5FX6A 2XOKD 1WCZA 1KDQB 2EEKA 1XUKA 1XUJA 1PPCE 1SGCA 1SFQB 1CGIE 3A7VA 1BJUA 2BQ7B 4OS1A 4FU8A 4ZMAH 4HZHA 1VCQA 4LK4A 4H42U 4X1SU 1ELTA 2AGIX 2FOHA 1NPMA 1GHYH 5G4BA 4BXSA 1Z7KA 1MCVA 3LJOA 1OKXA 3A88A 1GBMA 3LOXA 2H5DA 2VBCA 5EPYA 4FUBA 1GHBF 2AYWA 2IPQX 3ELAH 4F48B 4UONA 1DSUA 1IOEA 2BD2A 5GCHG 1UVUH 3U69H 4A1XA 1MMJN 3EQ0H 5A0BA 1O3NA 2ZTYA 4Z1MD 3BN9A 3T25A 4YT7H 1SGFG 8GCHG 1ARBA 1FN6A 2XNIA 3MU1A 2C3SA 4X6MA 1GI5A 2VNTA 2OTTX 4O9VA 2SGFE 2P8OB 4IW4E 2CHAB 3RM2H 3V7TA 5E2PA 1E1QD 1ZPBA 2VJ1A 4BTUB 3MQKC 2VIPA 3LPRA 1MKXK 4WMDA 2BXTH 1P57A 4X1PU 2A7HA 2UUJB 3P92A 3ITIA 1L1NA 4MLFB 1N6XA 1O34A 2OXSA 1EAWA 1X7AC 1VR1H 2QF5A 1O36A 2TGDA 4JZDH 2HLCA 4XDEA 2WPHS 4WH6A 2VVUA 1V2TT 2SGPE 1C5OH 1UMAH 2J9NA 2WPLS 3T29A 9ESTA 3ZVDA 3EA9A 3SV9A 1OOKB 3T27A 3F9EA 1C4V2 4K5ZA 1KY9A 4DW2U 1O2IA 2B0FA 1V2RT 2A31A 2GDDA 2QY0B 1O3HA 5GNDA 4ZUHA 3LGWA 1SGPE 3P95A 1GMCF 1QJ7B 1P9SA 2OQUA 2VH0A 2Z3CA 3B8JA 4A5TS 1SPJA 1K28D 1TBRH 1NBMD 1W7GH 1A61H 2HPPH 3URDA 1SGEE 3VXFH 1AD8H 3A84A 4A92A 4RSPA 2J98A 4CR9A 1QL8A 5GXPA 3T28A 1UHBB 2BVSH 2OD3B 1FAKH 4WVPE 3L33A 1PYTC 5JFBA 3HATH 4H4FA 3CS0A 1TQ7B 3DUXH 4GCHF 1OX1A 3PO1B 1A3EH 3FKSD 3OFND 1L0ZA 1TLDA 1GBHA 1AWFH 2KAIB 3M61U 1T7CA 3KF2A 5EJZA 1WDIA 2GMTB 1AE8H 1AN1E 4ZKSU 1HJAB 1UTLM 4UFEH 1O2LA 1O37A 1QURH 1JBUH 3BTQE 5J4SA 1UK4A 1WTGH 2O8MA 1NM6A 1QBVH 4J1YA 8ESTE 2ZGJA 1GGDC 3SJ8A 3A8BA 2A4GA 2BQ6B 2ASUB 3FP6E 3N7OA 3U98H 1O3OA 5A09A 3BG4B 5C94A 5J4QA 1O3JA 2P3TB 4OM9A 3ZVEA 1F5LA 1G32B 4TWYA 3NZIA 1AKSA 1O5FH 3KQDA 2NWNA 4NZLA 4NSVA 1RD3B 1ELEE 4RT1A 4JYUH 1T31A 1GJBB 1UJ1A 1O3GA 3GOVB 1O5FL 4BXWA 2RDLA 2XYAA 2HVYB 1G36A 2OC0A 3OYPA 3RM0H 1C2DA 1O33A 2OQ5A 1GHAG 4BAMB 1O38A 2ZU5A 3ZZ3A 3RU4E 3MNBA 4CHAB 1F0UA 1YPKH 3N7EA 1W2KH 3F9GA 1W0KD 2FM2A 1CO7E 1GWAA 5ESBA 3ZZ9A 2ZIQH 3E91A 4M9FA 1G2MA 3ATMA 1LQEA 1L2EA 3Q00A 1NFYA 1SSXA 3NUMA 4U01A 3SW2B 3TIUA 1E79D 1FY8E 1KXAA 2BYAX 4BANB 1DXPA 3UQOA 1HXFH 3WY8A 2YNBA 2QXJA 3ZYEA 1XXDA 2G8TA 6LPRA 1QFKH 1HUTH 2OYAA 4X8SH 3TJNA 2XC0A 1F0SA 1UCYH 1FLEE 1L4ZA 1THPB 5AFYH 5EJ1A 1PPEE 5C0UA 5EQRA 2NU0E 1CGJE 1TX6A 1TFXA 1HV7A 1DY9A 1PPHE 4I33A 4LXBH 4Y71A 1ACBE 1IQNA 1ZJDA 1EOLA 3P8NA 5CHBA 5KEDA 1OSSA 2RCEA 1OP0A 1GDQA 2RG3A 1PPFE 2Y81A 1JOUB 1MUEB 2A5IA 3TK6A 4BAHB 3MU5A 3SO3A 3S0NA 1MTNC 2HNTF 5CHAC 1S83A 4RI0A 1C2HA 3GDUA 3HKIB 3ZV9A 1UTNA 1AFEH 5E0GA 1UK3A 1MZAA 1G3BA 2FZZA 2GTBA 2OINA 2WPKS 3B9FH 4WY3A 1FV9A 1F2SE 2PSXA 3M36A 1FNIA 3STIA 5A8ZA 1GVZA 1QNJA 1SQTA 1THRH 3M3SA 2STBE 2CMYA 3PMBB 3BV9B 1H4WA 1GJ4H 5T6DA 2WYJA 1O3BA 3UQVA 1PPBH 5C5OA 3KN2A 4IBLH 1H1BA 2ZU3A 2H5CA 2LNCA 1TPSA 3M35A 2BX3A 4K69A 5A0AE 2QGRA 1O2XA 3MI4A 4ABEA 2D8WA 2PGQB 3PWCA 1AZ8A 1AU8A 1E37B 1TB6H 4RT0A 4SGBE 4KTCA 4RKOB 1N1LA 2EQNA 3UREA 1HAIH 3ATWA 1TWXB 2FOBA 1C5WB 2BLQA 2BY7X 4DIHH 1BRAA 3P70B 3SU3A 2GCTC 1P04A 1TE0A 3SU4A 2DUCA 3O8CA 1AHTH 1HAZB 4AYYB 1DOJA 2BY8X 2BD8A 3OTPA 4I7YH 2SGDE 2J5UA 1ZRKA 4B74A 1ESBA 3VB5A 1GDUA 2ZGXH 3M5NA 4I86A 5E2OA 2VIVA 5LPEA 1LPGB 2BQWB 3RXJA 3RMOH 5JBCS 2H9HA 1HJ9A 3W1EA 1HBTH 1EP5A 5DSFA 1DVAH 1A1RA 1KXCA 1LCYA 2P95A 4TT3D 1TALA 4AGKA 3DSGA 2ZFSA 5C1UA 1QL7A 3D49H 2A2XH 3GYLB 3E8LA 1AFQC 3MHWU 5EW1H 3LU9B 1J9CH 4X2WA 2P93A 1E0FD 1T4VH 1AVGH 4NWLA 4FUEA 1G3EA 2ZGHA 2PR3A 3V12A 1ANBA 1HYLA 2WSSD 5EIYA 1J8AA 1O2UA 1WSSH 3A7XA 1ELCA 1NC6A 2ZC9H 1VITF 3O8BA 2Z7FE 2BMGB 1TMUH 3UR6A 3PYHA 3SU1A 2CJIA 3SZNA 4IGDA 3GY3A 1AO5A 3H7TA 4JYVH 1QA0A 1GJ7B 1C9TA 4Y0YE 4X1NU 2QXGA 3NXPA 1S81A 4Y10E 1TYNA 4H6TA 1P09A 3A8DA 1WU1A 3M3TA 5HM2A 2XWBI 4YM9A 5A8YA 2HNTE 1WXRA 3RXVA 1C2JA 2QE7D 4JYTA 3I78A 3SNBA 3ZIAD 2SGQE 3M3VA 1P2JA 1LDTT 1O5BB 1O2OA 4CRGA 2HGTH 1COWD 3TGKE 2OLGA 3GCTF 5L2ZH 2GDEH 1BIOA 1V2NT 4FXGH 1C5YB 1FIZA 1BDAA 4ABAA 4KTSA 2A5AA 4KELA 3QWCH 1SGYE 4J2YB 2Y7ZA 2ZGBH 3ZZDA 3UY9A 1TONA 1P11E 2ZHQH 1O5CB 2BM2A 3NKKA 1YYY1 3SI4H 4CH2B 2CHAC 1AUJA 2P16A 1KSNA 4I8HA 1NU7B 2XBXA 2XTTB 1RTFB 1JWTA 1V2ST 1A7SA 4ABIA 1N8OC 3A7YA 2V0BA 1DANH 4K1SA 1SGFA 3DCLA 3U8RH 2M5TA 1XVOA 2O8UA 1TNGA 1GMDG 2O8TA 1UO6A 1VCWA 3PM3A 4HI3A 2BDCA 1NRPH 1O3MA 3A7WA 2EY4C 1ZJKA 1HNEE 4FETA 2ZCLP 3F2HA 4GHQA 5ESTE 1HDTH 4CRFA 5HIYA 3LH1A 2W6JD 1TABE 5GIBA 2FMJA 1P2MA 4XFQA 2Y6TA 2ZDKA 1J14A 1C1RA 1B0FA 4CRBA 1J17T 1LHFH 1MKWH 2H6MA 2K0QA 3BEUA 1C4Y2 1RXPA 5FXLA 1ZMJA 4DURA 1O2PA 2FS8A 1YWUA 1Z8IB 4P02A 4GUXA 3HK6B 3SJIA 1RIWB 2ZQ2A 1S6FA 1FUJA 3S7KB 4D7FA 2ZFRH 4INHA 4P00A 1UVOA 3E3TA 4ZXXH 4OS6A 1UTMA 5C1XA 3QZRA 4AG1A 5CHAB 1C5UA 3P8FA 1NTPA 2QN5T 3PO1C 3OEED 2O8WA 4I8GA 5DP6A 1H8DH 3RXSA 3TLOA 2ZPSA 4AN7A 1RTKA 4Q7YA 1NRRH 1TMBH 3LGYA 1C5LH 3OSYA 4TSFD 4YXWD 1O31A 1IQEA 2IPHA 3PWBA 5C2ZA 1EB1H 2FESH 1QRXA 1RTLA 1FZZA 2EI8A 3OX7U 1C5TA 2CN0H 3ZZ6A 2P94A 2F9PA 2H9EH 2R3UA 1P02A 1YPEH 1HAHH 4NCYA 2Y80A 2QCYA 4A7IB 1EKBB 2LELA 1L4DA 2Z9IA 1L1JA 1LTOA 4ZHMU 2PP6A 5DKMA 5C5NA 1LPKB 1PQ5A 1RRKA 1VJ9U 3ZZBA 3GDVA 4B76A 3SBKA 2F4LA 1D6WA 2D1JA 2JDID 2PKAA 3PLBA 3UWIA 2BLVA 2UWLA 2XXLA 2TPIZ 4JMYA 5EJLA 1H8HD 4CREA 2ILNA 2O8LA 1QRZA 3VFEA 5I46H 1BMLA 1NROH 4U2WA 1DLEA 1KLJH 4MVNA 4TY6A 1NO9H 3VGCB 4DY7B 4X6PA 1SLUB 4TY7A 4CHAC 3RXPA 3T62A 4LOYH 1QB1A 1ZYOA 4XBCA 1SMFE 4BAOB 2G5VA 3DHKH 3LJJA 3LC5A 2FI4E 3PTNA 1ELBA 2R9PA 2WPIS 2FOCA 1SGQE 1BQYA 3RC5A 3VG8A 2WHXA 4X2YA 4XSKU 4CRCA 3ZVGA 2KCOA 1IQLA 1GI4A 4CR5A 2BD4A 1CQQA 2KZ4A 2RA0A 2STAE 3NWUA 1AFQB 4AORA 3S9CA 2VWNA 3AW1A 4NZQA 1C5SA 3TITA 1BJVA 3GY8A 1GHBG 3MTYA 2F83A 1UTPA 1V2KT 1WUNH 1W3CA 1GHWH 1O5DH 2ZTZA 1BMNH 2F9OA 3A87A 2FIRH 5T6GA 3U28C 1MD7A 4O97A 3R3GB 3RXLA 2GV6A 3M5MA 2XNDD 1D6RA 2AMPA 1LO6A 2KCPA 2ZU4A 4FUFA 3BTHE 4HFPB 4Y6DA 1CHOF 2KFWA 4MNXA 5GJ4B 2ZO3H 3RXDA 1WV7H 2C8XB 4IMZA 3SORA 1DUAA 5AVDA 2BDBA 1HAYB 1SHYA 2AMQA 3MU4A 1EZXC 2ZEBA 3UWJH 1YY3A 1C5RA 4ACAA 3SJOA 1C5NH 4DIIH 4X8TH 1W7XH 3FN8A 3N99A 7GCHF 1O2HA 5EPNA 1C9PA 1QZ8A 1XKBC 1VZQH 1C1QA 2ZNKH 1W0JD 3MU0A 1E38B 1PPGE 3FZDA 1AQ7A 3LT3A 2AERH 2C8YB 1TA6A 5BRRE 2HLDD 1K1IA 2HALA 1W12U 3KYFA 2BOKA 2W26A 4WWYA 4ACBA 2G55A 1O2SA 2VH6A 4NIWA 3OU0A 1GCDA 3W95A 1EPTB 2ZHWH 1GMCG 1Q31A 4YLUA 1ZSKA 2A5KA 2J97A 2ZI2H 3GY7A 1TQ0B 3SUEA 5DP5A 4JZFH 3QTVH 2QF3A 1IQHA 2EA3A 2P59A 4Q7ZA 1N8OB 3Q76A 1DLKB 1E1RD 1EX3A 1LVOA 1PQ7A 2BDIA 3MO6A 3RXTA 2TBSA 4A6LA 1AMHA 2NU2E 1CBWC 2DE9A 2H9TH 5JBBS 5C17A 1WOFA 3E6PH 1JMOH 3VB7A 2ZFPH 1ZGVA 1O2MA 1TNKA 1HFDA 2GV7A 4GCHG 2ANYA 5EXLA 1B7XB 1ZLRA 2BDYA 1DWEH 3KQBA 2LP6A 3RC6A 2GX4A 1KXBA 1A46H 3GISB 3ZVFA 1BCUH 1YLDA 3TJVA 1CE5A 1O3DA 3RP2A 2P3FH 1MTVA 1SGDE 2F43B 2GZ7A 1TGSZ 1YPHC 5EW2H 1Z1JA 1MU6B 1FPHH 1NRNH 3VB3A 3V0XA 3OE7D 4AFQA 1GJ9B 8GCHF 3RMLH 3BIVH 4Y8ZA 1P05A 2ZU1A 1MAXA 1P2QA 1W8BH 1ELDE 2W6ID 1GJ6A 4ISOA 3TU7H 5SGAE 3SGQE 1O2YA 4FUDA 4AGJA 4U32A 1GJCB 2IN2A 5LGOA 1BRBE 2TGTA 2OTVA 1OWEA 5GPIB 1ZHPA 1N6YA 2XBWA 4NIYA 2PKSC 2GGVB 1TOMH 5FPTA 3F1SB 3QZQA 2VIOA 1BTPA 2BY6X 1BTYA 1LVMA 3ATKA 2CF8H 2VVCA 2GD4B 2W7SA 4B71A 1P06A 2VWOA 1MU8B 3F68H 4X6NA 4XE4A 5L2YH 4ZROA 4NGAH 2TIOA 1MABB 2OC8A 2BY9X 4Y76A 1LHGH 3A7TA 3Q3XA 4QT8C 1C5PA 1UCYK 1NN6A 1H9HE 2D2DA 4X8VH 1EJAA 1BTXA 2FPZA 4NA8A 1KDQA 7KMEH 1WAYB 3CENA 4JK5A 1KXEA 5E8EH 1HAPH 1UTJA 1ZOMA 4MPWA 4NA7A 1KXFA 3RXHA 4DJZB 2A0QB 5F03A 3P8GA 1G3DA 1O0DH 2BB4A 3H09A 4K60A 1H8ED 2GZ9A 5TCAA 1F0RA 1DE7H 1PJPA 1TAWA 1TA2A 1BBRH 5TCCA 3I77A 5JYIA 3STJA 4K3JA 2ANKH 1IQFA 1C2GA 2WUBA 2B8OH 3BSQA 1BTUA 2R0KA 4FUCA 1MBQA 5KGOA 1W0ZU 2WV9A 2JJ1D 4Y7AA 3ZYDA 2FEQH 1GI3A 1V6DA 1GI6A 1DITH 1K22H 1TPPA 3QO6A 1BITA 4GVUA 5T6FA 3SN8A 3QUMP 1UVSH 1OWHA 2K1QA 3TJUA 5AF9H 1ETTH 4Y8XA 1GI2A 2R0LA 3A89A 1C5MD 2JIZD 3UAIC 3U1JB 1GCTC 1K9OE 1QB6A 1FXYA 1O2QA 2FOEA 2Z3EA 4MPVA 3SUDA 3Q3YA 1O3LA 4BAQB 3UNSA 3QDZB 1TNIA 1RIWC 4XRNA 3UTUH 3LC3A 3RXBA 1XUHA 2WV5A 3SI3H 2OC7A 3EA8A 3PRBA 4M7GA 4ISNA 2PFEA 4HG6A 5C20A 4MNVA 3SU0A 3PLKA 3MNCA 1T8OA 4B73A 1P2IA 1GJAB 3EYDA 4UFDH 4BOHA 1QIXB 2J94A 1P10A 4H6SB 1UTQA 3CNRA 1LPZB 1XUIA 1YC0A 4K2YA 2G5NA 1DWBH 3GY2A 3AAVA 3FO8D 2FTMA 2GVFA 1O3IA 3RXGA 4AC9A 2W3KA 1DXWA 1ANCA 3H7OA 4I32A 2XC5A 3F2GA 5FAHA 2P3UB 3A7ZA 4GHTA 4O3TA 4ZAEA 2HOBA 2HWLB 4FUJA 3RXKA 1RGQA 3QGJA 4DCDA 2QF0A 3DA9B 2C8WB 3SUFA 1UHBA 3LIWA 1HRTH 2V3HH 1IHTH 2ZCKP 4Q7XA 1O5GH 1TRYA 4U30A 2QV1A 2AIPA 1YKTA 1O30A 5DP7A 3LDXH 5EXNA 1ZMLA 2XWAA 2BLOA 4YLQH 1GI0A 5A0CA 2FP7B 3MNSA 2V3MA 3FP7E 3BIUH 3KQ5A 3OTJE 2YNAA 3PROA 1S5SA 2KAIA 2YMSD 2OP9A 1C5XB 4F4OC 3ZVBA 3RDZA 4IC6A 2FX6A 3AVZA 3FVFB 2UUKB 3S7HB 3VGCC 4OS4A 1RJXB 3TK9A 1AZZA 1A5IA 2QAAA 1WYKA 1HAVB 2XC4A 1SGNE 4OS7A 2UUYA 3BTEE 1SHHB 3RXQA 2BDGA 3ZVCA 4HGCA 2ESTE 4B6FA 4JZIA 4UD9H 2BTCE 3F9FA 2XBVA 2QYIA 2J38A 2SFAA 3UNRA 3O8RA 2FOAA 1GJDB 4Y79A 4CBNA 1CBWB 2D26C 1J16A 2ZPRA 2Q1JA 5HIZA 3DFLA 4NIVA 1O3PB 2FWWA 2F91A 3BTGE 1EOJA 1Y5BT 3TPIZ 4DVAU 3RU4T 5F8TA 3KNXA 2YMSC 2ZA5A 5F8XA 1YPJH 3LKWA 3V13A 2K8IA 2JOPA 1GBLA 1QJ6B 4K1EA 2FO9A 4XBDA 1C2LA 3M7TA 3VXEH 5JB8S 3BTKE 2ZZUH 4MG3A 1LHDH 1EUFA 3A8AA 1V2OT 4GSOA 1C2MA 2ZP0H 1XX9A 2AS9A 3RXAA 3GCTG 3GYMA 3FFGA 2ODYB 1GJ8B 1ID5H 3ZVAA 3TGIE 4E7RG 1O2JA 2WV4A 3PRDA 1HB0B 2R2MB 1NBME 1JRSA 1P2KA 1TX7A 1O3FA 2Z9JA 1BHXB 3T26A 1AI8H 1CHGA 4AB9A 1EAUA 1ESAA 2PKSB 3SV6A 1K1PA 1GHXH 3P8OA 1KYNA 1DICA 4LZ4B 4TPIZ 1LQDB 3PMAB 1C2IA 1HXEH 3RC4A 1GL1A 3HK3B 5C3NA 1GI1A 1QBOA 1TGBA 5HKKD 4JZ1A 1YCPH 1G30B 1SKYE 1ZTJA 3CP7A 1AVXA 3RUOA 1HAGE 1H8IH 2YOLA 1EAIA 4UDWH 5K0HA 2GT7A 4X1RU 2ZHEH 4X2VA 3PTBA 1BY2A 5FL7D 4AFSA 2QXIA 3QN7A 1PQAA 4RKJB 1MTUA 3HPTB 3OY5U 4CRAA 3PB1E 4MPUA 3BTDE 1EPTC 2HRVA 3FAOA 1TNJA 1O2NA 2JH0D 2NU1E 1S0QA 4Z6AH 3MFJA 2I6QA 5CE1A 3QX5H 2ZQ1A 2Y7XA 4MNWA 1C4U2 1JXPA 1K1MA 1XKAC 1ZRBA 3G01A 3F2FA 4FU9A 4FUGA 4ABDA 1GBCA 1UCYE 2ZDVH 4YZUA 5A8XA 3AASA 1P3EA 1YGCH 1T8NA 1V2QT 3TH2H 2OBQA 1QRWA 2ALVA 1AB9C 3MH4A 4YT6H 3RXOA 3A82A 3V3MA 1ABIH 2RDEA 2VINA 2ZDAH 5GDSH 3TH4H 2A2QH 1A3BH 2GCHF 3OAAD 2LPRA 3BTME 2VGCB 1P9UA 1GMHF 1NS3A 1GCTB 2B5TB 3MMGA 4GAWA 1S85A 2ZDLA 4MDSA 5FCRA 1CGHA 1SLWB 3BEIB 2Y5FA 1GBJA 1C2KA 1HIAB 3TJOA 2C8ZB 1AGJA 3SNDA 2GKVE 4Y8YA 1PPZA 4D9RA 2GP9B 5GWZA 1W10U 1Y3UA 1YLNA 3E0PB 1V3XA 3KGPA 3BTFE 2ZG0H 3MO9A 1Z8JB 3SYJA 2Q6DA 1EZSC 2ZFTA 3E1XB 5HYOA 2ZFFH 5ABWA 4MTBA 1O5AB 2QXHA 2VWLA 2J95A 2A4OA 4VGCC 4MNYA 2BD5A 1A0JA 1GMDF 3U8TH 4ABJA 1BRCE 2PTCE 2XRCA 3EA7A 1GHZA 1K1NA 2R2WU 1FY5A 5FCKA 5FPSA 4B2BA 1ZZZA 1EAXA 1JIRA 3K2UA 4BAKB 2FXRA 1OXGA 2BVXH 1GBTA 2AGEX 3PV4A 4AFUA 1YF4A 4XOJA 3EE7A 4FUHA 1INCA 4XD7D 2C90B 1IQGA 3AAUA 3TNTA 4WMEA 3UFAA 2CXVA 5KECA 1YPMH 1QQ4A 1OYTH 5DJ7A 1WTHD 1QY6A 1L1GA 1Z1IA 1C1UH 2PHBA 3BTTE 1GL0E 2BY5X 2CK3D 3F0PA 3P6ZB 1XM1A 5DK1A 3FP8E 5EQQA 4ASHA 6GCHG 2XW9A 5C0TA 2BHGA 1LKAA 4ASUD 1P57B 1LHCH 4AG2A 1GPZA 3WWBA 1TOCB 3SOSA 1KMHB 1SFIA 1GDNA 4SGAE 3RU4D 3DSPA 4FVDA 3DT0H 2L6OA 1P01A 2RFKC 1OWIA 1Y3YA 2EI6A 4NA9H 1OPHB 2FOFA 1Z6JH 2OBOA 1OYQA 1K2I1 2ZHDA 1V2LT 1DFPA 1ELAA 1P0SH 2ANWA 5JBAS 3DFJA 3SV2H 1T8MA 2EC9H 2WPJS 1W0YH 3KQCA 2C4FH 4YESB 3A81A 2VB0A 5DP9A 1W11U 4AOQA 5B6LA 2FX4A 2RA3A 4F55A 1GI8B 2AMDA 4GLYA 1QTFA 1JIMA 4ZH8A 2ZWLH 3D65E 4CBOA 5CMXH 3QTOH 4TYDA 3SGBE 1OWJA 3F0OA 1OP2A 4ESTE 2YMSB 3URCA 1C1VH 2J98B 2M2AA 1F5KU 4TWWA 7GCHG 4UE7H 1P12E 1AVWA 3MOCA 2JH6D 2VVVA 3F9HA 4OS5A 2BOHB 2V35A 1YPLH 4CRDA 1QA7A 1U6QA 1ZGIA 1ESTA 2ODQA 4WF8A 1D3DB 1VCPA 2WPMS 5FHTA 2Z9GA 1E35B 1ZPZA 3S69A 1Z8RA 2WYGA 4NFEA 3BTWE 5T1VA 3L6PA 1P8VC 2ZCHP 2SNVA 3A86A 1PQ8A 4B75A 2EI7A 2QIQA 3MNXA 4DOQA 3OY6U 4MQAA 3P17H 3SUGA 2Z6BD 3UPEA 3T5FH 3A80A 1KTTB 4NFFA 4O03A 1FPCH 2FI3E 1HIAA 2B9LA 3SHCH 2A4QA 1TPAE 5JPMH 3AK5A 3VPKA 1GBKA 2F3CE 3MH6A 2F9VA 1ZHRA 1OP8A 1AE5A 1UVPA 3LGIA 3ENSB 1C1MA 1AKSB 1AUTC 1K1LA 4I31A 3LGVA 5K7RA 3HKJB 4WXIA 1CA8B 3QGNB 1BTHH 2BXUH 5B6OA 1KXDA 1TRMA 1Y3VA 1D3QB 1QJ1B 3M7UA 1P2OA 5JDUB 2FYQA 3T2NA 1AIXH 1D3PB 1S6LA 2AHME 2HVXA 4FVBA 3KEEA 3E90B 1YP9A 2TGPZ 1E36B 5DO4H 1O2GH 1ZTKA 1Y59T 1C2FA 5EGMA 1CSOE 1ABJH 4ABGA 4PROA 1V2VT 4D76A 3OEHD 1HPGA 1KIGH 1O2ZA 4YOGA 1IQJA 2R3YA 2ZHFH 1EZUC 2AH4X 4K8YA 4X0WU 2CGAA 1LVBA 1O5EH 1TRNA 1D3TB 4ZKOU 4ZHAA 4E05H 2PGBB 3SU2A 1O5EL 6ESTA 3QLPH 3C1KA 1QCPA 1AB9B 1BMFD 1F7ZA 1SQOA 3UOPA 1BMMH 3VB4A 2XBYA 2THFB 2HPQH 2WUCA 1MAYA 5GCHF 1SR5C 1PYTD 3IITA 3TNSA 5FBEA 1EJNA 1C5ZB 4RN6A 2FLRH 1S6HA 2TRMA 1CU1A 2OUAA 1J15A 3PV2A 3SHAH 3ZZ8A 1F5RA 5AHGH 1OHHD 1UTOA 2KX4A 4ZXYH 1FY3A 3D23A 2KCAA 1O32A 4F49A 5CDFE 1C5VA 2F9BH 4BTTB 1ZR0A 1W13U 2SGAA 1BBRK 5EXMA 1G9IE 1TBZH 3S9BA 4BTIB 5LPFA 5LPRA 7LPRA 4OGYA 3KCGH 2PWXA 1XMNB 8KME2 2A7CA 2CV3A 3EE0B 5I25A 1XUGA 1K0HA 1MTSA 4NWKA 4VGCB 1LKBA 1Q2WA 3AW0A 3ZZ4A 5EU8A 1Z71A 2G4UA 2KCYA 1JRTA 1P03A 4D8NA 1MKXH 1SG8B 1T4UH 4UFFH 1EJMA 1D4PB 4AFZA 2PUXB 3DD2H 3U9AH 1OWDA 3E16B 5IDKA 2ZECA 1BTWA 5T3HA 4KP0A 8LPRA 1O3EA 3JZ1B 4WJG2 1C1OA 4AB8A 4B1TA 1O3CA 3VEQB 3KHVA 4B2AA 1E34B 3VB6A 1ANEA 5EOKA 4HTCH 4A1VA 2JA4A 1O2KA 1BA8B 2G81E 2DE8A 3N7DA 2A32A 2W3IA 2HNTC 1Z8GA 2JP0A 1O35A 1Y3WA 3GY6A 1CT2E 5JBTA 2V7QD 3FANA 1TNHA 2V3OH 3HGPA 1DM4B 4I8LA 3UIRA 4ABHA 4KKDA 1GHVH 1FQ3A 5PTPA 1A0HB 1BHXF 4Q4LA 3C27B 1VGCB 4DG4A 2BD7A 2J4IA 4ABBA 2VGCC 1EPTA 2AEIH 3KIDU 1GVLA 3M5OA 4THNH 2W7UA 1NT1A 5IYTA 1Q3XA 1V2PT 1C1PA 1QR3E 1Z6EA 2FTLE 1FIWA 3WWFA 4ZHLU 3SNAA 3EDXB 3S9AA 1AY6H 3NCLA 5EQSA 3A8CA 1T8LA 2UUFB 1EP6A 3BG8A 4DT4A 2W5EA 1CA0C 1UTKA 4NSYA 5C67A 1NRSH 3RXIA 5HXFA 1QBNA 2IJD1 4Y11E 1DY8A 2VIDA 1MCTA 1WBGB 3ATLA 1QB9A 5DPAA 3MU8A 2I6SA 1GHAF 1NU9A 1LHEH 2TGAA 3UB0A 1HAOH 2FOMB 1O2WA 3K9XB 1UK2A 2VWMA 1BB0B 2OCVB 1NY22 3ZZ7A 2Q6FA 2IOTA 1GI9B 3IWMA 1TPOA 1G3CA 1SGIB 5E0JA 3L3TA 4Q80A 3U8OH 2Z9KA 1EB2A 6CHAC 1S84A 1SGRE 1GG6B 1FI8A 2ZTXA 2PW8H 1FONA 1LVYA 2FLBH 3GY4A 4YTAA 4E06H 1BRUP 2G51A 3Q77A 2Y5GA 2J2UA 2GT8A 1GJ5H 1HAXB 1TX8A 2PV9B 3GCNA 2Z94A 1EZQA 1O3KA 2IJOB 2J34A 3RXRA 3M37A 2BD9A 1QQUA 4WXVA 3SQEE 2XCNA 3H5CB 1IAUA 2BD3A 3FOAA 3NRLA 4X1QU 2WZQA 5DG6A 1VITH 3M7QA 2QA9E 1HGTH 1BTZA 1SI5H 5DP4A 1A0LA 1RFNA 1QL9A 1GVKB 2JJ2D 1VITG 4IN1A 2ODPA 3O8DA 2SNWA 3GCHC 4KTUA 3RXUA 1AWHB 2JETC 1YPHE 1K21H 2C93B 1A5GH 2L74A 1FX0B 2QC2A 1D9IA 1SQAA 3SJKA 5A2MH 3TH3H 1KLTA 1SBWA 3ODFA 4IN2A 4WMFA 5F53A 3RXMA 3WW7A 2BVRH 1MBMA 7ESTE 1K1OA 1YCPK 1NFWA 3MO3A 4Y0ZE 2ALPA 2H2ZA 2VU8E 1RS0A 2ZPQA 2ZKSA 1IQMA 3BEFB 2G52A 1DX5M 2BX4A 4B2CA 1EASA 2G00A 4E7NA 1MH0A 1DWCH 2Y82A 2ZF0H 4TPYA 1ORFA 3SV8A 1ELGA 2O9QA 1TBQH 1Y5AT 4Q63A 1GBEA 3JZ2B 5H4IB 3Q3KA 4Q2KA 3M5LA 1V2MT 4O3UA 2JH5D 1M9UA 1FY4A 3HGNA 4IC5A 3RXCA 1HLTH 3K6ZA 1OS8A 5C1YA 3LH3A
chains in the Genus database with same CATH topology
1PFXC 4UEHH 1XUFA 2A7JA 4D9QA 1SB1H 1NZQH 2AGGX 1G2LA 5FBIA 3SU5A 3LGUA 2NU3E 1ZSLA 2OC1A 2VIQA 1P2NA 1EATA 5DP3A 4WH8A 2FS9A 1V2JT 3ATIA 2FI5E 1KTSB 4D7GA 1ELFA 3GICB 1GBIA 1O2VA 2AIQA 2PUQH 3CS7A 1C1TA 1H9IE 1WQVH 1HCGA 9LPRA 1SOTA 2PKAB 4KGAA 4ZKRU 2NU4E 1MKWK 2B7DH 2BZAA 3GCOA 3ZV8A 1THSH 2UWOA 2XCFA 1FAXA 1DDJA 1BBRE 3MYWA 1Y5UT 1EXFA 2ULLA 1C1WH 3LONA 1MQ5A 1KLIH 1TGTA 2GCHG 3SJ9A 5L30H 5F6MA 1S82A 2H1UA 4DGJA 3UNQA 2UWPA 1GMHG 3BF6H 1FN8A 2A1DB 4FUIA 1ZMNA 1ZSJA 2Z9LA 2G4TA 5EG4A 1SVPA 1GGDB 5HM9A 4NIXA 1G37A 1SC8U 3MH7A 3SQHE 3ZZCA 4FU7A 3PMJA 1GBFA 2FYRA 3F6UH 1BZXE 5AFZH 2P8OC 1GI7B 1Y3XA 3RXFA 3SV7A 4I8KA 4YOIA 1O2RA 1TMTH 1O2TA 1CT4E 2A4RA 1DSTA 2BDHA 2ZGCA 1YM0A 1BUIA 1YCPM 1UVTH 3TK5A 4INKA 4AX9H 1HAVA 4X8UH 1DT2A 1Y8TA 1QGFA 1C1NA 2PLXA 2FOGA 2BDAA 2PTNA 1MD8A 1IHSH 1NFXA 2OY3A 3E0NB 3EAJA 5HGGA 4ZKNU 1DUEA 1GBBA 3NPSA 3UUZA 1ETSH 1VJAU 1GBDA 3ZZ5A 2F9NA 1MQ6A 1CA0B 4XBBA 1XVMA 5BPEA 4YOJA 5E0HA 1CVWH 4YO9A 1IQKA 3NK8A 3RMMH 1FDPA 1TGCA 1YLCA 1ZTLA 3KL6A 3R0FA 4GPGA 1NESE 1TNLA 1B5GH 3SGAE 1EQ9A 5DGJA 3PMHB 4JCNA 2CF9H 3RLWH 1GBAA 1F0TA 3QK1A 1DPOA 2ZDNA 1MTNB 4Z0KA 1OWKA 1TGNA 4IMQA 1C2EA 1SLVB 4AYVB 2F9UA 6CHAB 1FY1A 2AFQB 4X2XA 4X6OA 1ZHMA 5EODA 3SU6A 3GDSA 3K6YA 4ISHH 3A85A 4K8BA 2Y5HA 2GMTC 3I29A 1HJAC 3RLYH 3LGTA 3ODDA 4IS5A 2PSYA 4R0IA 1FMGA 2ZFQH 5DP8A 4CH8B 3RXEA 4INLA 4ISLA 1TIOA 1SL3A 1O39A 4AZ2B 4Y7BA 2Z3DA 4BNRA 1ELVA 2VIWA 1V2WT 3BG4C 1T32A 1A4WH 4K1TA 3MWIU 3SNEA 1MZDA 4LZ1H 1WQSA 3U1IB 5HMAA 1A5HA 1ANDA 1B0EA 1K1JA 1NFUA 5FX5A 5LH8A 3UOUA 3UR9A 5JB9S 2ZDMA 1C1SA 3PLPA 3GCHB 1VGCC 2GCTB 2JETB 2JKHA 1P3CA 2GZ8A 1YBWA 5FPYA 3FZZA 1HJ8A 1SGTA 4I8JA 4JZEH 1ETRH 3A83A 4A1TA 1CHOG 4NG9H 1IQIA 1ARCA 1XXFA 2A45B 4JK6A 1A2CH 3W94A 1LMWB 1S0RA 2J92A 2FODA 3GY5A 2BZ6H 2V6NA 3MH5A 1ZPCA 3RMNH 2ZU2A 2ANMH 3D62A 1SLXB 1FJSA 1BMAA 3SNCA 2Q6GA 4R8TB 3ZZAA 4MPXA 6GCHF 3K65B 4DT7B 1V2UT 1YPGH 4ABFA 5TJXA 1SOZA 3TGJE 1W14U 3IG6B 3EGKH 2BLWA 3B23B 1F92A 1H9LB 1MTWA 5F8ZA 4OS2A 1QHRB 1DWDH 2FDAA 4OGXA 5L6NH 1BT7A 3ESTA 1NRQH 5ETXA 4UFGH 1GG6C 2WINI 4ISIH 3TVJB 1CT0E 1C5QA 1O3AA 2SGEE 1BOQA 1DS2E 3KQEA 5FX6A 1WCZA 1KDQB 2EEKA 1XUKA 1XUJA 1PPCE 1SGCA 1SFQB 1CGIE 3A7VA 1BJUA 2BQ7B 4OS1A 4FU8A 4ZMAH 4HZHA 1VCQA 4LK4A 4H42U 4X1SU 1ELTA 2AGIX 2FOHA 1NPMA 1GHYH 5G4BA 4BXSA 1Z7KA 1MCVA 3LJOA 1OKXA 3A88A 1GBMA 3LOXA 2H5DA 5EPYA 4FUBA 1GHBF 2AYWA 3ELAH 4UONA 1DSUA 1IOEA 2BD2A 5GCHG 1UVUH 3U69H 4A1XA 1MMJN 3EQ0H 5A0BA 1O3NA 2ZTYA 3BN9A 3T25A 4YT7H 1SGFG 8GCHG 1ARBA 1FN6A 2XNIA 3MU1A 2C3SA 4X6MA 1GI5A 2VNTA 2OTTX 4O9VA 2SGFE 2P8OB 4IW4E 2CHAB 3RM2H 3V7TA 5E2PA 1ZPBA 2VJ1A 4BTUB 2VIPA 3LPRA 1MKXK 4WMDA 2BXTH 1P57A 4X1PU 2A7HA 2UUJB 3P92A 3ITIA 1L1NA 4MLFB 1N6XA 1O34A 2OXSA 1EAWA 1X7AC 1VR1H 1O36A 2TGDA 4JZDH 2HLCA 4XDEA 2WPHS 4WH6A 2VVUA 1V2TT 2SGPE 1C5OH 1UMAH 2J9NA 2WPLS 3T29A 9ESTA 3ZVDA 3EA9A 3SV9A 1OOKB 3T27A 3F9EA 1C4V2 4K5ZA 1KY9A 4DW2U 1O2IA 2B0FA 1V2RT 2A31A 2GDDA 2QY0B 1O3HA 4ZUHA 3LGWA 1SGPE 3P95A 1GMCF 1QJ7B 1P9SA 2OQUA 2VH0A 2Z3CA 3B8JA 4A5TS 1SPJA 1K28D 1TBRH 1W7GH 1A61H 2HPPH 3URDA 1SGEE 3VXFH 1AD8H 3A84A 4A92A 4RSPA 4CR9A 1QL8A 5GXPA 3T28A 1UHBB 2BVSH 2OD3B 1FAKH 4WVPE 3L33A 1PYTC 5JFBA 3HATH 4H4FA 3CS0A 1TQ7B 3DUXH 4GCHF 1OX1A 3PO1B 1A3EH 1L0ZA 1TLDA 1GBHA 1AWFH 2KAIB 3M61U 1T7CA 3KF2A 2GMTB 1AE8H 1AN1E 4ZKSU 1HJAB 1UTLM 4UFEH 1O2LA 1O37A 1QURH 1JBUH 3BTQE 5J4SA 1UK4A 1WTGH 2O8MA 1NM6A 1QBVH 4J1YA 8ESTE 2ZGJA 1GGDC 3SJ8A 3A8BA 2A4GA 2BQ6B 2ASUB 3FP6E 3N7OA 3U98H 1O3OA 5A09A 3BG4B 5J4QA 1O3JA 2P3TB 3ZVEA 1F5LA 1G32B 4TWYA 3NZIA 1AKSA 1O5FH 3KQDA 2NWNA 4NZLA 4NSVA 1RD3B 1ELEE 4JYUH 1T31A 1GJBB 1UJ1A 1O3GA 3GOVB 1O5FL 4BXWA 2RDLA 2XYAA 1G36A 2OC0A 3OYPA 3RM0H 1C2DA 1O33A 2OQ5A 1GHAG 4BAMB 1O38A 2ZU5A 3ZZ3A 3RU4E 3MNBA 4CHAB 1F0UA 1YPKH 1W2KH 3F9GA 2FM2A 1CO7E 1GWAA 5ESBA 3ZZ9A 2ZIQH 3E91A 1G2MA 3ATMA 1LQEA 1L2EA 3Q00A 1NFYA 1SSXA 3NUMA 4U01A 3SW2B 3TIUA 2BYAX 1FY8E 1KXAA 4BANB 1DXPA 3UQOA 1HXFH 3WY8A 2YNBA 2QXJA 3ZYEA 1XXDA 2G8TA 6LPRA 1QFKH 1HUTH 2OYAA 4X8SH 3TJNA 2XC0A 1F0SA 1UCYH 1FLEE 1L4ZA 1THPB 5AFYH 1PPEE 5EQRA 2NU0E 1CGJE 1TX6A 1TFXA 1HV7A 1DY9A 1PPHE 4I33A 4LXBH 4Y71A 1ACBE 1IQNA 1ZJDA 1EOLA 3P8NA 1OSSA 2RCEA 1OP0A 1GDQA 2RG3A 1PPFE 2Y81A 1JOUB 1MUEB 2A5IA 3TK6A 4BAHB 3MU5A 3SO3A 3S0NA 1MTNC 2HNTF 5CHAC 1S83A 1C2HA 3GDUA 3HKIB 3ZV9A 1UTNA 1AFEH 5E0GA 1UK3A 1MZAA 1G3BA 2FZZA 2GTBA 2OINA 2WPKS 3B9FH 4WY3A 1FV9A 1F2SE 2PSXA 3M36A 1FNIA 3STIA 5A8ZA 1GVZA 1QNJA 1SQTA 1THRH 3M3SA 2STBE 2CMYA 3PMBB 3BV9B 1H4WA 1GJ4H 5T6DA 2WYJA 1O3BA 3UQVA 1PPBH 5C5OA 3KN2A 4IBLH 1H1BA 2ZU3A 2H5CA 2LNCA 1TPSA 3M35A 2BX3A 4K69A 5A0AE 2QGRA 1O2XA 3MI4A 4ABEA 2D8WA 2PGQB 3PWCA 1AZ8A 1AU8A 1E37B 1TB6H 4SGBE 4KTCA 4RKOB 1N1LA 3UREA 1HAIH 3ATWA 1TWXB 2FOBA 1C5WB 2BLQA 2BY7X 4DIHH 1BRAA 3P70B 3SU3A 2GCTC 1P04A 1TE0A 3SU4A 2DUCA 3O8CA 1AHTH 1HAZB 4AYYB 1DOJA 2BY8X 2BD8A 4I7YH 2SGDE 1ZRKA 4B74A 1ESBA 3VB5A 1GDUA 2ZGXH 3M5NA 5E2OA 2VIVA 5LPEA 1LPGB 2BQWB 3RXJA 3RMOH 5JBCS 2H9HA 1HJ9A 1HBTH 1EP5A 1DVAH 1A1RA 1KXCA 1LCYA 2P95A 1TALA 4AGKA 2ZFSA 5C1UA 1QL7A 3D49H 2A2XH 3GYLB 3E8LA 1AFQC 3MHWU 5EW1H 3LU9B 1J9CH 4X2WA 2P93A 1E0FD 1T4VH 1AVGH 4NWLA 4FUEA 1G3EA 2ZGHA 2PR3A 3V12A 1ANBA 1HYLA 1J8AA 1O2UA 1WSSH 3A7XA 1ELCA 1NC6A 2ZC9H 1VITF 3O8BA 2Z7FE 2BMGB 1TMUH 3UR6A 3PYHA 3SU1A 2CJIA 3SZNA 4IGDA 3GY3A 1AO5A 3H7TA 4JYVH 1QA0A 1GJ7B 1C9TA 4Y0YE 4X1NU 2QXGA 3NXPA 1S81A 4Y10E 1TYNA 4H6TA 1P09A 3A8DA 1WU1A 3M3TA 5HM2A 2XWBI 4YM9A 5A8YA 2HNTE 3RXVA 1C2JA 4JYTA 3I78A 3SNBA 2SGQE 3M3VA 1P2JA 1LDTT 1O5BB 1O2OA 4CRGA 2HGTH 3TGKE 2OLGA 3GCTF 5L2ZH 2GDEH 1BIOA 1V2NT 4FXGH 1C5YB 1FIZA 1BDAA 4ABAA 4KTSA 2A5AA 4KELA 3QWCH 1SGYE 4J2YB 2Y7ZA 2ZGBH 3ZZDA 3UY9A 1TONA 1P11E 2ZHQH 1O5CB 2BM2A 3NKKA 1YYY1 3SI4H 4CH2B 2CHAC 1AUJA 2P16A 1KSNA 4I8HA 1NU7B 2XBXA 2XTTB 1RTFB 1JWTA 1V2ST 1A7SA 4ABIA 1N8OC 3A7YA 2V0BA 1DANH 4K1SA 1SGFA 3U8RH 2M5TA 1XVOA 2O8UA 1TNGA 1GMDG 2O8TA 1UO6A 1VCWA 3PM3A 4HI3A 2BDCA 1NRPH 1O3MA 3A7WA 1ZJKA 1HNEE 4GHQA 2ZCLP 5ESTE 1HDTH 4CRFA 3LH1A 5GIBA 1TABE 2FMJA 1P2MA 4XFQA 2Y6TA 2ZDKA 1J14A 1C1RA 1B0FA 4CRBA 1J17T 1LHFH 1MKWH 2H6MA 3BEUA 1C4Y2 1RXPA 5FXLA 1ZMJA 4DURA 1O2PA 2FS8A 1Z8IB 4GUXA 3HK6B 3SJIA 1RIWB 2ZQ2A 1S6FA 1FUJA 3S7KB 4D7FA 2ZFRH 4INHA 1UVOA 3E3TA 4ZXXH 4OS6A 1UTMA 5C1XA 3QZRA 4AG1A 5CHAB 1C5UA 3P8FA 1NTPA 2QN5T 3PO1C 4I8GA 2O8WA 3RXSA 5DP6A 1H8DH 3TLOA 2ZPSA 4AN7A 1RTKA 4Q7YA 1NRRH 1TMBH 3LGYA 1C5LH 3OSYA 1O31A 1IQEA 2IPHA 3PWBA 5C2ZA 1EB1H 2FESH 1QRXA 1RTLA 1FZZA 2EI8A 3OX7U 1C5TA 2CN0H 3ZZ6A 2P94A 2F9PA 2H9EH 2R3UA 1P02A 1YPEH 1HAHH 4NCYA 2Y80A 2QCYA 4A7IB 1EKBB 1L4DA 2Z9IA 1L1JA 1LTOA 4ZHMU 5DKMA 5C5NA 1LPKB 1PQ5A 1RRKA 1VJ9U 3ZZBA 3GDVA 4B76A 3SBKA 2PKAA 1D6WA 2D1JA 3PLBA 3UWIA 2BLVA 2UWLA 2XXLA 2TPIZ 4JMYA 4CREA 2ILNA 2O8LA 1QRZA 3VFEA 5I46H 1BMLA 1NROH 4U2WA 1DLEA 1KLJH 4MVNA 4TY6A 1NO9H 3VGCB 4DY7B 4X6PA 1SLUB 4TY7A 4CHAC 3RXPA 3T62A 4LOYH 1QB1A 1ZYOA 4XBCA 1SMFE 4BAOB 2G5VA 3DHKH 3LJJA 3LC5A 2FI4E 3PTNA 1ELBA 2R9PA 2WPIS 2FOCA 1SGQE 1BQYA 3RC5A 4X2YA 4XSKU 4CRCA 3ZVGA 1IQLA 1GI4A 4CR5A 2BD4A 1CQQA 2RA0A 2STAE 3NWUA 1AFQB 4AORA 3S9CA 2VWNA 3AW1A 4NZQA 1C5SA 3TITA 1BJVA 3GY8A 1GHBG 3MTYA 2F83A 1UTPA 1V2KT 1WUNH 1W3CA 1GHWH 1O5DH 2ZTZA 1BMNH 2F9OA 3A87A 2FIRH 5T6GA 1MD7A 4O97A 3R3GB 3RXLA 2GV6A 3M5MA 1D6RA 2AMPA 1LO6A 2ZU4A 4FUFA 3BTHE 4HFPB 4Y6DA 1CHOF 4MNXA 5GJ4B 2ZO3H 3RXDA 1WV7H 2C8XB 4IMZA 3SORA 1DUAA 5AVDA 2BDBA 1HAYB 1SHYA 2AMQA 3MU4A 1EZXC 2ZEBA 3UWJH 1C5RA 4DIIH 3SJOA 1C5NH 4X8TH 1W7XH 7GCHF 1O2HA 5EPNA 1C9PA 1XKBC 1VZQH 1C1QA 2ZNKH 3MU0A 1E38B 1PPGE 3FZDA 1AQ7A 3LT3A 2AERH 2C8YB 1TA6A 5BRRE 1K1IA 2HALA 1W12U 2BOKA 2W26A 4WWYA 2G55A 1O2SA 2VH6A