5CE1A

Crystal structure of serine protease hepsin in complex with inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
Knots found
sequence length
369
structure length
361
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASGLQLGVQAVVYHGGYLPFRPNSENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Serine protease Hepsin in complex with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease hepsin
total genus 93
structure length 361
sequence length 369
other databases KnotProt 2.0: S -31
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5ce1A03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 5ce1A01
2XW9A 3SUEA 1C1PA 4U32A 1MTNC 1C2GA 1C5OH 4CRAA 5T6GA 3UNSA 2CV3A 1HAZB 4ABGA 5EODA 5C1XA 3O8RA 2P16A 2PTCE 2QXGA 2PHBA 1S82A 1UTQA 2PSYA 3L3TA 2ALPA 8KME2 1MTWA 3FVFB 1O2YA 3S7HB 2P3FH 4FUFA 3ODDA 1D4PB 2FWWA 1O3HA 1K1JA 1QRXA 4IC6A 1C5NH 1ZOMA 1SLVB 2ZU4A 1K1IA 1P9UA 1QB9A 3CENA 4Y0YE 3PV4A 4JK6A 1YF4A 2WYGA 2OD3B 3PLBA 2ZTZA 3FP7E 1O3OA 1YPHC 3A7TA 5JBBS 1KLJH 3C1KA 2Z9IA 1EATA 2UUJB 1O2WA 2PUXB 2J2UA 3AAUA 2G5VA 3LGTA 4X1NU 3LGIA 1HIAB 3M5LA 2AFQB 2FODA 3ZYEA 4UONA 5GIBA 1EPTA 3EQ0H 1O3FA 2SNVA 1V2LT 1SQTA 2PKSB 1OX1A 1CVWH 1K2I1 3JZ2B 2GCHF 2ZFTA 3LC3A 1ELEE 3ZZ7A 1FXYA 1HAOH 1UK2A 4YTAA 4JZEH 4AORA 3RC5A 2XWAA 1AO5A 1L2EA 1VITH 2FLRH 3SORA 1C5YB 1G32B 2ZHFH 4X6MA 1WYKA 3UPEA 1TOMH 2ZEBA 4FUIA 1GHVH 3LONA 1P9SA 1QURH 1DOJA 3A89A 4NA9H 2XBVA 2GV7A 1FY8E 5AFZH 1QRZA 4UE7H 4NSYA 1NROH 4ABIA 4A1TA 1O2HA 2BD3A 2W7UA 3HKIB 3LKWA 1ZR0A 2FI4E 2IN2A 1FN8A 2GDEH 3QX5H 1F0RA 4B71A 3MTYA 3SN8A 1AKSB 1TBQH 1J14A 5DP4A 4DOQA 3H7TA 5F6MA 5DP7A 1AE5A 3EA7A 3LIWA 1P2JA 1C1SA 3I29A 3MYWA 1KSNA 4I8KA 3MO3A 1XUKA 1L4ZA 1B7XB 2Z94A 3RXBA 1EPTC 4R8TB 1GHBF 3SU5A 3UNQA 1C5LH 1WTHD 1YPMH 4D7FA 1W12U 4HZHA 3ELAH 1TALA 1MU8B 5H4IB 2BLVA 3UY9A 1NO9H 3NKKA 1CGHA 3TH4H 4AGJA 1LVBA 1SG8B 2GTBA 3OX7U 4XBCA 1HDTH 1EAWA 1TAWA 5JB9S 4WXVA 4FVDA 1GHAF 1WOFA 3EA8A 2ESTE 1PYTC 1GJBB 3C27B 1YCPM 4E05H 1Y5AT 4INHA 1W0ZU 1GG6B 2D26C 1O32A 1RD3B 3KNXA 1D3QB 3BV9B 3ZVAA 1GI3A 1OWEA 3ZZ8A 3EYDA 4AFSA 2BY5X 1BHXF 3RMOH 1FV9A 1MBMA 1C1QA 2AERH 5E2PA 3SV6A 2OY3A 4WF8A 3DUXH 4NA8A 1NESE 3A8CA 3HK6B 4HFPB 4ABFA 3AASA 1A5HA 1WUNH 5T3HA 3SU1A 1O5DH 1OOKB 2Y7ZA 4YLUA 1N6XA 1CHGA 4SGBE 2FOGA 4X8TH 3UOUA 1ZPZA 3NUMA 1NS3A 1OXGA 2CF8H 1EAIA 1X7AC 3KIDU 2JETB 2BX3A 3RC6A 1VCWA 1MD8A 1MMJN 1VGCC 1LPZB 4CRBA 2BQ6B 1VR1H 1L0ZA 2QXHA 3P92A 1AFQC 4GAWA 1ESAA 3U8TH 3DFJA 3L33A 3VB7A 1PFXC 1Y8TA 1ETTH 1JXPA 4K60A 6CHAC 2G4UA 1CT4E 4MVNA 2G5NA 5C5NA 2BXUH 1UVTH 1W2KH 7ESTE 2ZU5A 4CHAB 3SI3H 4IN1A 1SLXB 5DP3A 4K8BA 2DUCA 1GJDB 4GCHF 5EW2H 2ZWLH 1GMHF 1QGFA 5GDSH 3ZZCA 4Q7XA 2PKAB 2AMPA 3PLPA 3QTVH 2KAIA 3K2UA 3MH5A 1F92A 2B0FA 1NRQH 1IQKA 4ISHH 3LGYA 3RXSA 1TMBH 1TNKA 1Y5UT 3HGPA 1O2PA 4U01A 4TWWA 1O3GA 1TNJA 3GYLB 5C3NA 3HK3B 3LJJA 2PR3A 2BVSH 5DPAA 1RXPA 5E0GA 1RFNA 1KTTB 2F9BH 1DE7H 1O2KA 2VINA 4HGCA 1DWDH 1C1TA 2BVRH 2HPPH 1IQGA 1O5CB 4JZ1A 4JYUH 3AAVA 1FNIA 2VWOA 2OC8A 4NZQA 1K1PA 2JETC 1UTPA 1XVOA 2Z3EA 2C93B 2OTTX 3R0FA 3PMJA 1GVKB 4B2AA 3D62A 2JH0D 1EPTB 2QY0B 2ZFRH 3VXFH 1E38B 3S7KB 1QTFA 2F83A 3BG8A 2BY7X 5A0BA 1DY9A 2GCTC 1C5RA 3RXOA 3BTEE 1OWDA 4CREA 2PLXA 1MCTA 2FX6A 2Y5HA 4DVAU 1KDQA 4Y0ZE 3O8BA 2UUYA 4NSVA 1GCDA 2FYRA 1ELTA 1P10A 2WV5A 2OXSA 2F9VA 2KAIB 2ODQA 1HBTH 5FPYA 3FAOA 1WSSH 4TPIZ 1TLDA 4Y6DA 2ZO3H 2ZIQH 3ITIA 1Y3YA 8LPRA 3PMAB 1V2OT 1GHYH 2UWPA 2CMYA 2BVXH 3DFLA 3RXPA 1W14U 1SGTA 1ZMJA 2V35A 1NU7B 5LGOA 4BAMB 1C5PA 4JK5A 3H5CB 1IQEA 1GWAA 1QA7A 4FU9A 2SGDE 3SUGA 1GGDC 1ELVA 7GCHF 4YT7H 2ZZUH 2C8XB 3SNBA 3A8BA 1BZXE 5E0JA 1O36A 4Z0KA 3F9FA 1G3DA 1SGFA 1XUGA 3SO3A 1VCPA 4MG3A 5LPEA 4GHTA 4X6PA 2LNCA 4DURA 4FU7A 2ODYB 4D8NA 1O38A 1V2NT 4DG4A 2TBSA 1KXDA 4AB9A 3ZV8A 3MHWU 1W3CA 2XCNA 3MNSA 3E90B 1BRBE 1O5BB 5LPRA 4MQAA 3MH6A 1LTOA 4VGCC 5B6OA 2ZFPH 2ZGCA 3PWBA 1O30A 3RDZA 4CRFA 1UTOA 2FOBA 3M5NA 3PB1E 1P3EA 4U30A 1UK4A 1SFIA 1DXWA 1Z8IB 2BDAA 5I46H 1YGCH 4ZROA 1ESTA 2BXTH 4GLYA 1XMNB 3SGQE 1OYQA 3RXRA 2A0QB 2W7SA 1SI5H 2YNAA 2UUFB 2ZHWH 5E8EH 2UUKB 3ZZAA 1P0SH 4X1RU 2RCEA 2VU8E 3SQEE 2P59A 1GI5A 5A8YA 1JIMA 1LQDB 1Y3VA 2WV4A 1YP9A 1NRSH 7KMEH 5HYOA 3LT3A 3SV9A 4GSOA 1YC0A 2V0BA 3VEQB 1YBWA 2HPQH 1GJ7B 3RXDA 1HYLA 3QZQA 3MO9A 1SR5C 1V2QT 3U9AH 4BXSA 1ETRH 3BTGE 4YOGA 4CH8B 2H5CA 1H9HE 1HAVA 1G3CA 1SGCA 2ANMH 2NU3E 1HXEH 1W8BH 1G36A 1PQ8A 3M7TA 4KTSA 2JP0A 1GI9B 3VFEA 1FJSA 5EQSA 1C2HA 2XCFA 1RRKA 5AHGH 4TY7A 3ZZ9A 2JA4A 1QBVH 2CHAB 3LGUA 4ISIH 1O5GH 2ZDVH 4M7GA 1V2PT 1Y59T 1AFEH 2FM2A 1C9PA 1E37B 1GI1A 1OPHB 3RXCA 5GWZA 1GL1A 2O8TA 1THSH 2WPIS 2OC7A 3M3VA 1CHOG 1ZSLA 1O33A 1VCQA 5J4QA 2A2XH 1BTUA 1TA2A 3FP6E 1V2ST 1UK3A 5A09A 1GVLA 1D3DB 2VH0A 5CE1A 2GZ7A 1C5SA 1U6QA 4O3TA 1C1VH 1DPOA 3A7YA 2BDHA 3RUOA 1T8MA 1N1LA 2F9OA 2ZHDA 4B76A 1HV7A 1ZRBA 3ZV9A 1VZQH 1AWHB 4B2BA 1NPMA 1V2TT 2PUQH 3S0NA 1Z6EA 2F9PA 3DT0H 4B73A 3T28A 1MBQA 1GMCF 5ESTE 4KELA 3PTBA 3UR6A 3V7TA 3ZYDA 1GGDB 5GCHG 1UCYE 1WQVH 4WVPE 1HB0B 1JRTA 1LHEH 4D9QA 4NG9H 3A81A 3TH3H 1BBRK 2G4TA 3E91A 1YLCA 1UHBA 4A5TS 1BIOA 1F0SA 1H8IH 1A7SA 4XE4A 4O97A 1P2KA 3KN2A 4CBOA 5DP9A 2BMGB 1O2LA 2ZA5A 1Q2WA 2ZC9H 1UTKA 1MKXH 1IQIA 2Q6FA 3E6PH 1QA0A 3CS0A 4AOQA 3OYPA 3V3MA 1ZHMA 2FEQH 3E8LA 3ESTA 1FY3A 2BD9A 1HPGA 2OP9A 3E1XB 5FX5A 3URCA 2A7HA 3RXUA 1HAXB 1P01A 1XUHA 3F6UH 1V2KT 3PO1B 2A2QH 3PMHB 1SGYE 4ZXXH 2A7JA 1TPPA 1V2WT 1QL9A 2BDYA 3BIVH 3SGAE 5HM9A 5PTPA 3M3TA 4UFDH 3LGVA 1C2LA 3RMMH 4XFQA 2OQUA 3A85A 4Y7BA 4BXWA 1QHRB 2SGFE 1BTWA 1E36B 5J4SA 1RTLA 1IQJA 2GV6A 1OWIA 1G3BA 3M36A 1O0DH 3GCTG 3SNAA 2AMDA 4MNVA 1QY6A 2GCTB 2VIPA 1GMHG 4O3UA 2AYWA 4WWYA 1ZRKA 2PKSC 1P11E 1S83A 2ZFSA 1T32A 4MPVA 4X8SH 3RXIA 1LHGH 1C2EA 5T6DA 1O3JA 2PV9B 3SU0A 3UWIA 1GJ5H 1MTSA 1K21H 2O9QA 3DHKH 4Q80A 2FIRH 4YO9A 1NU9A 1NT1A 1GI2A 1SC8U 3GISB 3JZ1B 2GGVB 2THFB 1ARCA 1GCTB 3URDA 4RSPA 1UVPA 3T27A 3F9GA 1TNIA 1C4Y2 1O5EH 4AGKA 1EASA 5HXFA 1C1MA 1ELFA 3IG6B 3OSYA 4D9RA 1EUFA 2FTMA 1LPKB 1IQFA 4ISLA 3TJVA 2FX4A 4JCNA 2J4IA 1C2KA 3RXJA 4UDWH 1OYTH 3RXVA 1ORFA 2TPIZ 2ANKH 1XXFA 1LKAA 3BG4C 4JYVH 2R0KA 1INCA 2LPRA 2FYQA 3MU5A 3U1IB 1QRWA 4UD9H 1FLEE 2R3YA 3M37A 2G81E 3PO1C 3A84A 2NU1E 2AIPA 1W0YH 1AVGH 1OWHA 1MCVA 2A31A 1D9IA 1O2GH 1GDQA 1S0QA 1FN6A 3PLKA 3UNRA 1ZPCA 3IITA 5IYTA 1W13U 2CJIA 2G8TA 3VB3A 1LKBA 1GBFA 3B8JA 2VIWA 4FU8A 1IQLA 4ABHA 4FUJA 3O8CA 5IDKA 4ZHAA 3TLOA 1UO6A 1P2QA 1K28D 1TX8A 1NFXA 2BM2A 2SGQE 3CS7A 2Z9GA 1ZGVA 2GX4A 3GYMA 1CA8B 2ZP0H 5HM2A 3S69A 1YCPK 4ZXYH 4I8GA 4AFQA 4BAHB 1HFDA 2OBQA 1BTXA 2A5IA 3NXPA 1JMOH 1UTJA 1UMAH 3QTOH 4BTTB 2BZAA 2TGPZ 1LHFH 3MNBA 4J2YB 2VIVA 2Y80A 4Q2KA 3VGCC 1T4UH 2QGRA 1NY22 2PW8H 4DY7B 2Q6DA 1G2MA 1C5ZB 1ABJH 2ZECA 3MU8A 4IGDA 4CRCA 3T25A 1RS0A 3LU9B 1XXDA 2D1JA 3QZRA 3OY5U 1DWCH 5TCCA 4MPXA 2J38A 5A2MH 1ZLRA 2HRVA 1AUJA 1DM4B 3TH2H 2WYJA 2PWXA 2OQ5A 2QIQA 3GICB 4XBDA 1FI8A 1TMUH 1FY4A 5TJXA 1TIOA 4BAQB 2R9PA 3ZZBA 1S6FA 1PPFE 3KQCA 3RXTA 5DGJA 4ZKNU 4NWLA 1BRAA 1BHXB 2GZ9A 4ABBA 2HGTH 3MNXA 1FY1A 2HNTE 2A5KA 2WPMS 1AVXA 3Q00A 4CH2B 5JBAS 3KCGH 3TPIZ 1TA6A 5DO4H 1CSOE 1GBIA 3G01A 5FXLA 1CT2E 4MNXA 1EP6A 5FBEA 2R3UA 1A0LA 1GJAB 1SBWA 2Y6TA 4AFUA 3UR9A 1BMLA 1J17T 1DICA 5HMAA 1ZTKA 1RJXB 1MTUA 4CR9A 3E0PB 1AMHA 2EA3A 9ESTA 1O35A 4AYVB 1M9UA 1SLUB 1CT0E 1ESBA 2ZGBH 2XBXA 4Y7AA 1EAUA 2VIQA 4IBLH 1C1OA 1PPEE 1EX3A 2K1QA 5DP6A 2FS9A 1C2JA 3QLPH 1BQYA 3GDUA 3UQVA 3E16B 4Y10E 1S85A 3HKJB 1O37A 3UIRA 1KLIH 3NPSA 7LPRA 2QXJA 1A61H 4BTUB 2QXIA 3RM0H 1WBGB 4I31A 1DVAH 6GCHG 1GBMA 1ZMNA 1EOJA 1ELCA 1P2NA 4DIHH 2GZ8A 5FPTA 4XBBA 2R0LA 3BTHE 4BOHA 1ANEA 1O3EA 5GPIB 2J95A 2HNTC 4WY3A 1HNEE 2BQ7B 5AF9H 5DP5A 2BY9X 2GD4B 4Z6AH 3SJOA 1MTNB 1UTMA 1MAYA 2OYAA 1L1JA 7GCHG 1HJAB 1TGTA 1FAXA 3H7OA 4DCDA 3TU7H 3FFGA 1C5XB 2O8MA 3GCHC 1GDNA 4XSKU 4JZDH 4GVUA 3ZZ3A 1F2SE 1S0RA 4FUBA 1XUIA 1HAVB 1W7XH 1HAIH 5EG4A 1ZTLA 4TY6A 2WINI 4K1EA 1YPGH 2Z3CA 3CP7A 1ANCA 4MPUA 1P03A 4NZLA 1IQHA 3RU4E 4ABJA 8ESTE 3QDZB 3MWIU 4LK4A 1UTLM 1NRRH 3EE0B 1O3LA 1RTFB 3E0NB 1C5QA 5K7RA 1SL3A 1DSUA 3QO6A 2Z9JA 2ZDKA 3M5OA 2ZQ2A 3SNDA 2XBWA 4BTIB 3UFAA 4GUXA 4H42U 1CA0C 1V2JT 4Q7ZA 1BDAA 2VIOA 3SJIA 4Y79A 2FESH 4YOJA 2FS8A 4YOIA 1THRH 3T26A 1XUJA 3LDXH 1H9LB 3LH3A 1CBWB 1DXPA 1Y3UA 1P57B 2Z7FE 1B0FA 1FMGA 5EGMA 1IHSH 4A6LA 1GI6A 1YM0A 1Z7KA 1QL7A 3ATLA 1B0EA 2GVFA 2VWLA 1ZHRA 2ILNA 4D7GA 1QL8A 3GY2A 5C20A 1YKTA 5EXMA 3RXEA 3SQHE 2B5TB 4DW2U 4I7YH 3K9XB 1CE5A 4K8YA 2VWNA 5A0CA 1SGNE 1UCYH 4B2CA 1H1BA 1HAGE 2VVUA 4OGYA 1EP5A 3BF6H 1Z1IA 2ZG0H 4KTCA 1AHTH 4CR5A 1O2UA 2IOTA 1ANDA 3A82A 1GMCG 2RA0A 2A4QA 3ATWA 3GCNA 2Y5FA 4OS7A 2ZPRA 1N6YA 2BLOA 1UJ1A 3DA9B 1C2FA 3T62A 1J15A 3BTDE 4A1XA 1O2TA 4FUGA 4X2XA 1W10U 2HALA 3HPTB 1MKWK 1UVUH 2A7CA 5EQRA 4A1VA 2SGEE 1ZSJA 1LHCH 2AS9A 1O31A 1NN6A 1O3NA 4HTCH 1NRNH 2J94A 4CRGA 3RP2A 2PGQB 2F9NA 3SU6A 1SVPA 3LGWA 1ABIH 1TNGA 3UREA 1ACBE 1A5GH 1C4U2 2V3HH 3SU4A 1QR3E 1BT7A 1GL0E 1GJCB 1T8NA 4X8VH 2YNBA 2VVVA 1QNJA 2FI3E 1BMAA 1RIWC 1WV7H 1GI0A 3M61U 4X6OA 2C8YB 1DLEA 2Q1JA 2ZI2H 3GY6A 1Z71A 1GDUA 2H2ZA 4MLFB 1GJ4H 2FXRA 2XRCA 1P57A 1PPHE 1JBUH 1S84A 1GHAG 1A4WH 1J9CH 1QB6A 2CHAC 5CMXH 2ZTXA 1SGDE 1QBOA 3GY7A 1NFWA 4MNWA 5ABWA 1GHXH 2ZCKP 4UEHH 2V6NA 2W5EA 4IW4E 1AKSA 2FDAA 3TGIE 1YCPH 3ZZ5A 2VWMA 1K22H 2HLCA 1YLDA 1S6HA 1EB2A 3A8AA 3P6ZB 1AVWA 1AE8H 2RG3A 2O8LA 1ARBA 1DWEH 5C1YA 2CXVA 1O3PB 1VJAU 2AH4X 3EDXB 1Y3WA 2JH5D 2B7DH 1LVYA 3RLWH 2NU2E 5DJ7A 1O3CA 4TWYA 2XYAA 3ZVBA 5GCHF 3K6YA 5FX6A 4DGJA 1FDPA 1F5KU 2G52A 3MI4A 3KEEA 4B75A 1E0FD 1AI8H 3RMLH 2BLQA 3QWCH 4NCYA 5F03A 3RXFA 2JKHA 1KDQB 4A92A 2JOPA 4NIXA 3RXAA 3RXQA 2ODPA 2Y7XA 4YLQH 1ZGIA 1EQ9A 3D23A 1C2IA 1T7CA 1XM1A 1NRPH 2F91A 2BD8A 3NCLA 3Q3YA 1GHWH 1BY2A 1G30B 3EA9A 1C2MA 1GMDF 2JH6D 4KP0A 1TRYA 5BPEA 1KXFA 1TX7A 5A8XA 2C3SA 1QJ1B 2ZFQH 1GVZA 1HAPH 1KYNA 4ISOA 3P17H 3F68H 1W11U 4THNH 2XBYA 4Y8ZA 2BD7A 1O2QA 1KXEA 1O5FH 3RMNH 3TJNA 4Y71A 3P95A 2ZHQH 2FOCA 1Z6JH 2F3CE 4K69A 1FIWA 4B1TA 2VB0A 1BJVA 1BMNH 2WPHS 1GI4A 3MU1A 3ZVEA 1DWBH 1JWTA 1HGTH 2ZHEH 1ZMLA 3GY5A 1O39A 1GBHA 4NWKA 2NU4E 3RXHA 2CN0H 4F49A 5F8XA 1W7GH 4UFFH 2HOBA 3PWCA 5CHAC 3SU3A 3KQEA 2AGGX 1GBTA 4NIWA 5F8ZA 2GT8A 5E2OA 2QN5T 3OTJE 1PYTD 1BRCE 3BTWE 1SOZA 3Q77A 1O3IA 3RXGA 4DT7B 4Q7YA 2ALVA 3DD2H 1GCTC 2XC0A 1WAYB 5C1UA 5LH8A 3U98H 1MKWH 2BY6X 5DP8A 4FUEA 2QF3A 1ZJKA 1PJPA 3UUZA 3AW0A 2GDDA 2ZGXH 4GHQA 2H1UA 1P12E 2IPHA 1C1NA 1CO7E 1P2IA 1C4V2 1YPJH 1V6DA 1C5WB 3V0XA 3ZVFA 4MDSA 4FXGH 2GCHG 1LO6A 5EXLA 1SHYA 1O5FL 1D3TB 3SHAH 3PROA 4AYYB 1FPCH 1MZAA 3SBKA 2EI6A 1PQAA 1ELGA 2O8WA 3ATMA 3P8GA 3A83A 3TK9A 1VGCB 2A4GA 2TGTA 1P2OA 1DANH 1SQOA 2ZDLA 2H9TH 3P8OA 4ABDA 1YPEH 4K2YA 2HNTF 4WMDA 3RU4T 3FZZA 1TPAE 1KXAA 5ETXA 4JZIA 1GBBA 1DY8A 2GP9B 2ASUB 3ZVGA 1J16A 5I25A 3M7QA 1HJAC 2SGPE 2NWNA 4NIYA 4K1TA 4AN7A 2OLGA 2FOMB 4ZMAH 2BDIA 1TRNA 3GCHB 2Z3DA 4I32A 1TMTH 3RM2H 2B8OH 4CHAC 5EQQA 2G00A 1L1NA 1KLTA 4OS1A 3TGKE 1TONA 2ZGJA 4A7IB 3BTQE 2ZCLP 2ANYA 2QA9E 1UTNA 4ZHLU 1HUTH 3FANA 2WPJS 1BRUP 4IS5A 1WU1A 1YYY1 2A45B 2A4RA 3SNCA 1NFYA 3MOCA 3TNSA 1TQ7B 1BCUH 3SUFA 5JYIA 1GI8B 1TYNA 1MAXA 3ZVDA 4IC5A 1BTYA 5DK1A 1CQQA 8GCHF 3FP8E 5JDUB 5A0AE 4ABAA 4Y8XA 1TGNA 1QJ7B 2FLBH 5DG6A 3BIUH 2BTCE 3A80A 2XC4A 4JMYA 1N8OB 3PTNA 2XWBI 3BEIB 1THPB 1P3CA 1Z8GA 2BD5A 1ZHPA 1AN1E 4OS4A 2OTVA 2Y82A 4IMZA 3BTFE 3RXLA 1BJUA 3SGBE 2ZDAH 4MNYA 2OC1A 2STAE 1HIAA 1AIXH 2D8WA 4U2WA 1G37A 3M5MA 5HGGA 1QJ6B 1L4DA 3A7WA 4YT6H 2FP7B 1L1GA 2OBOA 1JIRA 4AG2A 1E35B 1SGPE 4I8JA 4ZKRU 3M3SA 5L6NH 2EI8A 1UVOA 5GXPA 1IQNA 2ZTYA 1AB9B 2QC2A 4R0IA 4H6TA 1SFQB 2W26A 4MPWA 1PPGE 1BOQA 1HRTH 1SGFG 1SLWB 2TIOA 3BN9A 2J9NA 4XDEA 1GJ6A 4E06H 1T31A 2VIDA 2H9EH 2STBE 2VJ1A 1TPOA 1KTSB 2BQWB 1VITG 1EJMA 1OP2A 1GBJA 2AIQA 2BDGA 4QT8C 2BDBA 1DX5M 3B23B 3HGNA 4TPYA 1A5IA 1A3BH 2FOFA 4PROA 2PKAA 3TJUA 4Y8YA 2HVXA 1XVMA 2I6QA 3V12A 1QFKH 3SV7A 1G2LA 1AWFH 1GJ9B 3W94A 3R3GB 3A7VA 2EC9H 1O3KA 3QGNB 1K1MA 1SSXA 1AD8H 2SFAA 1N8OC 1QBNA 3ATIA 3GCOA 4BNRA 2CGAA 1C5UA 1CU1A 2P95A 3SZNA 4XOJA 2Z6BD 3VB4A 3EAJA 2BOHB 3KHVA 1TOCB 1FZZA 3A86A 5A8ZA 3LH1A 4OGXA 3VB6A 4ZHMU 1TPSA 2A1DB 2GT7A 2ZCHP 4VGCB 3U69H 1FQ3A 3K6ZA 2ZPQA 3TIUA 3STJA 1MTVA 3MH4A 2AGEX 2WUBA 2VNTA 4X2YA 1P02A 1F0TA 2AGIX 2BB4A 2I6SA 1TBZH 2A4OA 3KF2A 3A87A 1ETSH 3MMGA 2OUAA 3F9EA 4AFZA 5JPMH 1O34A 2H5DA 2GMTB 1OSSA 1KIGH 1OS8A 1C2DA 2EEKA 3LC5A 1SQAA 4OS5A 2QV1A 1AGJA 1OWKA 2BDCA 4TYDA 1DUEA 2Z9LA 1AFQB 1OWJA 1AY6H 4K1SA 2ZKSA 2BD2A 1ZTJA 4WMFA 3RLYH 1TBRH 4J1YA 3QUMP 2TGDA 1FONA 1ELDE 3M35A 1V2MT 1SGRE 4RN6A 2P8OC 1VITF 2QF0A 4B74A 2SNWA 4WH8A 3Q3KA 3RXKA 2GKVE 2H6MA 3WY8A 4ZH8A 1D6RA 1MD7A 2FOHA 3NK8A 1O2JA 1SGIB 1JRSA 3BEUA 2WPKS 4K3JA 1XX9A 3FZDA 4OS2A 1V3XA 3S9BA 1EZSC 1PPBH 4SGAE 1TFXA 3P70B 1EZQA 1Y3XA 1TGBA 1MU6B 4OS6A 2Q6GA 2OCVB 2AMQA 5EW1H 2XTTB 1HAYB 2QAAA 3P8FA 1O3MA 1EAXA 2VGCB 1CGIE 4GPGA 1LMWB 3SV8A 1BUIA 2D2DA 2BOKA 3VXEH 4BAKB 2F9UA 2XC5A 2CF9H 4X6NA 3Q3XA 3IWMA 1UVSH 4AZ2B 1EZUC 1GBEA 2OC0A 3BTTE 1PPCE 4MTBA 3UOPA 4NIVA 4ZAEA 5T6FA 5C67A 1BTZA 1NFUA 5FAHA 5G4BA 3SI4H 1FUJA 1EJAA 2GMTC 4BAOB 4BANB 3KQDA 1EXFA 3B9FH 1O2MA 1HJ8A 2HWLB 1CHOF 5EPNA 2FO9A 1HLTH 3UQOA 4CBNA 1OP8A 4Y11E 1FIZA 1GPZA 1LQEA 4GCHG 2EI7A 1C5VA 2ZDMA 2C8ZB 3OU0A 1CA0B 3AVZA 2P8OB 1QQUA 2C90B 5CHAB 1YPHE 4E7RG 1HXFH 1QIXB 3STIA 2PFEA 1TGSZ 4UFEH 2UWOA 1B5GH 2FTLE 1XKBC 4WH6A 4ABEA 1D3PB 2H9HA 5E0HA 5DKMA 5EXNA 4INLA 1TB6H 1LHDH 3GY3A 1ZPBA 1A0JA 1LVMA 4X2VA 5ESBA 5FBIA 1J8AA 3TK6A 2FZZA 3U1JB 4X8UH 1Y5BT 2AEIH 1ELBA 3UTUH 1SMFE 1WTGH 4KGAA 1KY9A 5L2ZH 2UWLA 3ZZDA 2M5TA 5AFYH 1K9OE 1F5RA 3A7ZA 1O2XA 4JYTA 1SGQE 4YZUA 4LZ4B 2PGBB 3RU4D 1O3BA 5GJ4B 1LDTT 1S81A 2YOLA 5AVDA 1C1UH 1O2OA 1K1OA 1TQ0B 1GBAA 3U8RH 3W95A 2P3UB 4UFGH 2XXLA 3L6PA 3QGJA 1O5AB 1O2IA 1MQ5A 1MQ6A 4IN2A 1O3DA 2BHGA 2IJOB 3MO6A 2ZF0H 1HCGA 1MKXK 1GBDA 3KL6A 1DDJA 3D65E 4RKJB 2VH6A 3GCTF 4RKOB 1RGQA 3ATKA 1QQ4A 3V13A 2ZNKH 1EB1H 4X0WU 2A5AA 2Z9KA 1P8VC 4NA7A 1TX6A 2ANWA 5BRRE 5L30H 3SUDA 3KQBA 1A2CH 4FUHA 1A1RA 1WQSA 4NFFA 4I33A 1GI7B 3NZIA 1AUTC 4DJZB 2J34A 2DE8A 1NM6A 1IHTH 2WUCA 6ESTA 4JZFH 3LJOA 1H4WA 3I78A 1P2MA 2BYAX 1LVOA 2G51A 4LXBH 4CRDA 1UHBB 1KXBA 1O2ZA 5LPFA 1ID5H 1RIWB 9LPRA 2C8WB 4DIIH 1EZXC 1O2SA 2J92A 1C9TA 2Y81A 3ENSB 1GG6C 3EGKH 4Y76A 3S9AA 3MFJA 4O9VA 1OP0A 1K1NA 1O3AA 1Q3XA 1TE0A 4KTUA 3MU0A 4I8HA 2BY8X 3KGPA 3P8NA 3BG4B 2G55A 2ZU2A 4WMEA 3ODFA 2TGAA 3F1SB 4H4FA 1CBWC 1IOEA 1NTPA 5JBTA 1DS2E 3SU2A 2B9LA 3O8DA 1C5TA 4IMQA 1P09A 3AW1A 1AZ8A 4F4OC 4K5ZA 3TK5A 1GBKA 2P94A 2FMJA 2ZFFH 1EKBB 1FAKH 1C1RA 3SW2B 2ZU3A 3SHCH 1ELAA 1GHZA 2ZPSA 1F5LA 1GBCA 1AZZA 1C5MD 4ZKSU 2A32A 6GCHF 1BB0B 1Z8RA 1PQ7A 1BA8B 1SPJA 3TVJB 3ZVCA 1IAUA 1DLKB 5TCAA 1O2RA 3BSQA 1A46H 5C5OA 4E7NA 1PQ5A 5JB8S 4LOYH 1TNLA 1A0HB 4FUDA 2ZU1A 1ZJDA 3GDSA 4YESB 4ASHA 1XUFA 3QN7A 2XNIA 1AB9C 1TABE 1TNHA 3TITA 1QB1A 2Y5GA 1IQMA 1UCYK 4D76A 4ESTE 1T4VH 3GDVA 1O2VA 1G3EA 1ZZZA 1SB1H 2QCYA 2NU0E 3VPKA 1RTKA 1O5EL 3SJ8A 3VGCB 3MNCA 1FY5A 1SOTA 1BTHH 1D6WA 3MU4A 4ZKOU 1KXCA 4I8LA 3TGJE 4AX9H 1BTPA 5C2ZA 2ZDNA 1Z8JB 1GHBG 5EU8A 2RA3A 3SV2H 1NZQH 3A88A 2WPLS 1HJ9A 5EOKA 2W3IA 1Z1JA 2BX4A 1MH0A 1BBRH 2BLWA 3F9HA 3SJKA 2V3OH 5FCKA 3K65B 4NFEA 3UWJH 1V2RT 1CGJE 2R2WU 3PMBB 4KKDA 2FI5E 2O8UA 1ZYOA 2TRMA 1F7ZA 1K1LA 3OY6U 3T29A 1GJ8B 1H8DH 3HATH 4FVBA 1C1WH 4X2WA 1FPHH 5L2YH 3SJ9A 1TGCA 3T2NA 2VGCC 3A8DA 3SOSA 1G9IE 1DT2A 1A3EH 1LCYA 3GY8A 3RXMA 1V2UT 1T8OA 5JFBA 3N7OA 2W3KA 4ISNA 5FCRA 2FOAA 1V2VT 4H6SB 2R2MB 4WJG2 2ZQ1A 3TJOA 4ZUHA 1GBLA 4X1SU 5K0HA 1SHHB 1Q31A 3VB5A 1YPKH 2PTNA 2FOEA 3PYHA 1BMMH 3E3TA 1TRMA 1TWXB 6CHAB 2P93A 2BZ6H 4AB8A 5JBCS 1BBRE 5FHTA 1WCZA 3GY4A 1ZSKA 1DSTA 1HAHH 3QK1A 1P04A 3M7UA 1MZDA 1T8LA 3LOXA 1EJNA 3TNTA 3U8OH 4HI3A 1DUAA 1XKAC 5EPYA 2PSXA 1ANBA 1P05A 1SGEE 1BITA 3I77A 1DITH 3RC4A 2BD4A 2OINA 3BTKE 3ZZ4A 2ZGHA 4FUCA 4X1QU 5FPSA 1GMDG 4X1PU 1EOLA 1DFPA 1JOUB 6LPRA 2DE9A 3SNEA 4YM9A 1O2NA 3T5FH 4AG1A 4O03A 2RDLA 4WXIA 3S9CA 3BEFB 1E34B 1YPLH 3BTME 2QYIA 3LPRA 3A7XA 1AU8A 5SGAE 2ULLA 4INKA 1S5SA 3NWUA 1MUEB 1NC6A 1P06A 4NGAH 2P3TB 2VVCA 3MH7A 2SGAA 1H9IE 3ZZ6A 1QCPA 1VJ9U 1F0UA 1LPGB 1OKXA 3GOVB 3Q76A 8GCHG 2FPZA 3PM3A 3D49H 1AQ7A 4LZ1H 1PPZA 5F8TA 2C4FH
chains in the Genus database with same CATH superfamily
2XW9A 3SUEA 1C1PA 4U32A 1MTNC 1C2GA 1C5OH 4CRAA 5T6GA 3UNSA 2CV3A 1HAZB 4ABGA 5EODA 5C1XA 3O8RA 2P16A 2PTCE 2QXGA 2PHBA 1S82A 1UTQA 2PSYA 3L3TA 2ALPA 8KME2 1MTWA 3FVFB 3DSPA 1O2YA 3S7HB 2P3FH 4FUFA 3ODDA 1D4PB 2FWWA 1O3HA 1K1JA 1QRXA 4IC6A 1C5NH 1ZOMA 1SLVB 2ZU4A 1K1IA 1P9UA 1QB9A 3CENA 4Y0YE 3PV4A 4JK6A 1YF4A 2WYGA 2OD3B 3PLBA 2ZTZA 3FP7E 1O3OA 1YPHC 3A7TA 3OAAD 5JBBS 1KLJH 3C1KA 2Z9IA 1EATA 2UUJB 1O2WA 2PUXB 2J2UA 3AAUA 2G5VA 3LGTA 4X1NU 3LGIA 1HIAB 3M5LA 2AFQB 2FODA 3ZYEA 4UONA 5GIBA 1EPTA 3EQ0H 1O3FA 2SNVA 1V2LT 1SQTA 2PKSB 1OX1A 1CVWH 1K2I1 3JZ2B 2GCHF 2ZFTA 3H09A 3LC3A 1ELEE 2L74A 3ZZ7A 1FXYA 1HAOH 1UK2A 4YTAA 4JZEH 4AORA 3RC5A 2XWAA 1AO5A 1L2EA 1VITH 2FLRH 3SORA 1C5YB 1G32B 2ZHFH 4X6MA 1WYKA 3UPEA 1TOMH 2ZEBA 4FUIA 1GHVH 3LONA 1P9SA 1QURH 1DOJA 1VKYA 3A89A 4NA9H 2XBVA 2GV7A 1FY8E 5AFZH 1QRZA 4UE7H 4NSYA 1NROH 4ABIA 4A1TA 1O2HA 2BD3A 2W7UA 3HKIB 3LKWA 1ZR0A 2FI4E 2IN2A 1FN8A 2GDEH 3QX5H 1F0RA 4B71A 3MTYA 3SN8A 1AKSB 1TBQH 4YXWD 1J14A 5DP4A 4DOQA 3H7TA 5F6MA 5DP7A 1AE5A 3EA7A 3LIWA 1P2JA 1C1SA 3I29A 3MYWA 1KSNA 4I8KA 3MO3A 1XUKA 1L4ZA 1B7XB 2Z94A 3RXBA 1EPTC 5CDFE 4R8TB 1GHBF 3SU5A 3UNQA 1C5LH 1WTHD 1YPMH 4D7FA 1W12U 4HZHA 3ELAH 1TALA 1MU8B 5H4IB 2BLVA 3UY9A 3FO8D 1NO9H 3NKKA 4OM9A 1CGHA 3TH4H 4AGJA 1LVBA 1SG8B 2GTBA 3OX7U 4XBCA 1HDTH 1EAWA 1TAWA 5JB9S 4WXVA 4FVDA 1GHAF 1WOFA 3EA8A 2ESTE 1PYTC 1GJBB 3C27B 1YCPM 4E05H 1Y5AT 4INHA 1W0ZU 1GG6B 2D26C 1O32A 1COWD 1RD3B 3KNXA 1D3QB 3BV9B 3ZVAA 1GI3A 1OWEA 3ZZ8A 3EYDA 4AFSA 2BY5X 1BHXF 3RMOH 1FV9A 1MBMA 1C1QA 2AERH 5E2PA 3SV6A 2OY3A 4WF8A 1BMFD 2RFKC 3DUXH 4NA8A 1NESE 2AHME 3A8CA 3HK6B 4HFPB 4ABFA 3AASA 1A5HA 1WUNH 5T3HA 3SU1A 1O5DH 1OOKB 2Y7ZA 4YLUA 1N6XA 1CHGA 4SGBE 2FOGA 4X8TH 3UOUA 1ZPZA 2CK3D 3NUMA 1NS3A 1OXGA 2CF8H 1EAIA 1X7AC 3KIDU 2JETB 2BX3A 3RC6A 1VCWA 1MD8A 4FETA 1MMJN 1VGCC 1LPZB 4CRBA 2BQ6B 3PV2A 3KQ5A 1VR1H 1L0ZA 2QXHA 3P92A 1AFQC 4GAWA 1ESAA 4P00A 3U8TH 3DFJA 3L33A 3VB7A 3WWFA 1PFXC 1Y8TA 1ETTH 1JXPA 4K60A 6CHAC 2G4UA 1CT4E 2KCAA 4MVNA 2G5NA 3N99A 2BXUH 1UVTH 1W2KH 5C5NA 7ESTE 2ZU5A 4CHAB 3SI3H 4IN1A 1SLXB 5DP3A 4K8BA 2DUCA 1GJDB 4GCHF 5EW2H 2ZWLH 1GMHF 1QGFA 5GDSH 3ZZCA 4Q7XA 4Q4LA 2PKAB 2AMPA 3PLPA 1SKYE 3QTVH 2KAIA 3K2UA 3MH5A 1F92A 2B0FA 1NRQH 1IQKA 4ISHH 3LGYA 3RXSA 1TMBH 1TNKA 1Y5UT 3HGPA 1O2PA 4U01A 4TWWA 1O3GA 1TNJA 3GYLB 5C3NA 3HK3B 3LJJA 2PR3A 2BVSH 5DPAA 1RXPA 5E0GA 2V7QD 1RFNA 1KTTB 2F9BH 1DE7H 1O2KA 2VINA 4HGCA 1DWDH 1C1TA 2BVRH 2HPPH 1IQGA 1O5CB 4JZ1A 4JYUH 3AAVA 1FNIA 2VWOA 2OC8A 4NZQA 1K1PA 2JETC 1UTPA 1XVOA 2Z3EA 2C93B 2OTTX 3R0FA 3PMJA 1GVKB 4B2AA 3D62A 2JH0D 1EPTB 2QY0B 2ZFRH 3VXFH 1E38B 3S7KB 1YY3A 1QTFA 2F83A 3OEED 3BG8A 2BY7X 5A0BA 1DY9A 2GCTC 1C5RA 3RXOA 3BTEE 1OWDA 4CREA 2PLXA 2J98A 1MCTA 2FX6A 2Y5HA 4DVAU 1KDQA 4Y0ZE 3O8BA 2UUYA 4NSVA 1GCDA 2FYRA 1ELTA 1P10A 2WV5A 2OXSA 2F9VA 2KAIB 2ODQA 1HBTH 5FPYA 3FAOA 1WSSH 4TPIZ 1TLDA 4Y6DA 2ZO3H 2ZIQH 3ITIA 1Y3YA 8LPRA 3PMAB 1V2OT 1GHYH 2UWPA 2CMYA 2BVXH 3DFLA 3RXPA 2QF5A 1W14U 1SGTA 1ZMJA 2V35A 1NU7B 5LGOA 4BAMB 1C5PA 4JK5A 5EJ1A 3H5CB 1IQEA 4I86A 1GWAA 1NBME 1QA7A 4FU9A 2SGDE 3SUGA 1GGDC 1ELVA 7GCHF 4YT7H 2ZZUH 2C8XB 3SNBA 3A8BA 1BZXE 2EQNA 1O36A 5E0JA 3F9FA 1G3DA 4Z0KA 1SGFA 1XUGA 3SO3A 1VCPA 4MG3A 4B6FA 5LPEA 4GHTA 4X6PA 2LNCA 4DURA 4FU7A 2ODYB 4D8NA 1O38A 1V2NT 4DG4A 2TBSA 1KXDA 4AB9A 3ZV8A 3MHWU 1W3CA 2XCNA 3MNSA 3E90B 1E79D 1BRBE 2WSSD 1O5BB 5LPRA 4MQAA 3MH6A 1LTOA 4VGCC 5B6OA 2ZFPH 2ZGCA 3PWBA 1O30A 3RDZA 3UAIC 4CRFA 1UTOA 2FOBA 3M5NA 3PB1E 5C0UA 1P3EA 4U30A 1UK4A 1SFIA 1DXWA 1Z8IB 2BDAA 5I46H 1YGCH 4HG6A 4ZROA 1ESTA 2BXTH 4GLYA 1XMNB 3SGQE 4B6EA 1OYQA 3RXRA 2A0QB 2W7SA 1SI5H 2YNAA 2UUFB 2ZHWH 5E8EH 2UUKB 2KCPA 3ZZAA 1P0SH 4X1RU 2RCEA 2VU8E 3SQEE 2P59A 1GI5A 5A8YA 1JIMA 1LQDB 1Y3VA 2WV4A 1YP9A 1NRSH 7KMEH 5HYOA 3LT3A 5B6LA 3SV9A 4GSOA 1YC0A 2V0BA 3VEQB 1YBWA 2HPQH 1GJ7B 3RXDA 4P02A 1HYLA 3QZQA 3MO9A 1SR5C 3F0PA 1V2QT 3U9AH 4BXSA 3OFND 1ETRH 3BTGE 4YOGA 4CH8B 2H5CA 1H9HE 1HAVA 1G3CA 1SGCA 2ANMH 2NU3E 1HXEH 1W8BH 1G36A 1PQ8A 3M7TA 4KTSA 2JP0A 1GI9B 3VFEA 1FJSA 5EQSA 1C2HA 2XCFA 1RRKA 5AHGH 4TY7A 3ZZ9A 2WHXA 1QBVH 2CHAB 3LGUA 5CHBA 2JA4A 4ISIH 1O5GH 2ZDVH 4M7GA 1V2PT 1Y59T 1AFEH 2FM2A 1C9PA 1E37B 1GI1A 1OPHB 3RXCA 5GWZA 1GL1A 2O8TA 1THSH 2WPIS 2OC7A 2VBCA 3M3VA 1CHOG 1ZSLA 1O33A 1VCQA 5J4QA 2A2XH 1BTUA 1TA2A 3FP6E 1V2ST 1UK3A 5A09A 2F4LA 1GVLA 1D3DB 2VH0A 5CE1A 3EE7A 2GZ7A 1C5SA 1U6QA 4O3TA 1C1VH 2KCOA 1DPOA 3A7YA 2BDHA 3RUOA 1T8MA 1N1LA 2J5UA 2F9OA 2ZHDA 4B76A 1EFRD 1HV7A 5C0TA 1ZRBA 3ZV9A 1VZQH 1AWHB 4B2BA 1NPMA 1V2TT 2PUQH 3S0NA 1Z6EA 2F9PA 3DT0H 4B73A 3T28A 1MBQA 1GMCF 5ESTE 4KELA 3PTBA 3UR6A 3V7TA 3ZYDA 1GGDB 5GCHG 1UCYE 1WQVH 4WVPE 1HB0B 1JRTA 3OTPA 1LHEH 4D9QA 4NG9H 3A81A 3TH3H 1BBRK 2G4TA 3OEHD 3E91A 1YLCA 1UHBA 3N7EA 4A5TS 1BIOA 1F0SA 1H8IH 1A7SA 4XE4A 4O97A 1P2KA 3KN2A 4CBOA 5DP9A 3UB0A 2BMGB 1O2LA 2ZA5A 1Q2WA 2ZC9H 1UTKA 1MKXH 1IQIA 2Q6FA 3E6PH 4ZCNA 1QA0A 3CS0A 4AOQA 3OYPA 3V3MA 1ZHMA 3KYGA 2FEQH 3E8LA 3ESTA 1FY3A 2BD9A 1HPGA 2OP9A 3E1XB 5FX5A 3URCA 2A7HA 3RXUA 1WDIA 3PRBA 2JDID 1HAXB 1P01A 1XUHA 3F6UH 1V2KT 3PO1B 2A2QH 3PMHB 1SGYE 4ZXXH 2A7JA 1TPPA 1V2WT 1QL9A 2BDYA 3BIVH 3SGAE 5HM9A 5PTPA 3M3TA 4UFDH 3LGVA 1C2LA 3RMMH 4XFQA 2OQUA 3A85A 4Y7BA 4BXWA 1QHRB 2SGFE 1BTWA 1E36B 5J4SA 1RTLA 1IQJA 2GV6A 1OWIA 1G3BA 3M36A 1O0DH 3GCTG 3SNAA 2AMDA 4MNVA 1QY6A 2GCTB 2VIPA 1GMHG 4O3UA 2KR7A 2AYWA 4WWYA 1ZRKA 2PKSC 1P11E 1S83A 2ZFSA 1T32A 4MPVA 4AC9A 4X8SH 3RXIA 1LHGH 1C2EA 5T6DA 1O3JA 2PV9B 3SU0A 3UWIA 1GJ5H 1MTSA 1K21H 2O9QA 3DHKH 4Q80A 2FIRH 4YO9A 1NU9A 1NT1A 1GI2A 1SC8U 3GISB 3JZ1B 2GGVB 2THFB 1ARCA 1GCTB 3URDA 4RSPA 1UVPA 2L6OA 3T27A 3F9GA 1TNIA 1C4Y2 1O5EH 4AGKA 1EASA 5HXFA 1C1MA 1ELFA 3IG6B 3OSYA 2OK5A 1EUFA 4D9RA 2FTMA 1LPKB 4ACAA 1IQFA 4ISLA 3TJVA 2FX4A 4JCNA 2J4IA 1C2KA 3RXJA 4UDWH 1OYTH 3RXVA 4RI0A 1ORFA 2TPIZ 2ANKH 1XXFA 1LKAA 3BG4C 4JYVH 2R0KA 1INCA 2LPRA 2FYQA 3MU5A 3U1IB 1QRWA 4UD9H 1FLEE 2R3YA 3M37A 2G81E 3PO1C 3A84A 2NU1E 2AIPA 1W0YH 1AVGH 1OWHA 1MCVA 2A31A 1D9IA 1O2GH 1GDQA 1S0QA 1FN6A 3PLKA 3UNRA 1ZPCA 3IITA 5IYTA 1W13U 2CJIA 2G8TA 3VB3A 1LKBA 1GBFA 3B8JA 2VIWA 2YMSB 1IQLA 4FU8A 4FUJA 4ABHA 3O8CA 5IDKA 4ZHAA 3TLOA 1UO6A 1P2QA 1K28D 1TX8A 1NFXA 2BM2A 2SGQE 3CS7A 2Z9GA 1ZGVA 2GX4A 3GYMA 1CA8B 2ZP0H 5HM2A 3S69A 1YCPK 4ZXYH 4I8GA 4AFQA 4BAHB 2KX4A 1HFDA 2OBQA 1BTXA 2A5IA 3NXPA 1JMOH 1UTJA 1UMAH 3QTOH 4BTTB 2BZAA 2TGPZ 1LHFH 3MNBA 4J2YB 3W1EA 2VIVA 2Y80A 4Q2KA 3VGCC 1T4UH 2QGRA 1NY22 2PW8H 4DY7B 2Q6DA 1G2MA 1C5ZB 1ABJH 2ZECA 3MU8A 4IGDA 4CRCA 3T25A 1RS0A 3LU9B 1XXDA 2D1JA 3QZRA 3OY5U 1DWCH 5TCCA 4MPXA 2J38A 5A2MH 1ZLRA 2HRVA 1AUJA 1DM4B 3TH2H 2WYJA 2PWXA 2OQ5A 2QIQA 3GICB 4XBDA 1FI8A 1TMUH 1FY4A 5TJXA 1TIOA 4BAQB 2R9PA 3ZZBA 1S6FA 1PPFE 3KQCA 3RXTA 5DGJA 4ZKNU 4NWLA 1BRAA 1BHXB 2GZ9A 4ABBA 2HGTH 3MNXA 1FY1A 2HNTE 2A5KA 2WPMS 1AVXA 3Q00A 3CNRA 4CH2B 5JBAS 3KCGH 3TPIZ 1TA6A 5DO4H 1CSOE 1GBIA 3G01A 5FXLA 1CT2E 4MNXA 1EP6A 5FBEA 2R3UA 1A0LA 1GJAB 1SBWA 2Y6TA 4AFUA 1OHHD 1BMLA 3UR9A 1J17T 1DICA 5HMAA 1ZTKA 1RJXB 1MTUA 4CR9A 3E0PB 1AMHA 2EA3A 9ESTA 1O35A 4AYVB 1M9UA 1SLUB 1CT0E 1ESBA 2ZGBH 2XBXA 4Y7AA 1EAUA 2VIQA 4IBLH 1C1OA 3ZIAD 2KZ4A 1PPEE 1EX3A 2K1QA 5DP6A 2FS9A 1C2JA 3FN8A 3QLPH 1BQYA 3GDUA 3UQVA 3FKSD 3E16B 4Y10E 1S85A 3HKJB 1O37A 3UIRA 1KLIH 3NPSA 7LPRA 2QXJA 1A61H 4BTUB 2QXIA 3KYFA 3RM0H 1WBGB 4I31A 1DVAH 6GCHG 1GBMA 2W6JD 1ZMNA 1EOJA 1ELCA 1P2NA 4DIHH 2GZ8A 5FPTA 1E1RD 4XBBA 2R0LA 3BTHE 4BOHA 1ANEA 1O3EA 5GPIB 2J95A 2HNTC 4WY3A 1HNEE 2BQ7B 5AF9H 5DP5A 2BY9X 2GD4B 4Z6AH 3SJOA 1MTNB 1UTMA 1MAYA 2OYAA 1L1JA 7GCHG 1HJAB 1TGTA 1FAXA 3H7OA 4DCDA 3TU7H 3FFGA 1C5XB 2O8MA 3GCHC 1GDNA 4XSKU 4JZDH 4GVUA 3ZZ3A 1F2SE 1S0RA 4FUBA 1XUIA 1HAVB 1W7XH 1HAIH 3F2FA 5EG4A 1ZTLA 4TY6A 1UW7A 2WINI 4K1EA 1YPGH 2Z3CA 3CP7A 1ANCA 4MPUA 1P03A 4NZLA 1IQHA 3RU4E 4ABJA 8ESTE 2V3MA 3QDZB 5EJZA 3MWIU 4LK4A 1UTLM 1NRRH 3EE0B 1O3LA 1RTFB 3E0NB 1C5QA 5K7RA 1SL3A 1DSUA 3QO6A 2Z9JA 2ZDKA 3M5OA 2ZQ2A 3SNDA 2XBWA 4BTIB 3UFAA 4GUXA 4H42U 1CA0C 1V2JT 4Q7ZA 1BDAA 2VIOA 3SJIA 4Y79A 2FESH 4YOJA 2FS8A 2GJGA 4YOIA 1THRH 3T26A 1XUJA 3LDXH 1H9LB 3LH3A 1CBWB 1DXPA 1Y3UA 1P57B 2Z7FE 1B0FA 1FMGA 5EGMA 1IHSH 4A6LA 1GI6A 1YM0A 1Z7KA 1QL7A 1YWUA 1B0EA 3ATLA 2GVFA 4F55A 2VWLA 1ZHRA 2ILNA 2WV9A 4D7GA 1QL8A 3GY2A 5HKKD 5C20A 1YKTA 5EXMA 3RXEA 3SQHE 2B5TB 4DW2U 4I7YH 3K9XB 1CE5A 4K8YA 2VWNA 5A0CA 1SGNE 1UCYH 4B2CA 1H1BA 1HAGE 2VVUA 4OGYA 1EP5A 3BF6H 1KMHB 1Z1IA 2ZG0H 4KTCA 1AHTH 4CR5A 1O2UA 2IOTA 1ANDA 3A82A 1GMCG 2RA0A 2A4QA 3ATWA 3GCNA 2Y5FA 4OS7A 2ZPRA 5EJLA 1N6YA 2BLOA 1UJ1A 3DA9B 1C2FA 3T62A 2KFWA 1J15A 3BTDE 4A1XA 1O2TA 4FUGA 4X2XA 1H8HD 1W10U 4RT0A 4TT3D 2HALA 3HPTB 1MKWK 1UVUH 2A7CA 5EQRA 2WPDD 4DT4A 3MQKC 4A1VA 2SGEE 1ZSJA 1LHCH 2AS9A 2HLDD 1O31A 1NN6A 1H8ED 1O3NA 4HTCH 1NRNH 2J94A 4CRGA 3RP2A 2PGQB 2F9NA 3SU6A 1SVPA 3LGWA 1ABIH 1TNGA 3UREA 1ACBE 1A5GH 1C4U2 2V3HH 5F53A 3SU4A 1QR3E 1BT7A 1GL0E 1GJCB 1T8NA 4X8VH 2YNBA 2VVVA 1QNJA 2FI3E 3WW7A 1BMAA 1RIWC 1WV7H 1GI0A 3M61U 4X6OA 2C8YB 1DLEA 2Q1JA 2ZI2H 3GY6A 1Z71A 1GDUA 2H2ZA 3U28C 4MLFB 1GJ4H 2FXRA 2XRCA 1P57A 1PPHE 1JBUH 1S84A 1GHAG 1A4WH 1J9CH 1QB6A 2CHAC 5CMXH 2ZTXA 1SGDE 1QBOA 3GY7A 1NFWA 4MNWA 5ABWA 1GHXH 2ZCKP 4UEHH 2V6NA 2W5EA 4IW4E 1AKSA 2FDAA 3TGIE 1YCPH 3ZZ5A 2VWMA 1K22H 2HLCA 1YLDA 1S6HA 1EB2A 5IK2D 3A8AA 3P6ZB 1AVWA 1AE8H 2RG3A 3GS9A 2O8LA 1ARBA 1DWEH 5C1YA 2CXVA 1O3PB 1VJAU 2AH4X 3EDXB 1Y3WA 2JH5D 2B7DH 1LVYA 3RLWH 2NU2E 5DJ7A 1O3CA 4TWYA 2XYAA 3ZVBA 5GCHF 3K6YA 5FX6A 4DGJA 1FDPA 1F5KU 2G52A 3MI4A 3KEEA 4B75A 1E0FD 1AI8H 3RMLH 2BLQA 3QWCH 3FOAA 4NCYA 5F03A 3RXFA 2JKHA 4F48B 1KDQB 4A92A 2JOPA 4NIXA 3RXAA 3RXQA 2ODPA 2Y7XA 4YLQH 1ZGIA 4XRNA 1EQ9A 3D23A 1C2IA 1T7CA 1XM1A 3NRLA 1NRPH 2F91A 2BD8A 3NCLA 3Q3YA 2IJD1 1GHWH 1BY2A 3DSGA 1G30B 3EA9A 1C2MA 1GMDF 2JH6D 4KP0A 1TRYA 5BPEA 1KXFA 1TX7A 5A8XA 2C3SA 1QJ1B 2ZFQH 1GVZA 1HAPH 1KYNA 4ISOA 3P17H 3F68H 1W11U 4THNH 2XBYA 4Y8ZA 2BD7A 1O2QA 1KXEA 1O5FH 3RMNH 3TJNA 2J97A 4Y71A 3P95A 2ZHQH 2FOCA 1Z6JH 2F3CE 4K69A 1FIWA 4B1TA 2VB0A 1BJVA 1BMNH 2WPHS 1GI4A 3MU1A 3ZVEA 1DWBH 1JWTA 1HGTH 2ZHEH 1ZMLA 3GY5A 1O39A 1GBHA 4NWKA 2NU4E 2IPQX 2CN0H 3RXHA 4F49A 4Q63A 5F8XA 1W7GH 4UFFH 2HOBA 3PWCA 5CHAC 3SU3A 3KQEA 2AGGX 1GBTA 4NIWA 5F8ZA 2GT8A 5E2OA 2QN5T 3OTJE 1PYTD 1BRCE 3BTWE 1SOZA 3Q77A 1O3IA 3RXGA 2XOKD 4DT7B 4Q7YA 2ALVA 3DD2H 1GCTC 2XC0A 5C94A 1WAYB 5C1UA 1NBMD 5LH8A 3U98H 1MKWH 2BY6X 5DP8A 4FUEA 3AK5A 5HIYA 2QF3A 1ZJKA 1PJPA 1FX0B 3UUZA 3AW0A 2GDDA 2ZGXH 4GHQA 2H1UA 3F2HA 1P12E 2IPHA 1C1NA 1CO7E 1P2IA 1W0JD 1C4V2 1YPJH 1V6DA 1C5WB 3V0XA 3ZVFA 1SQRA 4MDSA 4FXGH 2GCHG 1LO6A 5EXLA 1SHYA 1O5FL 1D3TB 3SHAH 3PROA 4AYYB 1FPCH 1YLNA 1MZAA 3SBKA 2EI6A 1PQAA 1ELGA 2O8WA 3ATMA 3P8GA 3A83A 3TK9A 1VGCB 2A4GA 2TGTA 2RDEA 1P2OA 1DANH 1SQOA 2ZDLA 2H9TH 3P8OA 4ABDA 1YPEH 4K2YA 2HNTF 4WMDA 3RU4T 3FZZA 1TPAE 1KXAA 5ETXA 4JZIA 1GBBA 1DY8A 2GP9B 2ASUB 3ZVGA 1J16A 5I25A 3M7QA 3PV5A 1HJAC 2SGPE 2NWNA 4NIYA 4K1TA 4AN7A 2OLGA 2FOMB 4ZMAH 2BDIA 1TRNA 3GCHB 2Z3DA 4I32A 1TMTH 3RM2H 2B8OH 4CHAC 5EQQA 2G00A 1L1NA 1KLTA 4OS1A 3TGKE 1TONA 2ZGJA 3SYJA 4A7IB 3BTQE 2ZCLP 2ANYA 2QA9E 1UTNA 4ZHLU 1HUTH 3FANA 5HIZA 2WPJS 1BRUP 4IS5A 1WU1A 1YYY1 2A45B 2A4RA 3SNCA 1NFYA 3MOCA 3TNSA 1TQ7B 1BCUH 3SUFA 5JYIA 2JIZD 1GI8B 1TYNA 1MAXA 3ZVDA 4IC5A 1BTYA 5DK1A 1CQQA 8GCHF 3FP8E 5JDUB 5A0AE 4ABAA 4Y8XA 1TGNA 1QJ7B 2K0QA 2FLBH 5DG6A 4RT1A 3BIUH 3VG8A 2BTCE 3A80A 2XC4A 4JMYA 1N8OB 2PP6A 3PTNA 2XWBI 3BEIB 1THPB 3N7DA 1P3CA 1Z8GA 2BD5A 1ZHPA 1AN1E 4OS4A 2OTVA 2Y82A 4IMZA 3BTFE 3RXLA 1BJUA 3SGBE 2ZDAH 4MNYA 2OC1A 2STAE 2D8WA 1AIXH 1HIAA 4U2WA 1G37A 3M5MA 5HGGA 1QJ6B 1L4DA 3A7WA 4YT6H 2FP7B 1L1GA 2OBOA 1JIRA 3F0OA 4AG2A 1E35B 1SGPE 4I8JA 4ZKRU 3M3SA 5L6NH 2EI8A 1UVOA 5GXPA 1IQNA 2ZTYA 1AB9B 2QC2A 4R0IA 4H6TA 1SFQB 2W26A 4MPWA 1PPGE 1BOQA 1HRTH 1SGFG 1SLWB 2TIOA 3BN9A 2J9NA 4XDEA 1GJ6A 4E06H 1T31A 2VIDA 2H9EH 2STBE 2VJ1A 1TPOA 2EY4C 1KTSB 2BQWB 1VITG 1EJMA 1OP2A 1GBJA 2AIQA 2BDGA 4QT8C 2BDBA 1DX5M 3B23B 3HGNA 4TPYA 4Z1MD 1A5IA 1A3BH 2FOFA 4PROA 2PKAA 3TJUA 4Y8YA 2QE7D 2HVXA 1XVMA 2I6QA 3V12A 1QFKH 3SV7A 1G2LA 1AWFH 1GJ9B 3W94A 3R3GB 3A7VA 2EC9H 1O3KA 3QGNB 1K1MA 1SSXA 1AD8H 2SFAA 1N8OC 1QBNA 3ATIA 3GCOA 4BNRA 1WXRA 2CGAA 1C5UA 1CU1A 2P95A 3SZNA 3WWBA 2WZQA 4XOJA 2Z6BD 3VB4A 3EAJA 4ASUD 2BOHB 3KHVA 1TOCB 3F2GA 1FZZA 3A86A 5A8ZA 3LH1A 4OGXA 2J98B 3VB6A 4ZHMU 1TPSA 2A1DB 2GT7A 2ZCHP 4VGCB 3U69H 2LELA 1FQ3A 3K6ZA 2ZPQA 3TIUA 3STJA 1MTVA 3MH4A 2AGEX 2WUBA 2VNTA 4FOUC 2W6ID 4X2YA 1P02A 1F0TA 2AGIX 2BB4A 2I6SA 1TBZH 2A4OA 3KF2A 3A87A 1ETSH 3MMGA 2OUAA 3F9EA 4AFZA 5JPMH 1O34A 4ACBA 2H5DA 3SZEA 2GMTB 1OSSA 1KIGH 1OS8A 1C2DA 2EEKA 3LC5A 1SQAA 4OS5A 2QV1A 1AGJA 1OWKA 2BDCA 4TYDA 1DUEA 2YMSC 2Z9LA 1AFQB 1OWJA 1AY6H 4K1SA 2ZKSA 2BD2A 1ZTJA 4WMFA 3RLYH 1TBRH 4J1YA 3QUMP 2LP6A 2TGDA 1FONA 1ELDE 3M35A 1V2MT 1SGRE 4RN6A 2P8OC 1VITF 2QF0A 4B74A 2SNWA 4WH8A 3Q3KA 3RXKA 2GKVE 2H6MA 3WY8A 4ZH8A 1D6RA 1MD7A 2FOHA 3NK8A 1O2JA 1SGIB 1JRSA 3BEUA 2WPKS 4K3JA 1XX9A 2HVYB 3FZDA 4OS2A 1V3XA 3S9BA 1EZSC 1PPBH 4SGAE 1TFXA 3P70B 1EZQA 1Y3XA 1TGBA 1MU6B 4OS6A 2Q6GA 2OCVB 2AMQA 5EW1H 2XTTB 1HAYB 2QAAA 3P8FA 1O3MA 1EAXA 2VGCB 1CGIE 5C17A 4GPGA 1LMWB 3SV8A 1BUIA 2JJ1D 2D2DA 2BOKA 3VXEH 4BAKB 2F9UA 2XC5A 2CF9H 4X6NA 3Q3XA 5DSFA 3IWMA 1UVSH 1QZ8A 4AZ2B 1EZUC 1GBEA 2OC0A 3BTTE 1PPCE 4MTBA 3UOPA 4NIVA 4ZAEA 5T6FA 5C67A 1BTZA 1NFUA 5FAHA 5G4BA 3SI4H 1FUJA 1EJAA 2GMTC 4BAOB 4BANB 3KQDA 1EXFA 3B9FH 1O2MA 1HJ8A 2HWLB 1CHOF 5EPNA 2FO9A 1HLTH 3UQOA 4CBNA 1OP8A 4Y11E 1FIZA 1GPZA 1LQEA 4GCHG 5KGOA 2EI7A 1W0KD 1C5VA 2ZDMA 5T1VA 2C8ZB 3OU0A 1CA0B 3AVZA 2P8OB 1QQUA 2C90B 5CHAB 1YPHE 4E7RG 1HXFH 1QIXB 3STIA 2PFEA 1TGSZ 4UFEH 2UWOA 1B5GH 2FTLE 1XKBC 4WH6A 4ABEA 1D3PB 2H9HA 5E0HA 5DKMA 5EXNA 4INLA 1TB6H 1LHDH 3GY3A 1ZPBA 1A0JA 1LVMA 4X2VA 5ESBA 5FBIA 1J8AA 3TK6A 2FZZA 3U1JB 4X8UH 1Y5BT 2AEIH 1ELBA 3UTUH 1SMFE 1WTGH 4KGAA 1KY9A 5L2ZH 2UWLA 3ZZDA 2M5TA 2F43B 5AFYH 1K9OE 1F5RA 3A7ZA 2XNDD 1O2XA 4JYTA 1SGQE 4YZUA 4LZ4B 2PGBB 3RU4D 1O3BA 5GJ4B 1LDTT 1S81A 2YOLA 5AVDA 1C1UH 1O2OA 1K1OA 1TQ0B 1GBAA 1S6LA 3U8RH 3W95A 2P3UB 4UFGH 2XXLA 3L6PA 3QGJA 1O5AB 1O2IA 1MQ5A 1MQ6A 4IN2A 1O3DA 2BHGA 2IJOB 3MO6A 2ZF0H 1HCGA 1MKXK 1GBDA 3KL6A 1DDJA 5KEDA 3D65E 4RKJB 2VH6A 3GCTF 4RKOB 1RGQA 3ATKA 1QQ4A 3V13A 2ZNKH 1EB1H 4X0WU 2KM0A 2A5AA 2Z9KA 1P8VC 4NA7A 1TX6A 2ANWA 5BRRE 5L30H 3SUDA 3KQBA 1A2CH 4FUHA 1A1RA 1WQSA 4NFFA 4I33A 1GI7B 3NZIA 1AUTC 3F3BA 4DJZB 2J34A 2DE8A 1NM6A 1IHTH 2WUCA 6ESTA 4JZFH 3LJOA 1H4WA 3I78A 4M9FA 1P2MA 2BYAX 1LVOA 2G51A 1E1QD 4LXBH 4CRDA 1UHBB 1KXBA 1O2ZA 5LPFA 1ID5H 1RIWB 9LPRA 2C8WB 4DIIH 1EZXC 1O2SA 2J92A 1C9TA 2Y81A 3ENSB 1GG6C 3EGKH 4Y76A 3S9AA 3MFJA 4O9VA 1OP0A 1K1NA 1O3AA 1Q3XA 1TE0A 4KTUA 3MU0A 4I8HA 2BY8X 3KGPA 3P8NA 3BG4B 2G55A 2ZU2A 4WMEA 3ODFA 2TGAA 3F1SB 4H4FA 1CBWC 1IOEA 1NTPA 5JBTA 1DS2E 3SU2A 2B9LA 3O8DA 1C5TA 4IMQA 1P09A 3AW1A 1AZ8A 4F4OC 4K5ZA 3TK5A 1GBKA 2P94A 2FMJA 2ZFFH 1EKBB 1FAKH 1C1RA 3SW2B 2ZU3A 3SHCH 1ELAA 1GHZA 2ZPSA 1F5LA 1GBCA 1AZZA 1C5MD 4ZKSU 2A32A 6GCHF 1BB0B 1Z8RA 1PQ7A 1BA8B 1SPJA 3TVJB 3ZVCA 5DN6D 1IAUA 1DLKB 5TCAA 1O2RA 3BSQA 1A46H 5C5OA 4E7NA 1PQ5A 5JB8S 4LOYH 1TNLA 2JJ2D 1A0HB 4FUDA 2ZU1A 1ZJDA 3PRDA 3GDSA 4YESB 4ASHA 1XUFA 3QN7A 2XNIA 1AB9C 1TABE 1TNHA 3TITA 1QB1A 2Y5GA 1IQMA 1UCYK 4D76A 4ESTE 1T4VH 3GDVA 1O2VA 1G3EA 1ZZZA 1SB1H 2QCYA 2NU0E 3VPKA 1RTKA 1O5EL 3SJ8A 3VGCB 3MNCA 1FY5A 1SOTA 1BTHH 1D6WA 3MU4A 4ZKOU 1KXCA 4I8LA 3TGJE 4AX9H 1BTPA 5GNDA 5C2ZA 2ZDNA 1Z8JB 1GHBG 5FL7D 5EU8A 2RA3A 3SV2H 1NZQH 2YMSD 3A88A 5KECA 2WPLS 1HJ9A 3DCLA 5EOKA 2W3IA 1Z1JA 2BX4A 1MH0A 1BBRH 2BLWA 3F9HA 3SJKA 2V3OH 5FCKA 4XD7D 3K65B 4NFEA 3UWJH 1V2RT 2QF4A 1CGJE 2R2WU 3PMBB 4KKDA 2FI5E 2O8UA 1ZYOA 2TRMA 1F7ZA 1K1LA 3OY6U 3T29A 1GJ8B 1H8DH 3HATH 4FVBA 3OE7D 1C1WH 4X2WA 1FPHH 5L2YH 3SJ9A 1TGCA 3T2NA 2VGCC 3A8DA 3SOSA 3DSOA 1G9IE 1DT2A 1A3EH 1LCYA 3GY8A 3RXMA 1V2UT 1T8OA 5JFBA 3N7OA 2W3KA 4ISNA 5FCRA 2FOAA 1V2VT 4H6SB 2R2MB 4WJG2 2ZQ1A 3TJOA 4ZUHA 1GBLA 4X1SU 5K0HA 1SHHB 2K8IA 1Q31A 3VB5A 1YPKH 2PTNA 2FOEA 3PYHA 1BMMH 3E3TA 1TRMA 1TWXB 6CHAB 1K0HA 2P93A 2BZ6H 4AB8A 5JBCS 1BBRE 5FHTA 1WCZA 3GY4A 5EIYA 1MABB 1DSTA 1ZSKA 1HAHH 3QK1A 1P04A 3M7UA 1MZDA 1T8LA 4TSFD 3LOXA 1EJNA 3TNTA 3U8OH 4HI3A 2M2AA 1DUAA 1XKAC 5EPYA 2PSXA 1ANBA 1P05A 1SGEE 1BITA 3I77A 1DITH 3RC4A 2BD4A 2OINA 3BTKE 3ZZ4A 2ZGHA 4FUCA 4X1QU 5FPSA 1GMDG 4X1PU 1EOLA 1DFPA 1JOUB 6LPRA 2DE9A 3SNEA 4YM9A 1O2NA 3T5FH 4AG1A 4O03A 2RDLA 4WXIA 3S9CA 3BEFB 1E34B 1YPLH 3BTME 2KCYA 2QYIA 3LPRA 3A7XA 1AU8A 5SGAE 2ULLA 4INKA 1S5SA 3NWUA 1MUEB 1NC6A 1P06A 4NGAH 2P3TB 2VVCA 3MH7A 2SGAA 1H9IE 3ZZ6A 1QCPA 1VJ9U 1F0UA 1LPGB 1OKXA 3GOVB 3Q76A 8GCHG 2FPZA 3PM3A 3D49H 1AQ7A 4LZ1H 1PPZA 5F8TA 2C4FH
chains in the Genus database with same CATH topology
2XW9A 3SUEA 1C1PA 4U32A 1MTNC 1C2GA 1C5OH 4CRAA 5T6GA 3UNSA 2CV3A 1HAZB 4ABGA 5EODA 5C1XA 3O8RA 2P16A 2PTCE 2QXGA 2PHBA 1S82A 1UTQA 2PSYA 3L3TA 2ALPA 8KME2 1MTWA 3FVFB 1O2YA 3S7HB 2P3FH 4FUFA 3ODDA 1D4PB 2FWWA 1O3HA 1K1JA 1QRXA 4IC6A 1C5NH 1ZOMA 1SLVB 2ZU4A 1K1IA 1P9UA 1QB9A 3CENA 4Y0YE 3PV4A 4JK6A 1YF4A 2WYGA 2OD3B 3PLBA 2ZTZA 3FP7E 1O3OA 1YPHC 3A7TA 5JBBS 1KLJH 3C1KA 2Z9IA 1EATA 2UUJB 1O2WA 2PUXB 2J2UA 3AAUA 2G5VA 3LGTA 4X1NU 3LGIA 1HIAB 3M5LA 2AFQB 2FODA 3ZYEA 4UONA 5GIBA 1EPTA 3EQ0H 1O3FA 2SNVA 1V2LT 1SQTA 2PKSB 1OX1A 1CVWH 1K2I1 3JZ2B 2GCHF 2ZFTA 3LC3A 1ELEE 3ZZ7A 1FXYA 1HAOH 1UK2A 4YTAA 4JZEH 4AORA 3RC5A 2XWAA 1AO5A 1L2EA 1VITH 2FLRH 3SORA 1C5YB 1G32B 2ZHFH 4X6MA 1WYKA 3UPEA 1TOMH 2ZEBA 4FUIA 1GHVH 3LONA 1P9SA 1QURH 1DOJA 3A89A 4NA9H 2XBVA 2GV7A 1FY8E 5AFZH 1QRZA 4UE7H 4NSYA 1NROH 4ABIA 4A1TA 1O2HA 2BD3A 2W7UA 3HKIB 3LKWA 1ZR0A 2FI4E 2IN2A 1FN8A 2GDEH 3QX5H 1F0RA 4B71A 3MTYA 3SN8A 1AKSB 1TBQH 1J14A 5DP4A 4DOQA 3H7TA 5F6MA 5DP7A 1AE5A 3EA7A 3LIWA 1P2JA 1C1SA 3I29A 3MYWA 1KSNA 4I8KA 3MO3A 1XUKA 1L4ZA 1B7XB 2Z94A 3RXBA 1EPTC 4R8TB 1GHBF 3SU5A 3UNQA 1C5LH 1WTHD 1YPMH 4D7FA 1W12U 4HZHA 3ELAH 1TALA 1MU8B 5H4IB 2BLVA 3UY9A 1NO9H 3NKKA 1CGHA 3TH4H 4AGJA 1LVBA 1SG8B 2GTBA 3OX7U 4XBCA 1HDTH 1EAWA 1TAWA 5JB9S 4WXVA 4FVDA 1GHAF 1WOFA 3EA8A 2ESTE 1PYTC 1GJBB 3C27B 1YCPM 4E05H 1Y5AT 4INHA 1W0ZU 1GG6B 2D26C 1O32A 1RD3B 3KNXA 1D3QB 3BV9B 3ZVAA 1GI3A 1OWEA 3ZZ8A 3EYDA 4AFSA 2BY5X 1BHXF 3RMOH 1FV9A 1MBMA 1C1QA 2AERH 5E2PA 3SV6A 2OY3A 4WF8A 3DUXH 4NA8A 1NESE 3A8CA 3HK6B 4HFPB 4ABFA 3AASA 1A5HA 1WUNH 5T3HA 3SU1A 1O5DH 1OOKB 2Y7ZA 4YLUA 1N6XA 1CHGA 4SGBE 2FOGA 4X8TH 3UOUA 1ZPZA 3NUMA 1NS3A 1OXGA 2CF8H 1EAIA 1X7AC 3KIDU 2JETB 2BX3A 3RC6A 1VCWA 1MD8A 1MMJN 1VGCC 1LPZB 4CRBA 2BQ6B 1VR1H 1L0ZA 2QXHA 3P92A 1AFQC 4GAWA 1ESAA 3U8TH 3DFJA 3L33A 3VB7A 1PFXC 1Y8TA 1ETTH 1JXPA 4K60A 6CHAC 2G4UA 1CT4E 4MVNA 2G5NA 5C5NA 2BXUH 1UVTH 1W2KH 7ESTE 2ZU5A 4CHAB 3SI3H 4IN1A 1SLXB 5DP3A 4K8BA 2DUCA 1GJDB 4GCHF 5EW2H 2ZWLH 1GMHF 1QGFA 5GDSH 3ZZCA 4Q7XA 2PKAB 2AMPA 3PLPA 3QTVH 2KAIA 3K2UA 3MH5A 1F92A 2B0FA 1NRQH 1IQKA 4ISHH 3LGYA 3RXSA 1TMBH 1TNKA 1Y5UT 3HGPA 1O2PA 4U01A 4TWWA 1O3GA 1TNJA 3GYLB 5C3NA 3HK3B 3LJJA 2PR3A 2BVSH 5DPAA 1RXPA 5E0GA 1RFNA 1KTTB 2F9BH 1DE7H 1O2KA 2VINA 4HGCA 1DWDH 1C1TA 2BVRH 2HPPH 1IQGA 1O5CB 4JZ1A 4JYUH 3AAVA 1FNIA 2VWOA 2OC8A 4NZQA 1K1PA 2JETC 1UTPA 1XVOA 2Z3EA 2C93B 2OTTX 3R0FA 3PMJA 1GVKB 4B2AA 3D62A 2JH0D 1EPTB 2QY0B 2ZFRH 3VXFH 1E38B 3S7KB 1QTFA 2F83A 3BG8A 2BY7X 5A0BA 1DY9A 2GCTC 1C5RA 3RXOA 3BTEE 1OWDA 4CREA 2PLXA 1MCTA 2FX6A 2Y5HA 4DVAU 1KDQA 4Y0ZE 3O8BA 2UUYA 4NSVA 1GCDA 2FYRA 1ELTA 1P10A 2WV5A 2OXSA 2F9VA 2KAIB 2ODQA 1HBTH 5FPYA 3FAOA 1WSSH 4TPIZ 1TLDA 4Y6DA 2ZO3H 2ZIQH 3ITIA 1Y3YA 8LPRA 3PMAB 1V2OT 1GHYH 2UWPA 2CMYA 2BVXH 3DFLA 3RXPA 1W14U 1SGTA 1ZMJA 2V35A 1NU7B 5LGOA 4BAMB 1C5PA 4JK5A 3H5CB 1IQEA 1GWAA 1QA7A 4FU9A 2SGDE 3SUGA 1GGDC 1ELVA 7GCHF 4YT7H 2ZZUH 2C8XB 3SNBA 3A8BA 1BZXE 5E0JA 1O36A 4Z0KA 3F9FA 1G3DA 1SGFA 1XUGA 3SO3A 1VCPA 4MG3A 5LPEA 4GHTA 4X6PA 2LNCA 4DURA 4FU7A 2ODYB 4D8NA 1O38A 1V2NT 4DG4A 2TBSA 1KXDA 4AB9A 3ZV8A 3MHWU 1W3CA 2XCNA 3MNSA 3E90B 1BRBE 1O5BB 5LPRA 4MQAA 3MH6A 1LTOA 4VGCC 5B6OA 2ZFPH 2ZGCA 3PWBA 1O30A 3RDZA 4CRFA 1UTOA 2FOBA 3M5NA 3PB1E 1P3EA 4U30A 1UK4A 1SFIA 1DXWA 1Z8IB 2BDAA 5I46H 1YGCH 4ZROA 1ESTA 2BXTH 4GLYA 1XMNB 3SGQE 1OYQA 3RXRA 2A0QB 2W7SA 1SI5H 2YNAA 2UUFB 2ZHWH 5E8EH 2UUKB 3ZZAA 1P0SH 4X1RU 2RCEA 2VU8E 3SQEE 2P59A 1GI5A 5A8YA 1JIMA 1LQDB 1Y3VA 2WV4A 1YP9A 1NRSH 7KMEH 5HYOA 3LT3A 3SV9A 4GSOA 1YC0A 2V0BA 3VEQB 1YBWA 2HPQH 1GJ7B 3RXDA 1HYLA 3QZQA 3MO9A 1SR5C 1V2QT 3U9AH 4BXSA 1ETRH 3BTGE 4YOGA 4CH8B 2H5CA 1H9HE 1HAVA 1G3CA 1SGCA 2ANMH 2NU3E 1HXEH 1W8BH 1G36A 1PQ8A 3M7TA 4KTSA 2JP0A 1GI9B 3VFEA 1FJSA 5EQSA 1C2HA 2XCFA 1RRKA 5AHGH 4TY7A 3ZZ9A 2JA4A 1QBVH 2CHAB 3LGUA 4ISIH 1O5GH 2ZDVH 4M7GA 1V2PT 1Y59T 1AFEH 2FM2A 1C9PA 1E37B 1GI1A 1OPHB 3RXCA 5GWZA 1GL1A 2O8TA 1THSH 2WPIS 2OC7A 3M3VA 1CHOG 1ZSLA 1O33A 1VCQA 5J4QA 2A2XH 1BTUA 1TA2A 3FP6E 1V2ST 1UK3A 5A09A 1GVLA 1D3DB 2VH0A 5CE1A 2GZ7A 1C5SA 1U6QA 4O3TA 1C1VH 1DPOA 3A7YA 2BDHA 3RUOA 1T8MA 1N1LA 2F9OA 2ZHDA 4B76A 1HV7A 1ZRBA 3ZV9A 1VZQH 1AWHB 4B2BA 1NPMA 1V2TT 2PUQH 3S0NA 1Z6EA 2F9PA 3DT0H 4B73A 3T28A 1MBQA 1GMCF 5ESTE 4KELA 3PTBA 3UR6A 3V7TA 3ZYDA 1GGDB 5GCHG 1UCYE 1WQVH 4WVPE 1HB0B 1JRTA 1LHEH 4D9QA 4NG9H 3A81A 3TH3H 1BBRK 2G4TA 3E91A 1YLCA 1UHBA 4A5TS 1BIOA 1F0SA 1H8IH 1A7SA 4XE4A 4O97A 1P2KA 3KN2A 4CBOA 5DP9A 2BMGB 1O2LA 2ZA5A 1Q2WA 2ZC9H 1UTKA 1MKXH 1IQIA 2Q6FA 3E6PH 1QA0A 3CS0A 4AOQA 3OYPA 3V3MA 1ZHMA 2FEQH 3E8LA 3ESTA 1FY3A 2BD9A 1HPGA 2OP9A 3E1XB 5FX5A 3URCA 2A7HA 3RXUA 1HAXB 1P01A 1XUHA 3F6UH 1V2KT 3PO1B 2A2QH 3PMHB 1SGYE 4ZXXH 2A7JA 1TPPA 1V2WT 1QL9A 2BDYA 3BIVH 3SGAE 5HM9A 5PTPA 3M3TA 4UFDH 3LGVA 1C2LA 3RMMH 4XFQA 2OQUA 3A85A 4Y7BA 4BXWA 1QHRB 2SGFE 1BTWA 1E36B 5J4SA 1RTLA 1IQJA 2GV6A 1OWIA 1G3BA 3M36A 1O0DH 3GCTG 3SNAA 2AMDA 4MNVA 1QY6A 2GCTB 2VIPA 1GMHG 4O3UA 2AYWA 4WWYA 1ZRKA 2PKSC 1P11E 1S83A 2ZFSA 1T32A 4MPVA 4X8SH 3RXIA 1LHGH 1C2EA 5T6DA 1O3JA 2PV9B 3SU0A 3UWIA 1GJ5H 1MTSA 1K21H 2O9QA 3DHKH 4Q80A 2FIRH 4YO9A 1NU9A 1NT1A 1GI2A 1SC8U 3GISB 3JZ1B 2GGVB 2THFB 1ARCA 1GCTB 3URDA 4RSPA 1UVPA 3T27A 3F9GA 1TNIA 1C4Y2 1O5EH 4AGKA 1EASA 5HXFA 1C1MA 1ELFA 3IG6B 3OSYA 4D9RA 1EUFA 2FTMA 1LPKB 1IQFA 4ISLA 3TJVA 2FX4A 4JCNA 2J4IA 1C2KA 3RXJA 4UDWH 1OYTH 3RXVA 1ORFA 2TPIZ 2ANKH 1XXFA 1LKAA 3BG4C 4JYVH 2R0KA 1INCA 2LPRA 2FYQA 3MU5A 3U1IB 1QRWA 4UD9H 1FLEE 2R3YA 3M37A 2G81E 3PO1C 3A84A 2NU1E 2AIPA 1W0YH 1AVGH 1OWHA 1MCVA 2A31A 1D9IA 1O2GH 1GDQA 1S0QA 1FN6A 3PLKA 3UNRA 1ZPCA 3IITA 5IYTA 1W13U 2CJIA 2G8TA 3VB3A 1LKBA 1GBFA 3B8JA 2VIWA 4FU8A 1IQLA 4ABHA 4FUJA 3O8CA 5IDKA 4ZHAA 3TLOA 1UO6A 1P2QA 1K28D 1TX8A 1NFXA 2BM2A 2SGQE 3CS7A 2Z9GA 1ZGVA 2GX4A 3GYMA 1CA8B 2ZP0H 5HM2A 3S69A 1YCPK 4ZXYH 4I8GA 4AFQA 4BAHB 1HFDA 2OBQA 1BTXA 2A5IA 3NXPA 1JMOH 1UTJA 1UMAH 3QTOH 4BTTB 2BZAA 2TGPZ 1LHFH 3MNBA 4J2YB 2VIVA 2Y80A 4Q2KA 3VGCC 1T4UH 2QGRA 1NY22 2PW8H 4DY7B 2Q6DA 1G2MA 1C5ZB 1ABJH 2ZECA 3MU8A 4IGDA 4CRCA 3T25A 1RS0A 3LU9B 1XXDA 2D1JA 3QZRA 3OY5U 1DWCH 5TCCA 4MPXA 2J38A 5A2MH 1ZLRA 2HRVA 1AUJA 1DM4B 3TH2H 2WYJA 2PWXA 2OQ5A 2QIQA 3GICB 4XBDA 1FI8A 1TMUH 1FY4A 5TJXA 1TIOA 4BAQB 2R9PA 3ZZBA 1S6FA 1PPFE 3KQCA 3RXTA 5DGJA 4ZKNU 4NWLA 1BRAA 1BHXB 2GZ9A 4ABBA 2HGTH 3MNXA 1FY1A 2HNTE 2A5KA 2WPMS 1AVXA 3Q00A 4CH2B 5JBAS 3KCGH 3TPIZ 1TA6A 5DO4H 1CSOE 1GBIA 3G01A 5FXLA 1CT2E 4MNXA 1EP6A 5FBEA 2R3UA 1A0LA 1GJAB 1SBWA 2Y6TA 4AFUA 3UR9A 1BMLA 1J17T 1DICA 5HMAA 1ZTKA 1RJXB 1MTUA 4CR9A 3E0PB 1AMHA 2EA3A 9ESTA 1O35A 4AYVB 1M9UA 1SLUB 1CT0E 1ESBA 2ZGBH 2XBXA 4Y7AA 1EAUA 2VIQA 4IBLH 1C1OA 1PPEE 1EX3A 2K1QA 5DP6A 2FS9A 1C2JA 3QLPH 1BQYA 3GDUA 3UQVA 3E16B 4Y10E 1S85A 3HKJB 1O37A 3UIRA 1KLIH 3NPSA 7LPRA 2QXJA 1A61H 4BTUB 2QXIA 3RM0H 1WBGB 4I31A 1DVAH 6GCHG 1GBMA 1ZMNA 1EOJA 1ELCA 1P2NA 4DIHH 2GZ8A 5FPTA 4XBBA 2R0LA 3BTHE 4BOHA 1ANEA 1O3EA 5GPIB 2J95A 2HNTC 4WY3A 1HNEE 2BQ7B 5AF9H 5DP5A 2BY9X 2GD4B 4Z6AH 3SJOA 1MTNB 1UTMA 1MAYA 2OYAA 1L1JA 7GCHG 1HJAB 1TGTA 1FAXA 3H7OA 4DCDA 3TU7H 3FFGA 1C5XB 2O8MA 3GCHC 1GDNA 4XSKU 4JZDH 4GVUA 3ZZ3A 1F2SE 1S0RA 4FUBA 1XUIA 1HAVB 1W7XH 1HAIH 5EG4A 1ZTLA 4TY6A 2WINI 4K1EA 1YPGH 2Z3CA 3CP7A 1ANCA 4MPUA 1P03A 4NZLA 1IQHA 3RU4E 4ABJA 8ESTE 3QDZB 3MWIU 4LK4A 1UTLM 1NRRH 3EE0B 1O3LA 1RTFB 3E0NB 1C5QA 5K7RA 1SL3A 1DSUA 3QO6A 2Z9JA 2ZDKA 3M5OA 2ZQ2A 3SNDA 2XBWA 4BTIB 3UFAA 4GUXA 4H42U 1CA0C 1V2JT 4Q7ZA 1BDAA 2VIOA 3SJIA 4Y79A 2FESH 4YOJA 2FS8A 4YOIA 1THRH 3T26A 1XUJA 3LDXH 1H9LB 3LH3A 1CBWB 1DXPA 1Y3UA 1P57B 2Z7FE 1B0FA 1FMGA 5EGMA 1IHSH 4A6LA 1GI6A 1YM0A 1Z7KA 1QL7A 3ATLA 1B0EA 2GVFA