The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
5
|
sequence length |
68
|
structure length |
68
|
Chain Sequence |
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGEMPDDRCTGQSADCPRYH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Effect of D to E mutation of the RGD motif in rhodostomin on its activity, structure, and dynamics: Importance of the interactions between the D residue and integrin
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Calloselasma rhodostoma
|
| molecule keywords |
Rhodostoxin-disintegrin rhodostomin
|
| total genus |
5
|
| structure length |
68
|
| sequence length |
68
|
| ec nomenclature |
ec
3.4.24.-: |
| pdb deposition date | 2007-04-16 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Echistatin | Disintegrin domain |
#chains in the Genus database with same CATH superfamily 3UCI A; 1TEJ A; 2PJF A; 2ECH A; 1RMR A; 2PJG A; 4R5R A; 1Q7I A; 1TEJ B; 1RO3 A; 2MOP 1; 3C05 A; 1L3X A; 4M4C A; 2MP5 1; 3C05 B; 1FVL A; 1Q7J A; 4R5U A; 2W9O A; 2M7H A; 1N4Y A; 2W9V A; 2PJI A; 1Z1X A; 1J2L A; 2LJV A; 1MPZ A; 3G5C A; 4RQG A; 2M7F A; 2M75 A; 2W9W A; 2W9U A; #chains in the Genus database with same CATH topology 3UCI A; 1TEJ A; 2PJF A; 2ECH A; 1RMR A; 2PJG A; 4R5R A; 1Q7I A; 1TEJ B; 1RO3 A; 2MOP 1; 3C05 A; 1L3X A; 4M4C A; 2MP5 1; 3C05 B; 1FVL A; 1Q7J A; 4R5U A; 2W9O A; 2M7H A; 1N4Y A; 2W9V A; 2PJI A; 1Z1X A; 1J2L A; 2LJV A; 1MPZ A; 3G5C A; 4RQG A; 2M7F A; 2M75 A; 2W9W A; 2W9U A; #chains in the Genus database with same CATH homology 3UCI A; 1TEJ A; 2PJF A; 2ECH A; 1RMR A; 2PJG A; 4R5R A; 1Q7I A; 1TEJ B; 1RO3 A; 2MOP 1; 3C05 A; 1L3X A; 4M4C A; 2MP5 1; 3C05 B; 1FVL A; 1Q7J A; 4R5U A; 2W9O A; 2M7H A; 1N4Y A; 2W9V A; 2PJI A; 1Z1X A; 1J2L A; 2LJV A; 1MPZ A; 3G5C A; 4RQG A; 2M7F A; 2M75 A; 2W9W A; 2W9U A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
