The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
121
|
structure length |
110
|
Chain Sequence |
PCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural Basis for Oligosaccharide Recognition of Misfolded Glycoproteins by OS-9 in ER-Associated Degradation
pubmed doi rcsb |
| molecule keywords |
Protein OS-9
|
| molecule tags |
Sugar binding protein
|
| source organism |
Homo sapiens
|
| total genus |
28
|
| structure length |
110
|
| sequence length |
121
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-05-14 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07915 | PRKCSH | Glucosidase II beta subunit-like protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Cation-dependent Mannose-6-phosphate Receptor; Chain A | Mannose-6-phosphate receptor binding domain |
#chains in the Genus database with same CATH superfamily 1GP3 A; 2V5O A; 1Q25 A; 2RLB A; 3CY4 A; 2M6T A; 1C39 A; 2CNJ D; 2RL9 A; 1SYO A; 2LVX A; 2L21 A; 2KVA A; 3K41 A; 2KVB A; 1SZ0 A; 1E6F A; 1M6P A; 4XQM A; 3K42 A; 2N1H A; 1GQB A; 2LLA A; 2L2A A; 1KEO A; 2M68 A; 2RL7 A; 2V5N A; 1GP0 A; 2L29 A; 2L2G A; 3K43 A; 5IEI A; 3AIH A; 2RL8 A; #chains in the Genus database with same CATH topology 1GP3 A; 2V5O A; 1Q25 A; 2RLB A; 3CY4 A; 2M6T A; 1C39 A; 2CNJ D; 2RL9 A; 1SYO A; 2LVX A; 2L21 A; 2KVA A; 3K41 A; 2KVB A; 1SZ0 A; 1E6F A; 1M6P A; 4XQM A; 3K42 A; 2N1H A; 1GQB A; 2LLA A; 2L2A A; 1KEO A; 2M68 A; 2RL7 A; 2V5N A; 1GP0 A; 2L29 A; 2L2G A; 3K43 A; 5IEI A; 3AIH A; 2RL8 A; #chains in the Genus database with same CATH homology 1GP3 A; 2V5O A; 1Q25 A; 2RLB A; 3CY4 A; 2M6T A; 1C39 A; 2CNJ D; 2RL9 A; 1SYO A; 2LVX A; 2L21 A; 2KVA A; 3K41 A; 2KVB A; 1SZ0 A; 1E6F A; 1M6P A; 4XQM A; 3K42 A; 2N1H A; 1GQB A; 2LLA A; 2L2A A; 1KEO A; 2M68 A; 2RL7 A; 2V5N A; 1GP0 A; 2L29 A; 2L2G A; 3K43 A; 5IEI A; 3AIH A; 2RL8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...