The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
218
|
sequence length |
501
|
structure length |
500
|
Chain Sequence |
SMKPYKELERVFTKLYRYGHMLLLADWDSHTMMPKGSDARGAAMAELQLHMHDTITAPKIRALIEEAEKSVGDLEKLQRANLREMRRAWELENLLPEEFVERKTVLTTKAHQVWKTCREKNDFAGFLPTLKELIALFREEGKLRAGNSGKHPYEALVDIYEPGMTLQRLDEIFGNVRSWLPELLKEVQEKQKALGETVLEPKGPFPVSKQEALCRFFMDVWKFDFDGGRLDVSAHPFCGNSKEDVRITTKYTETEFVTSLLGVIHETGHAKYEQNCGPKGFETQPVCMARSLGVHEGQSLFAEMQIGRSGAFMEFLAPRLVEYFGDQPAFTSSNMKRVIQRVSPGLIRIDADELCYPLHVMLRYEIERDLMDGNIEAEEVPRVWNEKMKSYLGLETLGNDKEGCLQDVHWSGGMFGYFPTYSLGAMVAAQLMSCVRRELGEEVVDDCIRKGDLGKILAKQNEKIWQHGSSLTTDELLRQATGETLNPEHYRRHLERRYRD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The molecular analysis of Trypanosoma cruzi metallocarboxypeptidase 1 provides insight into fold and substrate specificity
pubmed doi rcsb |
| molecule keywords |
Metallocarboxypeptidase
|
| molecule tags |
Hydrolase
|
| source organism |
Trypanosoma cruzi
|
| total genus |
218
|
| structure length |
500
|
| sequence length |
501
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.4.17.19: Carboxypeptidase Taq. |
| pdb deposition date | 2008-07-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02074 | Peptidase_M32 | Carboxypeptidase Taq (M32) metallopeptidase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Neurolysin; domain 3 | Neurolysin; domain 3 |
#chains in the Genus database with same CATH superfamily 3AHO A; 2H1N A; 1K9X A; 3HOA A; 3SKS A; 3AHM A; 3HQ2 A; 1KA2 A; 2H1J A; 3DWC A; 3AHN A; 5E3X A; 1KA4 A; #chains in the Genus database with same CATH topology 2H1N A; 3HOA A; 3AHM A; 2O3E A; 4KA8 A; 1I1I P; 2H1J A; 3AHN A; 3CE2 A; 1KA2 A; 5E3X A; 1KA4 A; 4KA7 A; 2O36 A; 3HQ2 A; 5L43 A; 1Y79 1; 4FXY P; 3AHO A; 1K9X A; 2QR4 A; 3SKS A; 5L44 A; 4PUT A; 1S4B P; 3DWC A; #chains in the Genus database with same CATH homology 2H1N A; 3HOA A; 3AHM A; 4KA8 A; 2H1J A; 3AHN A; 3CE2 A; 1KA2 A; 5E3X A; 1KA4 A; 4KA7 A; 3HQ2 A; 5L43 A; 1Y79 1; 3AHO A; 1K9X A; 2QR4 A; 3SKS A; 5L44 A; 4PUT A; 3DWC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...