3IGCA

Smallpox virus topoisomerase-dna transition state
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
MRALFYKDGKLFTDNNFLNPVSDNNPAYEVLQHVKIPTHLTDVVVYGQTWEEALTRLIFVGSDSKGRRQYFYGKMHVQNRNAKRDRIFVRVYNVMKRINSFINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLTLKNKHIEISPDKIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYESIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKSSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights from the Structure of a Smallpox Virus Topoisomerase-DNA Transition State Mimic.
pubmed doi rcsb
source organism Variola virus
molecule tags Isomerase/dna
molecule keywords DNA topoisomerase 1
total genus 98
structure length 313
sequence length 313
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01028 Topoisom_I Eukaryotic DNA topoisomerase I, catalytic core
A PF09266 VirDNA-topo-I_N Viral DNA topoisomerase I, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.66.10 Alpha Beta 2-Layer Sandwich Viral Topoisomerase I DNA topoisomerase I domain 3igcA01
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 3igcA02
1RR8C 1EJ9A 1A36A 1A35A 3M4AA 1LPQA 1TL8A 2H7FX 2F4QA 1T8IA 1R49A 2H7GX 2B9SA 3IGCA 1K4SA 1K4TA 1A31A 1A41A 1RRJA 1SEUA 1SC7A 1VCCA 1NH3A
chains in the Genus database with same CATH superfamily
1RR8C 1EJ9A 1A36A 1A35A 3M4AA 1LPQA 1TL8A 2H7FX 2F4QA 1T8IA 1R49A 2H7GX 2B9SA 3IGCA 1K4SA 1K4TA 1A31A 1A41A 1RRJA 1SEUA 1SC7A 1VCCA 1NH3A
chains in the Genus database with same CATH topology
1RR8C 1EJ9A 1A36A 1A35A 3M4AA 1LPQA 1TL8A 2H7FX 2F4QA 1T8IA 1R49A 2H7GX 2B9SA 3IGCA 1K4SA 1K4TA 1A31A 1A41A 1RRJA 1SEUA 1SC7A 1VCCA 1NH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RR8 C;  1EJ9 A;  1A36 A;  1A35 A;  3M4A A;  1LPQ A;  1TL8 A;  2H7F X;  2F4Q A;  1T8I A;  1R49 A;  2H7G X;  2B9S A;  3IGC A;  1K4S A;  1K4T A;  1A31 A;  1A41 A;  1RRJ A;  1SEU A;  1SC7 A;  1VCC A;  1NH3 A; 
#chains in the Genus database with same CATH topology
 1RR8 C;  1EJ9 A;  1A36 A;  1A35 A;  3M4A A;  1LPQ A;  1TL8 A;  2H7F X;  2F4Q A;  1T8I A;  1R49 A;  2H7G X;  2B9S A;  3IGC A;  1K4S A;  1K4T A;  1A31 A;  1A41 A;  1RRJ A;  1SEU A;  1SC7 A;  1VCC A;  1NH3 A; 
#chains in the Genus database with same CATH homology
 1RR8 C;  1EJ9 A;  1A36 A;  1A35 A;  3M4A A;  1LPQ A;  1TL8 A;  2H7F X;  2F4Q A;  1T8I A;  1R49 A;  2H7G X;  2B9S A;  3IGC A;  1K4S A;  1K4T A;  1A31 A;  1A41 A;  1RRJ A;  1SEU A;  1SC7 A;  1VCC A;  1NH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...