The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
150
|
structure length |
127
|
Chain Sequence |
NADSAWLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEDAEKEVLVWRFDSKLAFHHMARELHPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Molecular design, functional characterization and structural basis of a protein inhibitor against the HIV-1 pathogenicity factor Nef.
pubmed doi rcsb |
molecule tags |
Protein binding
|
source organism |
Hiv-1 m:b_arv2/sf2
|
molecule keywords |
Protein Nef
|
total genus |
34
|
structure length |
127
|
sequence length |
150
|
chains with identical sequence |
C
|
ec nomenclature | |
pdb deposition date | 2011-04-04 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Nef Regulatory Factor | Nef Regulatory Factor |
#chains in the Genus database with same CATH superfamily 4U5W A; 1AVZ A; 2XI1 B; 3REB A; 1AVV A; 4D8D B; 4EMZ B; 3RBB A; 3IK5 A; 3IOZ A; 2XI1 A; 4EN2 B; 3REA A; 4ORZ B; 1EFN B; 2NEF A; 4NEE C; #chains in the Genus database with same CATH topology 4U5W A; 1AVZ A; 2XI1 B; 3REB A; 1AVV A; 4D8D B; 4EMZ B; 3RBB A; 3IK5 A; 3IOZ A; 2XI1 A; 4EN2 B; 3REA A; 4ORZ B; 1EFN B; 2NEF A; 4NEE C; #chains in the Genus database with same CATH homology 4U5W A; 1AVZ A; 2XI1 B; 3REB A; 1AVV A; 4D8D B; 4EMZ B; 3RBB A; 3IK5 A; 3IOZ A; 2XI1 A; 4EN2 B; 3REA A; 4ORZ B; 1EFN B; 2NEF A; 4NEE C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...