The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
120
|
sequence length |
375
|
structure length |
364
|
Chain Sequence |
GIGGVPGPHNGLTDVPGVRVGHAGRTGDGWLTGVTVVLAPPGGAVAAVDVRGGGPGTRETDALDPRNLVQTIDAVVLTGGSAFGLDAAGGVAAWLEEQGRGFPVGADPSQVVPVVPAAALFDLGRGGTWRARPDAALGRAAVEAAAARPEGDPVEQGGVGAGTGAVVGGLKGGIGTASVVLDSGATVAALAAVNAAGSAVDPATGVLYGARTGLPGEFAGYGVPDAIGADTHARARARLAEAAEETARRRAGGAATLNCTLAVVATDATLTRAQAQKLAGTAHDGLARAVRPVHLLSDGDTVFALSTGRRPLLPGVHLEAGALNEVLAAGADVLTRAVVHAVLAATGVDTPGGVHPSYRELYAR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transferase
|
| molecule keywords |
cysteine transferase
|
| publication title |
Insights into cis-autoproteolysis reveal a reactive state formed through conformational rearrangement.
pubmed doi rcsb |
| source organism |
Streptomyces cattleya
|
| total genus |
120
|
| structure length |
364
|
| sequence length |
375
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2011-05-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03576 | Peptidase_S58 | Peptidase family S58 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | L-amino peptidase D-ALA esterase/amidase | L-amino peptidase D-ALA esterase/amidase |
#chains in the Genus database with same CATH superfamily 3AXG A; 1VRA A; 4IHD A; 3S3U A; 3TM1 A; 2VZK A; 1VZ6 A; 3N2W A; 3N33 A; 3NDV A; 2YEP A; 3IT6 A; 3N5I A; 4IHE A; 3IT4 A; 1B65 A; 1VZ7 A; 3NFB A; 1VZ8 A; 2DRH A; 3TM2 A; 2V4I A; #chains in the Genus database with same CATH topology 3AXG A; 1VRA A; 4IHD A; 3S3U A; 3TM1 A; 2VZK A; 1VZ6 A; 3N2W A; 3N33 A; 3NDV A; 2YEP A; 3IT6 A; 3N5I A; 4IHE A; 3IT4 A; 1B65 A; 1VZ7 A; 3NFB A; 1VZ8 A; 2DRH A; 3TM2 A; 2V4I A; #chains in the Genus database with same CATH homology 3AXG A; 1VRA A; 4IHD A; 3S3U A; 3TM1 A; 2VZK A; 1VZ6 A; 3N2W A; 3N33 A; 3NDV A; 2YEP A; 3IT6 A; 3N5I A; 4IHE A; 3IT4 A; 1B65 A; 1VZ7 A; 3NFB A; 1VZ8 A; 2DRH A; 3TM2 A; 2V4I A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
