The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
189
|
structure length |
189
|
Chain Sequence |
KLTVYLATTNPHKVEEIKMIAPEWMEILPSPEKIEVVEDGETFLENSVKKAVVYGKKLKHPVMADDSGLVIYSLGGFPGVMSARFMEEHSYKEKMRTILKMLEGKDRRAAFVCSATFFDPVENTLISVEDRVEGRIANEIRGTGGFGYDPFFIPDGYDKTFGEIPHLKEKISHRSKAFRKLFSVLEKIL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and functional characterization of a noncanonical nucleoside triphosphate pyrophosphatase from Thermotoga maritima.
pubmed doi rcsb |
| molecule keywords |
Nucleoside-triphosphatase
|
| molecule tags |
Hydrolase
|
| source organism |
Thermotoga maritima
|
| total genus |
63
|
| structure length |
189
|
| sequence length |
189
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.6.1.66: XTP/dITP diphosphatase. |
| pdb deposition date | 2011-05-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01725 | Ham1p_like | Ham1 family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 4HEB A; 2DVP A; 2Q16 A; 2AMH A; 3S86 A; 1U14 A; 4JHC A; 2I5D A; 2P5X A; 2E5X A; 2J4E A; 4P0U A; 2PYU A; 4F95 A; 2DVN A; 4P0E A; 1EXC A; 1EX2 A; 3TQU A; 2ZTI A; 2CAR A; 4OO0 A; 1ZNO A; 1U5W A; 4LU1 A; 1ZWY A; 4BNQ A; 1V7R A; 1K7K A; 1B78 A; 1VP2 A; 2MJP A; 2DVO A; #chains in the Genus database with same CATH topology 4HEB A; 2DVP A; 2Q16 A; 2AMH A; 3S86 A; 4UUX A; 1U14 A; 4JHC A; 4CT9 A; 2I5D A; 4UOC A; 2P5X A; 2E5X A; 2J4E A; 4UUW A; 4P0U A; 2PYU A; 4CT8 A; 2DVN A; 4P0E A; 4F95 A; 1EXC A; 1EX2 A; 2A9S A; 3TQU A; 2ZTI A; 2CAR A; 4OO0 A; 1ZNO A; 1U5W A; 4LU1 A; 1ZWY A; 4BNQ A; 1V7R A; 4CTA B; 5KOL A; 5KVK A; 1K7K A; 1B78 A; 1VP2 A; 2MJP A; 4CTA A; 2DVO A; #chains in the Genus database with same CATH homology 4HEB A; 2DVP A; 2Q16 A; 2AMH A; 3S86 A; 1U14 A; 4JHC A; 2I5D A; 2P5X A; 2E5X A; 2J4E A; 4P0U A; 2PYU A; 4F95 A; 2DVN A; 4P0E A; 1EXC A; 1EX2 A; 3TQU A; 2ZTI A; 2CAR A; 4OO0 A; 1ZNO A; 1U5W A; 4LU1 A; 1ZWY A; 4BNQ A; 1V7R A; 1K7K A; 1B78 A; 1VP2 A; 2MJP A; 2DVO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...