The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
ALFPTPLFQTLYLASQSPRRQELLQQIGVRFELLLPRPDEDAEALEAELPGEAADAYVRRVTVAKAEAARARLVASGKPAAPVLVADTTVTIDGAILGKPTDADDALAMLTRLAGREHAVLTAVAVIDASGELLPPALSRSSVRFAAASRDAYVRYVETGEPFGKAGAYAIQGRAAEFIERIDGSHSGIMGLPLFETAALLRTARVAF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of Maf-like protein BceJ2315_23540 from Burkholderia cenocepacia
rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Burkholderia cenocepacia
|
| molecule keywords |
Maf-like protein BCAL2394
|
| total genus |
60
|
| structure length |
208
|
| sequence length |
208
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2014-01-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02545 | Maf | Maf-like protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Maf protein | Maf protein |
#chains in the Genus database with same CATH superfamily 1EX2 A; 2DVN A; 1B78 A; 3S86 A; 2P5X A; 1U5W A; 1K7K A; 2AMH A; 1ZWY A; 4F95 A; 4LU1 A; 1U14 A; 3TQU A; 4OO0 A; 4P0U A; 4HEB A; 2Q16 A; 4BNQ A; 2E5X A; 1EXC A; 1VP2 A; 1V7R A; 2DVO A; 2J4E A; 2MJP A; 4P0E A; 2PYU A; 2CAR A; 4JHC A; 1ZNO A; 2ZTI A; 2DVP A; 2I5D A; #chains in the Genus database with same CATH topology 4UUX A; 1EX2 A; 2A9S A; 2DVN A; 1B78 A; 3S86 A; 4UOC A; 2P5X A; 1U5W A; 1K7K A; 2AMH A; 1ZWY A; 4UUW A; 4CTA A; 4F95 A; 4LU1 A; 4CTA B; 5KOL A; 1U14 A; 3TQU A; 4OO0 A; 4CT9 A; 5KVK A; 4P0U A; 4HEB A; 2Q16 A; 4BNQ A; 2E5X A; 1EXC A; 1VP2 A; 1V7R A; 2DVO A; 4CT8 A; 2J4E A; 2MJP A; 4P0E A; 2PYU A; 2CAR A; 4JHC A; 1ZNO A; 2ZTI A; 2DVP A; 2I5D A; #chains in the Genus database with same CATH homology 1EX2 A; 2DVN A; 1B78 A; 3S86 A; 2P5X A; 1U5W A; 1K7K A; 2AMH A; 1ZWY A; 4F95 A; 4LU1 A; 1U14 A; 3TQU A; 4OO0 A; 4P0U A; 4HEB A; 2Q16 A; 4BNQ A; 2E5X A; 1EXC A; 1VP2 A; 1V7R A; 2DVO A; 2J4E A; 2MJP A; 4P0E A; 2PYU A; 2CAR A; 4JHC A; 1ZNO A; 2ZTI A; 2DVP A; 2I5D A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
