The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
YRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEGNVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure and Functional Analyses of the Lectin Domain of Glucosidase II: Insights into Oligomannose Recognition.
pubmed doi rcsb |
| molecule keywords |
Glucosidase 2 subunit beta
|
| molecule tags |
Hydrolase
|
| source organism |
Schizosaccharomyces pombe (strain 972 / atcc 24843)
|
| total genus |
21
|
| structure length |
94
|
| sequence length |
94
|
| ec nomenclature |
ec
3.2.1.84: Glucan 1,3-alpha-glucosidase. |
| pdb deposition date | 2015-01-19 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Cation-dependent Mannose-6-phosphate Receptor; Chain A | Mannose-6-phosphate receptor binding domain |
#chains in the Genus database with same CATH superfamily 1KEO A; 3AIH A; 2M6T A; 2LLA A; 2KVA A; 3K42 A; 2RL7 A; 2V5N A; 2LVX A; 2RLB A; 3K43 A; 2L2G A; 1C39 A; 2M68 A; 2L2A A; 1E6F A; 2N1H A; 1SYO A; 5IEI A; 2RL8 A; 2RL9 A; 1Q25 A; 2L29 A; 2V5O A; 3CY4 A; 2CNJ D; 1GP0 A; 2KVB A; 3K41 A; 2L21 A; 4XQM A; 1GQB A; 1SZ0 A; 1GP3 A; 1M6P A; #chains in the Genus database with same CATH topology 1KEO A; 3AIH A; 2M6T A; 2LLA A; 2KVA A; 3K42 A; 2RL7 A; 2V5N A; 2LVX A; 2RLB A; 3K43 A; 2L2G A; 1C39 A; 2M68 A; 2L2A A; 1E6F A; 2N1H A; 1SYO A; 5IEI A; 2RL8 A; 2RL9 A; 1Q25 A; 2L29 A; 2V5O A; 3CY4 A; 2CNJ D; 1GP0 A; 2KVB A; 3K41 A; 2L21 A; 4XQM A; 1GQB A; 1SZ0 A; 1GP3 A; 1M6P A; #chains in the Genus database with same CATH homology 1KEO A; 3AIH A; 2M6T A; 2LLA A; 2KVA A; 3K42 A; 2RL7 A; 2V5N A; 2LVX A; 2RLB A; 3K43 A; 2L2G A; 1C39 A; 2M68 A; 2L2A A; 1E6F A; 2N1H A; 1SYO A; 5IEI A; 2RL8 A; 2RL9 A; 1Q25 A; 2L29 A; 2V5O A; 3CY4 A; 2CNJ D; 1GP0 A; 2KVB A; 3K41 A; 2L21 A; 4XQM A; 1GQB A; 1SZ0 A; 1GP3 A; 1M6P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...