4IOCK

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
HGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLITTAKGGDLHSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGTRRGDGVTMALIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01196 Ribosomal_L17 Ribosomal protein L17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1030.10 Alpha Beta Alpha-Beta Complex 50s Ribosomal Protein L17; Chain: A, Ribosomal protein L17 4iocK00
5JVGK 4WFBK 4U67K 5GADO 4WCEK 4IO9K 4IOAK 4WF9K 4UY8N 1GD8A 3J7ZN 5H1SP 3CF5K 5JVHK 5GAEO 4WFAK 2CQMA 4IOCK 3PIOK 2ZJQK 5MLCP 2ZJRK 3DLLK 3PIPK 5DM7K 5HL7K 5GAGO 2ZJPK 4WFNK 5GAHO 5DM6K
chains in the Genus database with same CATH superfamily
5JVGK 4WFBK 4U67K 5GADO 4WCEK 4IO9K 4IOAK 4WF9K 4UY8N 1GD8A 3J7ZN 5H1SP 3CF5K 5JVHK 5GAEO 4WFAK 2CQMA 4IOCK 3PIOK 2ZJQK 5MLCP 2ZJRK 3DLLK 3PIPK 5DM7K 5HL7K 5GAGO 2ZJPK 4WFNK 5GAHO 5DM6K
chains in the Genus database with same CATH topology
5JVGK 4WFBK 4U67K 5GADO 4WCEK 4IO9K 4IOAK 4WF9K 4UY8N 1GD8A 3J7ZN 5H1SP 3CF5K 5JVHK 5GAEO 4WFAK 2CQMA 4IOCK 3PIOK 2ZJQK 5MLCP 2ZJRK 3DLLK 3PIPK 5DM7K 5HL7K 5GAGO 2ZJPK 4WFNK 5GAHO 5DM6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG K;  4WFB K;  4U67 K;  5GAD O;  4WCE K;  4IO9 K;  4IOA K;  4WF9 K;  4UY8 N;  1GD8 A;  3J7Z N;  5H1S P;  3CF5 K;  5JVH K;  5GAE O;  4WFA K;  2CQM A;  4IOC K;  3PIO K;  2ZJQ K;  5MLC P;  2ZJR K;  3DLL K;  3PIP K;  5DM7 K;  5HL7 K;  5GAG O;  2ZJP K;  4WFN K;  5GAH O;  5DM6 K; 
#chains in the Genus database with same CATH topology
 5JVG K;  4WFB K;  4U67 K;  5GAD O;  4WCE K;  4IO9 K;  4IOA K;  4WF9 K;  4UY8 N;  1GD8 A;  3J7Z N;  5H1S P;  3CF5 K;  5JVH K;  5GAE O;  4WFA K;  2CQM A;  4IOC K;  3PIO K;  2ZJQ K;  5MLC P;  2ZJR K;  3DLL K;  3PIP K;  5DM7 K;  5HL7 K;  5GAG O;  2ZJP K;  4WFN K;  5GAH O;  5DM6 K; 
#chains in the Genus database with same CATH homology
 5JVG K;  4WFB K;  4U67 K;  5GAD O;  4WCE K;  4IO9 K;  4IOA K;  4WF9 K;  4UY8 N;  1GD8 A;  3J7Z N;  5H1S P;  3CF5 K;  5JVH K;  5GAE O;  4WFA K;  2CQM A;  4IOC K;  3PIO K;  2ZJQ K;  5MLC P;  2ZJR K;  3DLL K;  3PIP K;  5DM7 K;  5HL7 K;  5GAG O;  2ZJP K;  4WFN K;  5GAH O;  5DM6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...