The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
137
|
structure length |
132
|
Chain Sequence |
NEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGRTRISVGKANKRLRYVDQVLQLVYKDGSHCPSKHGLSYKSVISFVCRPNRPMLISLDKQTCTLFFSWHTPLACE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Functional evolution of IGF2:IGF2R domain 11 binding generates novel structural interactions and a specific IGF2 antagonist.
pubmed doi rcsb |
| molecule keywords |
Cation-independent mannose-6-phosphate receptor
|
| molecule tags |
Transport protein
|
| source organism |
Homo sapiens
|
| total genus |
36
|
| structure length |
132
|
| sequence length |
137
|
| ec nomenclature | |
| pdb deposition date | 2016-02-25 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Cation-dependent Mannose-6-phosphate Receptor; Chain A | Mannose-6-phosphate receptor binding domain |
#chains in the Genus database with same CATH superfamily 3K42 A; 5IEI A; 2RLB A; 2KVB A; 3CY4 A; 3K41 A; 2RL8 A; 1GQB A; 2CNJ D; 1C39 A; 2L2G A; 2M68 A; 1E6F A; 2M6T A; 2LVX A; 1SZ0 A; 3AIH A; 2L21 A; 2V5N A; 2KVA A; 4XQM A; 1GP3 A; 2V5O A; 2RL7 A; 3K43 A; 1KEO A; 1GP0 A; 2RL9 A; 2L2A A; 2L29 A; 1M6P A; 2N1H A; 2LLA A; 1Q25 A; 1SYO A; #chains in the Genus database with same CATH topology 3K42 A; 5IEI A; 2RLB A; 2KVB A; 3CY4 A; 3K41 A; 2RL8 A; 1GQB A; 2CNJ D; 1C39 A; 2L2G A; 2M68 A; 1E6F A; 2M6T A; 2LVX A; 1SZ0 A; 3AIH A; 2L21 A; 2V5N A; 2KVA A; 4XQM A; 1GP3 A; 2V5O A; 2RL7 A; 3K43 A; 1KEO A; 1GP0 A; 2RL9 A; 2L2A A; 2L29 A; 1M6P A; 2N1H A; 2LLA A; 1Q25 A; 1SYO A; #chains in the Genus database with same CATH homology 3K42 A; 5IEI A; 2RLB A; 2KVB A; 3CY4 A; 3K41 A; 2RL8 A; 1GQB A; 2CNJ D; 1C39 A; 2L2G A; 2M68 A; 1E6F A; 2M6T A; 2LVX A; 1SZ0 A; 3AIH A; 2L21 A; 2V5N A; 2KVA A; 4XQM A; 1GP3 A; 2V5O A; 2RL7 A; 3K43 A; 1KEO A; 1GP0 A; 2RL9 A; 2L2A A; 2L29 A; 1M6P A; 2N1H A; 2LLA A; 1Q25 A; 1SYO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
