1UAMA

Crystal structure of trna(m1g37)methyltransferase: insight into trna recognition
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
252
structure length
250
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (Guanine-N(1)-)-methyltransferase
publication title Crystal structure of tRNA(m(1)G37)methyltransferase: insights into tRNA recognition
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 74
structure length 250
sequence length 252
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 1uamA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1uamA01
4YQBA 2QWVA 2Z0YA 4YPZA 1UAKA 5CO4A 4YQJA 1VHYA 3ONPA 2I6DA 1O6DA 4YQ6A 4YQ4A 3BBEA 3KW2A 3O7BA 4PZKA 4FAKA 1VHKA 4H3YA 4YQ9A 3N4JA 2CX8A 4CNDA 1NS5A 4CNFA 4YVKA 1K3RA 4YVGA 4YQ7A 4YVIA 3AIAA 4CNEA 1P9PA 3KTYA 4YQRA 1X7PA 4YQ2A 2V3JA 1MXIA 3OIIA 3N4KA 4MCDA 4YQKA 4YQGA 1Z85A 2EGWA 5GMCA 4MCBA 4YQAA 4J3CA 4YPYA 1NXZA 4KDZA 4YQQA 3L8UA 3E5YA 2HA8A 3IEFA 3KY7A 2V3KA 1UALA 1X7OA 3BBDA 1J85A 5GM8A 4X3LA 3NK6A 1V6ZA 3IC6A 4YQSA 4L69A 2QMMA 4YQCA 1OY5A 4MCCA 4IG6A 4YQ1A 4YVJA 4YVHA 4KGNA 3AI9X 1GZ0A 4RG1A 3GYQA 4YQLA 4YQDA 1UAJA 4JAKA 2YY8A 5GMBA 3AXZA 1IPAA 5FAIA 4YPXA 4YQ8A 3QUVA 4CNGA 4YQTA 4YQNA 4JALA 4YQIA 4YPWA 4X3MA 1ZJRA 1UAMA 1TO0A 1V2XA 3BBHA 3OINA 4H3ZA 3KNUA 3DCMX 4E8BA 2EGVA 4YQ0A 5D9FA 3OIJA 4YQ3A 4YQOA 4XBOA 4YQPA 3NK7A 1VH0A 3ILKA 2O3AA 4YQ5A
chains in the Genus database with same CATH superfamily
3SSWN 2OZ9R 4YQBA 2QWVA 2Z0YA 1WRSR 1WRPR 1UAKA 4YPZA 4YQJA 1VHYA 3ONPA 5CO4A 2I6DA 1RCSA 1O6DA 4YQ6A 4YQ4A 3BBEA 3KW2A 3O7BA 4PZKA 4FAKA 1VHKA 4H3YA 4YQ9A 3N4JA 2CX8A 4CNDA 1NS5A 3KORA 4FMWA 4CNFA 1ZT9A 4YVKA 1K3RA 4YVGA 4YQ7A 4YVIA 3AIAA 4JWGA 4CNEA 1P9PA 3KTYA 4YQRA 1X7PA 4YQ2A 1WRTR 2V3JA 1MXIA 3OIIA 3N4KA 4MCDA 4YQKA 4YQGA 1Z85A 2EGWA 5GMCA 4MCBA 4YQAA 4J3CA 4YPYA 1NXZA 4KDZA 4YQQA 3L8UA 3E5YA 2HA8A 3IEFA 3KY7A 2V3KA 1UALA 1X7OA 3BBDA 1TRRA 1J85A 5GM8A 4X3LA 3NK6A 1V6ZA 3IC6A 4YQSA 4L69A 1CO0A 2QMMA 4YQCA 1OY5A 4MCCA 4IG6A 2O3AA 4YQ1A 1TROA 4YVJA 4KGNA 3AI9X 1GZ0A 4RG1A 3GYQA 4YQLA 4YQDA 1UAJA 4JAKA 2YY8A 5GMBA 3AXZA 1IPAA 5FAIA 4YPXA 3FRWA 2XDIA 4YQ8A 4JWHA 3QUVA 4CNGA 1MI7R 3G1CA 4YQTA 4YQNA 4JWJA 1JHGA 4JALA 4YQIA 4YPWA 4X3MA 1ZJRA 1UAMA 1TO0A 1V2XA 3BBHA 3OINA 4H3ZA 3KNUA 3SSXN 3DCMX 4E8BA 2EGVA 4YQ0A 5D9FA 3OIJA 4JWFA 4YQ3A 4YQOA 4XBOA 4YQPA 3WRPA 3NK7A 1VH0A 3ILKA 4YVHA 4YQ5A
chains in the Genus database with same CATH topology
4YQBA 2QWVA 2Z0YA 4YPZA 1UAKA 5CO4A 4YQJA 1VHYA 3ONPA 2I6DA 1O6DA 4YQ6A 4YQ4A 3BBEA 3KW2A 3O7BA 4PZKA 4FAKA 1VHKA 4H3YA 4YQ9A 3N4JA 2CX8A 4CNDA 1NS5A 4FMWA 4CNFA 4YVKA 1K3RA 4YVGA 4YQ7A 4YVIA 3AIAA 4JWGA 4CNEA 1P9PA 3KTYA 4YQRA 1X7PA 4YQ2A 2V3JA 1MXIA 3OIIA 3N4KA 4MCDA 4YQKA 4YQGA 1Z85A 2EGWA 5GMCA 4MCBA 4YQAA 4J3CA 4YPYA 1NXZA 4KDZA 4YQQA 3L8UA 3E5YA 2HA8A 3IEFA 3KY7A 2V3KA 1UALA 1X7OA 3BBDA 1J85A 5GM8A 4X3LA 3NK6A 1V6ZA 3IC6A 4YQSA 4L69A 2QMMA 4YQCA 1OY5A 4MCCA 4IG6A 4YQ1A 4YVJA 4YVHA 4KGNA 3AI9X 1GZ0A 4RG1A 3GYQA 4YQLA 4YQDA 1UAJA 4JAKA 2YY8A 5GMBA 3AXZA 1IPAA 5FAIA 4YPXA 4YQ8A 4JWHA 3QUVA 4CNGA 4YQTA 4YQNA 4JWJA 4JALA 4YQIA 4YPWA 4X3MA 1ZJRA 1UAMA 1TO0A 1V2XA 3BBHA 3OINA 4H3ZA 3KNUA 3DCMX 4E8BA 2EGVA 4YQ0A 5D9FA 3OIJA 4JWFA 4YQ3A 4YQOA 4XBOA 4YQPA 3NK7A 1VH0A 3ILKA 2O3AA 4YQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQB A;  2QWV A;  2Z0Y A;  4YPZ A;  1UAK A;  5CO4 A;  4YQJ A;  1VHY A;  3ONP A;  2I6D A;  1O6D A;  4YQ6 A;  4YQ4 A;  3BBE A;  3KW2 A;  3O7B A;  4PZK A;  4FAK A;  1VHK A;  4H3Y A;  4YQ9 A;  3N4J A;  2CX8 A;  4CND A;  1NS5 A;  4CNF A;  4YVK A;  1K3R A;  4YVG A;  4YQ7 A;  4YVI A;  3AIA A;  4CNE A;  1P9P A;  3KTY A;  4YQR A;  1X7P A;  4YQ2 A;  2V3J A;  1MXI A;  3OII A;  3N4K A;  4MCD A;  4YQK A;  4YQG A;  1Z85 A;  2EGW A;  5GMC A;  4MCB A;  4YQA A;  4J3C A;  4YPY A;  1NXZ A;  4KDZ A;  4YQQ A;  3L8U A;  3E5Y A;  2HA8 A;  3IEF A;  3KY7 A;  2V3K A;  1UAL A;  1X7O A;  3BBD A;  1J85 A;  5GM8 A;  4X3L A;  3NK6 A;  1V6Z A;  3IC6 A;  4YQS A;  4L69 A;  2QMM A;  4YQC A;  1OY5 A;  4MCC A;  4IG6 A;  4YQ1 A;  4YVJ A;  4YVH A;  4KGN A;  3AI9 X;  1GZ0 A;  4RG1 A;  3GYQ A;  4YQL A;  4YQD A;  1UAJ A;  4JAK A;  2YY8 A;  5GMB A;  3AXZ A;  1IPA A;  5FAI A;  4YPX A;  4YQ8 A;  3QUV A;  4CNG A;  4YQT A;  4YQN A;  4JAL A;  4YQI A;  4YPW A;  4X3M A;  1ZJR A;  1UAM A;  1TO0 A;  1V2X A;  3BBH A;  3OIN A;  4H3Z A;  3KNU A;  3DCM X;  4E8B A;  2EGV A;  4YQ0 A;  5D9F A;  3OIJ A;  4YQ3 A;  4YQO A;  4XBO A;  4YQP A;  3NK7 A;  1VH0 A;  3ILK A;  2O3A A;  4YQ5 A; 
#chains in the Genus database with same CATH topology
 3SSW N;  2OZ9 R;  4YQB A;  2QWV A;  2Z0Y A;  1WRS R;  1WRP R;  1UAK A;  4YPZ A;  4YQJ A;  1VHY A;  3ONP A;  5CO4 A;  2I6D A;  1RCS A;  1O6D A;  4YQ6 A;  4YQ4 A;  3BBE A;  3KW2 A;  3O7B A;  4PZK A;  4FAK A;  1VHK A;  4H3Y A;  4YQ9 A;  3N4J A;  2CX8 A;  4CND A;  1NS5 A;  3KOR A;  4FMW A;  4CNF A;  1ZT9 A;  4YVK A;  1K3R A;  4YVG A;  4YQ7 A;  4YVI A;  3AIA A;  4JWG A;  4CNE A;  1P9P A;  3KTY A;  4YQR A;  1X7P A;  4YQ2 A;  1WRT R;  2V3J A;  1MXI A;  3OII A;  3N4K A;  4MCD A;  4YQK A;  4YQG A;  1Z85 A;  2EGW A;  5GMC A;  4MCB A;  4YQA A;  4J3C A;  4YPY A;  1NXZ A;  4KDZ A;  4YQQ A;  3L8U A;  3E5Y A;  2HA8 A;  3IEF A;  3KY7 A;  2V3K A;  1UAL A;  1X7O A;  3BBD A;  1TRR A;  1J85 A;  5GM8 A;  4X3L A;  3NK6 A;  1V6Z A;  3IC6 A;  4YQS A;  4L69 A;  1CO0 A;  2QMM A;  4YQC A;  1OY5 A;  4MCC A;  4IG6 A;  2O3A A;  4YQ1 A;  1TRO A;  4YVJ A;  4KGN A;  3AI9 X;  1GZ0 A;  4RG1 A;  3GYQ A;  4YQL A;  4YQD A;  1UAJ A;  4JAK A;  2YY8 A;  5GMB A;  3AXZ A;  1IPA A;  5FAI A;  4YPX A;  3FRW A;  2XDI A;  4YQ8 A;  4JWH A;  3QUV A;  4CNG A;  1MI7 R;  3G1C A;  4YQT A;  4YQN A;  4JWJ A;  1JHG A;  4JAL A;  4YQI A;  4YPW A;  4X3M A;  1ZJR A;  1UAM A;  1TO0 A;  1V2X A;  3BBH A;  3OIN A;  4H3Z A;  3KNU A;  3SSX N;  3DCM X;  4E8B A;  2EGV A;  4YQ0 A;  5D9F A;  3OIJ A;  4JWF A;  4YQ3 A;  4YQO A;  4XBO A;  4YQP A;  3WRP A;  3NK7 A;  1VH0 A;  3ILK A;  4YVH A;  4YQ5 A; 
#chains in the Genus database with same CATH homology
 4YQB A;  2QWV A;  2Z0Y A;  4YPZ A;  1UAK A;  5CO4 A;  4YQJ A;  1VHY A;  3ONP A;  2I6D A;  1O6D A;  4YQ6 A;  4YQ4 A;  3BBE A;  3KW2 A;  3O7B A;  4PZK A;  4FAK A;  1VHK A;  4H3Y A;  4YQ9 A;  3N4J A;  2CX8 A;  4CND A;  1NS5 A;  4FMW A;  4CNF A;  4YVK A;  1K3R A;  4YVG A;  4YQ7 A;  4YVI A;  3AIA A;  4JWG A;  4CNE A;  1P9P A;  3KTY A;  4YQR A;  1X7P A;  4YQ2 A;  2V3J A;  1MXI A;  3OII A;  3N4K A;  4MCD A;  4YQK A;  4YQG A;  1Z85 A;  2EGW A;  5GMC A;  4MCB A;  4YQA A;  4J3C A;  4YPY A;  1NXZ A;  4KDZ A;  4YQQ A;  3L8U A;  3E5Y A;  2HA8 A;  3IEF A;  3KY7 A;  2V3K A;  1UAL A;  1X7O A;  3BBD A;  1J85 A;  5GM8 A;  4X3L A;  3NK6 A;  1V6Z A;  3IC6 A;  4YQS A;  4L69 A;  2QMM A;  4YQC A;  1OY5 A;  4MCC A;  4IG6 A;  4YQ1 A;  4YVJ A;  4YVH A;  4KGN A;  3AI9 X;  1GZ0 A;  4RG1 A;  3GYQ A;  4YQL A;  4YQD A;  1UAJ A;  4JAK A;  2YY8 A;  5GMB A;  3AXZ A;  1IPA A;  5FAI A;  4YPX A;  4YQ8 A;  4JWH A;  3QUV A;  4CNG A;  4YQT A;  4YQN A;  4JWJ A;  4JAL A;  4YQI A;  4YPW A;  4X3M A;  1ZJR A;  1UAM A;  1TO0 A;  1V2X A;  3BBH A;  3OIN A;  4H3Z A;  3KNU A;  3DCM X;  4E8B A;  2EGV A;  4YQ0 A;  5D9F A;  3OIJ A;  4JWF A;  4YQ3 A;  4YQO A;  4XBO A;  4YQP A;  3NK7 A;  1VH0 A;  3ILK A;  2O3A A;  4YQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...