The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
71
|
structure length |
71
|
Chain Sequence |
MSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKNG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of a type I dockerin domain, a novel prokaryotic, extracellular calcium-binding domain.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Clostridium thermocellum
|
| molecule keywords |
ENDOGLUCANASE SS
|
| total genus |
6
|
| structure length |
71
|
| sequence length |
71
|
| ec nomenclature |
ec
3.2.1.176: Cellulose 1,4-beta-cellobiosidase (reducing end). |
| pdb deposition date | 1999-10-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00404 | Dockerin_1 | Dockerin type I domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Type 1 dockerin domain | Dockerin domain |
#chains in the Genus database with same CATH superfamily 5K39 B; 4FL4 C; 2B59 B; 2Y3N B; 2JNK A; 1DAQ A; 3KCP A; 5G5D B; 4IU3 B; 5LXV B; 2CCL B; 3UL4 B; 4IU2 B; 2VN5 B; 2MTE A; 4DH2 B; 2OZN B; 4U3S B; 4WKZ A; 1OHZ B; 4UYP B; 4FL4 A; 1DAV A; 4WI0 B; 2VN6 B; 4UYQ B; #chains in the Genus database with same CATH topology 5K39 B; 4FL4 C; 2B59 B; 2Y3N B; 2JNK A; 1DAQ A; 3KCP A; 5G5D B; 4IU3 B; 5LXV B; 2CCL B; 3UL4 B; 4IU2 B; 2VN5 B; 2MTE A; 4DH2 B; 2OZN B; 4U3S B; 4WKZ A; 1OHZ B; 4UYP B; 4FL4 A; 1DAV A; 4WI0 B; 2VN6 B; 4UYQ B; #chains in the Genus database with same CATH homology 5K39 B; 4FL4 C; 2B59 B; 2Y3N B; 2JNK A; 1DAQ A; 3KCP A; 5G5D B; 4IU3 B; 5LXV B; 2CCL B; 3UL4 B; 4IU2 B; 2VN5 B; 2MTE A; 4DH2 B; 2OZN B; 4U3S B; 4WKZ A; 1OHZ B; 4UYP B; 4FL4 A; 1DAV A; 4WI0 B; 2VN6 B; 4UYQ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
