4WKZA

Complex of autonomous scag cohesin cohg and x-doc domains
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
231
Chain Sequence
VTSAVKTQYVEIESVMGFYFNTEDKFDTAQIKKAVLHTVYNEGYTDDGVAVVLREYESEPVDITAELTFGDATPANTYKAVENKFDYEIPVYYNNATLKDAEGNDATVTVYIGLKGDTDLNNIVDGRDATATLTYYAATSTDGKDATTVALSPSTLVGGNPESVYDDFSAFLSDVKVDAGKELTRFAKKAERLIDGRDASSILTFYTKSSVDQYKDMAANEPNKLWDIVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Putative cellulose-binding protein
publication title Complex of autonomous ScaG cohesin CohG and X-doc domains
rcsb
source organism Ruminococcus flavefaciens
total genus 66
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18244 CttA_N Cellulose-binding protein CttA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wkzA02
2.60.40.3810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wkzA01
5LXVB 2MTEA 4FL4A 4DH2B 2JNKA 1OHZB 3KCPA 2VN5B 3UL4B 1DAVA 1DAQA 4IU2B 4UYQB 5K39B 4WI0B 2Y3NB 2B59B 4UYPB 4FL4C 2OZNB 5G5DB 4U3SB 2CCLB 4WKZA 2VN6B 4IU3B
chains in the Genus database with same CATH superfamily
4U6VH 3TEYA 4P3WA 1KBGH 5DRWB 3LRSB 4LMQI 4AK2A 3GNMH 3QNYA 1MXGA 3M88A 2OX5A 5DQ9B 1SMOA 1B4JL 4XC1H 1LVEA 3BFWA 1ZVSA 3D3VB 3Q1SL 2IPKB 4NYLB 5K39B 1ASQA 1E9PA 2UVEA 1RLWA 3RIAK 4PJ9D 1I7ZA 3WKNA 4QRRD 3GJFA 3HG1E 1OTUC 4ZMAT 2ESVA 3DX7B 3QJVB 4YIQA 4AYDC 3NEEA 2HLFD 4Q8BA 3N44B 5IV2B 3TH2T 4FJZA 2NNCA 1X5XA 4P46D 1MREH 3PHQB 1F3JB 2QV2A 4JFQA 1HXYA 1MNUH 5FC9A 3MI6A 5ICXA 3BVNB 4F9PC 4YSUA 4RZKA 4A7SA 1CICB 2JQAA 4JY5H 5DRXA 4PFEA 4ZUTB 1DO6A 3DJSA 4ZSOB 1EAPA 3DHMA 3RGVB 4Q2ZB 2BP8B 1OLZA 1U3JA 1YHPA 2IWKA 1HSBB 2FH6A 2WN2A 4OQ1A 4AXWB 4C55A 1ZXKA 1G9NH 2J7LA 1XX9C 4ZFQA 2JNZA 4MD4B 4FQQA 1EFXB 4E9TA 3C5ZC 2R2HA 4N9GB 2X3CA 2ZWKA 2H6UA 3PJSB 4NRXB 4ETQA 2HUHA 1SXSA 2XACC 4R26L 3W1ZA 1E8YA 1KIRB 4CVXA 4DN4L 5ITBH 2AAVA 5CJQH 1XGYL 4EDXA 1HDMA 2R0ZL 3BVXA 4OJEH 5ENWA 1QFWM 4Y2OB 1A7RH 3HI6H 3C5SB 1INDH 1HHHA 3G5ZB 3GSNA 3RVVC 5AVSB 4PS8A 4UQCA 2Z31D 2X89A 3RI5K 1NCAH 4A2LA 4ANVA 3HAEH 3RWDA 3ZDYF 3TBVA 3VG9C 3FO9B 5DQJA 3Q13A 4PJAB 1CGUA 2AGJL 4GKZB 5T5FL 3T1WA 4J28A 4KO5A 2ZUTA 1WWAX 1N59B 4H1LH 1NEZA 1VFOA 4AM0Q 4Q58C 1Q9LB 3FN0L 3LB6C 3RWIA 5JQ6L 5LWYL 3BRFA 2EDJA 1V54B 2YPLD 1J0YA 1V3MA 2L7QA 1KXVC 2V5SA 2NY2C 3NN8A 5F9JA 5LN8A 3MCKB 1KTDA 4PJBF 1W0VA 2CA3A 2G2NA 3W39B 4A68A 2QGBA 3S5ZA 1G7JA 3TJEL 4U2ZA 3EF4A 1MEXL 2DWYA 4FQ1H 4JFYA 5ESVA 5KBKA 4X99A 2HT3C 3WY2A 3GIVA 3N1MC 4X6EA 4L4VB 2FL5B 3O3UN 1Z3RA 3SDAA 2ENPA 2VABB 3FT2A 3H8NA 4PJIA 1ZANH 3EKCA 3PIQB 3ABKB 4DFHA 2Q1EA 4KJPD 1P1VA 4ZX4A 3U0PA 2QQNL 5AB2A 4F37F 4NB7A 3WY3A 3MRNB 1FO0B 1LNUB 3O9WC 3RU8L 5IQ9A 3JUZA 1HQRA 2AXHA 3KWTA 4HX1A 3BKYH 4ANUA 3HG4A 3I74A 5E4OA 3HHRB 3M6DA 4LQFH 1QSZA 3T4AB 1AANA 5B1AB 4Z8FH 4S10A 4X4ZA 4LOFA 1E3XA 3RBGA 5DJZB 1QVOB 3KS0J 4WJ5A 3QDHA 2DWSA 4IDJL 4PJEF 4YR6B 3OC5A 1JXJA 1RULL 3VFSB 3T0DA 4PV1C 2L7JA 3ULVL 3GD1C 4FEIA 1CG9A 1H15B 1NAMB 3KXFD 4DF9A 1YUHA 3IMVA 5K9QI 1BJ1H 3VU2A 3O81A 5EU6D 4ILDA 3P77B 1ZTXH 1FE8L 1I1FA 5EO9B 3D4CA 1SMDA 3O6LH 5EIIG 4HK3N 3BHBA 1T83C 3FFCA 4U2YA 5KSBF 1XO8A 3MRFA 4HUXB 3HRPA 1Q72H 1WIUA 2QVIA 3MRQA 4OKVA 1GC1H 2H26A 4QLRA 5JHLA 2UY7B 5B3SB 5TQ2L 4DKFH 4IHBA 1SLWA 2BCMA 3W2DH 1U8QA 5F8QC 4HPOL 4JVPA 4K71C 1VGEL 3RZWA 4H8PA 1AQDA 2GSIB 4XNXL 5D2NA 2FBRA 3CSTA 1D2PA 2CUMA 3QJHB 4YLBA 2C3WA 3HI5H 1P6WA 1K2DA 4Y4FB 3L45A 2WLMA 2BHZA 3PS6A 1K4CB 4DGUA 7CGTA 2WN3A 3S35L 1BYPA 1IX2A 3HJEA 5ISZD 5A2IH 3MU3A 4LIQE 4FULA 4A55A 4XB3A 4W68A 3CHPA 4HPYH 4HIPA 2D7TH 3D9AH 3QZWA 4GI8A 4EUPA 3N85L 1U21A 1R5WB 2NR6A 1L9QA 5DCCA 3IKCA 2ICEA 5DYOA 2DKUA 2ADIA 1D5XB 2L4OA 4Y4KC 3UTPD 1CFNA 2WXRA 3UGEA 3BWSA 5BS0E 1N5YH 1G4RA 4PRPD 1PKOA 2EXTA 3H7BA 3P30L 4Y19E 3RVXC 3P4NB 4F9LA 4F2MA 4J3OH 2W81C 1IFGA 1JNHA 3RFZC 3ZQXA 5AAPA 3HZYA 3ULVE 1YEGL 3C87A 2ZCZA 3UAEA 3N40F 2DEXX 1MXDA 4FNTA 3JV6B 5D4IA 2L04A 3HC3H 4Z95L 2VDMB 2GI7A 4LCWA 2K1MA 4M6OL 3BPLB 4LZKA 4MXWL 1HSAB 4H7VA 2CHZA 2M8XA 4N0RA 3BQVA 5DFVD 4LK4A 3KWWB 4FLQA 3HAEG 4WUUE 4LHUA 1H3PL 1TITA 2DWEA 2OKMA 4I3RL 5IQOA 2JELL 3ATBA 2CNZA 5F21B 1HL5A 3NIGF 4H1LG 1ZLWK 2WZ0A 5AVWB 5ESAA 3OG6B 1VJSA 1XR9A 3NSCA 1FIGH 2F7RA 1JRHL 4AYMC 1KYAA 5IESH 3MTRA 4NKOA 4XZUB 2WGXA 3MRIB 4R5TA 4GINA 1KCRH 4WFFE 1FP5A 1JD7A 4QXUH 1UWXK 2OYMA 3LRLA 2RTTA 2JK5A 4PJFA 5D5MF 1QO3B 3KPLB 3GMQA 2J8OA 2TAAA 3IFNL 4YBLB 4HAKA 3GMLA 4R7NA 2NCMA 1YY8A 4Z3TA 2F58H 3O6FB 5IW6B 3CQPA 5EFIA 1OAQH 4M8QA 1T22A 1U30A 4WAFA 3KPSD 3IJHB 1J9TA 1ONQB 1TQTA 3B9DA 4H8VA 1CZ8L 2WINB 4DETA 2VUYA 1VENA 1JF1A 3OSKA 3C5XA 5FYLH 2IQAA 3D50A 1K9TA 1LO0L 1TTCA 3NA4A 4JO3H 2FJUB 5A2FA 4OBSA 2WKGA 3GYRA 4NQDB 4XN1A 2X87A 2LW3A 4HK3J 3W11C 3STBA 5ALCL 5J1SC 3GRWA 2GEEA 1G7LA 4PUBL 3P4MB 5CN2A 5I0ZA 1QYGL 5DHMC 3BP4A 4QPEA 3MV11 1FORH 1JWSB 2YMXL 4JVUA 5I76A 4OJAA 3RJOA 3RZCB 3ZE0F 4BCZA 4U1KB 2Q7YA 2VDRL 2OLDA 5CO1A 3C60B 5D7JB 1MHHB 4J3VA 3LRHA 1KJ3H 4ODHH 1ZHLB 4WSKA 5CCHE 4OLWH 4DVBB 3D48R 5FR3A 5A3IC 3O8XC 4G42B 4LSTH 4M9PA 3L6FA 1J05A 1KYFA 4NBXB 5JNYA 1J48A 1IBHA 3LAFA 4YSPA 3QEGH 1MHPL 5F0LB 2DQJL 4G7RB 4TNWK 3ULVC 3UAFA 1U3HA 4GQ9H 1YEFH 4HK0A 4GBXC 4DP6X 3O3DA 4Y9BA 1OPGL 4UV4H 2GAZB 3P3TA 5I9QC 3VJ6B 5KS9B 3TEWA 3TN0C 3GHBL 5HVFB 4FQHB 1E50A 3OKNA 2BZCA 2X4NB 3QCVL 3VD7A 4EOWH 1S7TB 3AG3B 1AQHA 1AD9B 3FF8A 3NSXA 4WW2A 3UTQB 4D0CA 4D7BA 1UZGA 2Q87A 3QUXB 3I02A 4XMVA 1XMEB 4FYTA 3UBHA 1RZKC 4S0TD 1ZIBA 2ALWA 2X4RA 1IGFL 3KYNA 4MTMA 4OUUA 5DMJB 4HOXA 1NIBA 4ZNEE 4TKWA 1MZZA 2XA8L 4XNZB 4P57A 4MMZB 4OD2A 2PXYA 2NY4D 3VB9A 2R4SH 5LHDA 4HCRL 5DMGD 1QOKA 4TOYH 4TQ8A 1VGKB 5K9KB 1MH5B 1W0WB 4WWKA 2V17H 1I9JL 1CLVA 1E28A 3FU7B 4APXA 5AVTB 4HS8H 4R4BB 1JGUH 1X7QB 1A6AB 1WAAE 2WB1A 2EE3A 3IPEA 4JW3A 2YR3A 4XBMA 4HIEA 2MJWA 2NY7L 2AV1A 1OANA 2P48B 5HGHA 1LO5A 1OSEA 2H2SC 4WGKA 5HI5C 5DEJA 4X8CA 2EVIA 3QIUD 1CXKA 5HHPB 4U6XB 2AJSL 4K23H 4PJHA 1KBVA 4ZMYA 3MREB 4KVCH 4HUKB 5GQBA 1MVUB 1HH6A 3PPEA 5I5IA 4MQ7A 5CEYA 1H8NA 2B9AA 4QHLA 4PB0L 3P9MA 2JMRA 4M93C 2J1WA 5ANMA 3RQ3A 3KLDA 4JANB 4LLWB 5MENB 4ZFFB 1WTGT 2NXYC 2Y6SC 3HE6B 3MJ7B 5MERA 5I6XB 1MRFL 3QAQA 4U05A 1WWCA 2OZNA 3MBEB 2YUWA 1CMOA 4E2OA 3PABB 3QZMA 3ARZA 4JKPL 5DUPL 4PVNA 2C9VA 2XPZA 5IB3B 1DSFL 3V4PB 3BKJL 4QXTA 4IRZH 3SDCC 3EUDA 1E7UA 1G6VK 1OSYA 3FUNA 1LMKA 2E7LA 4ONGH 4H20H 5EC1A 4AVHA 3X17A 2WQRA 3LHPH 2WNXA 3BH9B 2DTMH 2XRAH 3ZZQA 4HD5A 4FA8A 1JVLA 4AIEA 4Y1AA 4X5WA 2V8MA 4ICWA 1WEJH 2CLVB 3MRCB 4N90D 1OGAA 4FQXC 4ZS6D 4HS6A 5J6HA 4MS6A 1QBAA 1K6QH 4B50A 1FNLA 4EPSA 2Y1ZA 3FSAA 3JWOH 2R39A 5FGSA 4EI5D 4JREC 3IDJB 2OMXA 1RK1A 2H32A 1KNOB 5IJCC 3FU9A 3FO2B 1XZ0A 2BCKA 3OWEA 4KTDL 2VSMB 1G7HA 3GSWB 2EEBA 2B1AH 5C0BB 2P5ED 4CU7A 2F5BL 3OJDB 4HIIB 3CFDB 4KJQD 2Y5QA 3FOMA 5AAWA 1LWHA 4XMZA 4E5XB 3FT3B 2XWTB 3QR1A 2WUCH 2O6CA 3SZKC 4WI3A 1IM9D 4XVJL 3IU3A 3ZRCC 2NTFA 4JFWA 1A7BA 4MNQD 1VLXA 4CRPA 2HMIC 3D6GA 3GKWL 2K70A 3TTYA 3TV3H 5IFHH 3ZX1A 2BJMH 2ZCKH 4PCTA 5EA0L 3SE9L 4B96A 1GGIL 1T04B 2ZKWA 3L2LA 6PAZA 2BNRD 3MRKA 3U1SH 5D96C 1T5XA 3EDEA 4DPRA 2YA0A 3BUYA 1UH2A 5K69A 2TRHA 4PRNA 3TO4A 1BGXH 1L9NA 4NZRL 4AIZB 2AERT 2PPAA 2VLME 3I2CL 4E9SA 1TNNA 4Y9FA 5SWZE 5ACZB 2J57A 2AITA 3NGBB 4ABWA 3JV4A 3BWUF 3UTZA 4F7MA 1UOLA 3CMOL 3DOHA 5FHAH 3L2MA 2BZ7A 1KBBA 3PNRB 1JYNA 1YNLL 5DZVA 1UTDA 3SGDI 1X9RA 5EU4B 1FVDB 1Z9PA 3QIBA 4X7TA 2J8UE 3EBGA 3HE7B 3PQYA 3SGEI 2VLJD 2VXQL 3ME0B 3B8YA 2OCCB 2GYSA 2E6QA 2WWMD 5D1ZB 4XWOD 1ZLEA 4TUKL 3KDMA 3MOAL 4F7PB 4UILH 5HGBB 4PH8A 1GJWA 3OJVC 1VPOH 3CE1A 1Q9WA 1Q1PA 4EE2A 4RWYL 2MNJB 3TA3B 4UM9B 1GTFA 2A6IA 4PG9B 4BQ9A 5HJ3B 2AK4A 2F74B 2X4PA 3U2SB 1JTOA 5J9PA 1AY1H 2FX8L 1G5AA 3L17A 4YFEA 3ESMA 2Z93B 2A6KB 2VQTA 2BW5A 4HKZA 3VXPB 1EEYA 3FRUA 2GT9A 2ZXWB 1MFVA 4X2UA 1I1AD 1PZDA 4HBQA 4QYOA 1M2OA 5FM4A 1AE6L 2E5EA 4KTEL 3BX7C 5DEGA 1NIAA 5KUKA 3EFDL 3IAGC 1HHJB 3VI4F 4WNSA 3QO0B 2EYRA 4XHJC 1IC7L 4Y2DD 4AKQA 4AMKL 3VFPA 3GS4A 3GJEB 2Q6WB 3EOBB 3L5IA 2B3RA 1BOGA 4JO4L 4IRSB 4NUJB 1DSYA 4J3XA 3UTTA 4CW1A 4Y5XB 4KKQA 5KJRH 4GRLA 4FAAB 2VAJA 3CTTA 3ML8A 2J71A 3AADB 4KDVA 2QKIA 3PWVA 4WTWA 1G1OA 3AU0A 5KG9B 1NGZB 4WTZG 2P24A 3WJLC 1RIUH 4ZOAA 4AENA 2NQCA 4I89A 4AL8H 3ZN6A 4PJ7A 2EXWD 1EH9A 4TM9A 3WLBA 1U8LB 3MYZA 3JTTB 4HWBA 4IJ3B 1X5YA 1CBVH 4TSCH 2OQJA 1IQDB 5DRZA 5LNDA 4WK2B 2NW3A 2Q3ZA 4L8SC 3HN3A 3P11H 4QTHB 2H0JA 3L4WA 5TDOB 4ES9A 4XVSL 2Y22A 5HVGB 5L2JA 3DJTA 5B39G 5D2LA 3QPQC 2RCSL 4HJJH 3HZVB 4EVNA 5IQNA 1HJBC 2FTAA 3KDPB 4BD4A 1MJ8H 2B08A 1FL6B 5T3XE 1RJCA 2VLRE 5G5DB 3Q5YA 3PWJB 5AOZA 4I1NB 4EN3A 3QS3A 5KVFL 3L5XH 3QQNA 1CE1H 1F5WA 4FTVA 1FZOB 5FDWA 1CFVH 3BAKA 4AGMA 2AVFA 5JHDD 1YYMH 4LOEA 3H9YA 5TE6L 1CLOL 5EV7A 1LP9A 2DI8A 3GMPA 3HS0A 3QUML 1MIMH 3A4DA 4HEME 3ZXAC 4IS6B 3WU1A 4P2RE 3KLSA 5IHHA 4N28A 5L6YL 2FO1A 2IAMB 5CSZB 1O9ZA 1WAEA 4HFWB 1NL0H 1F4XH 1QLRB 4F8NA 4PIRF 4XN5A 4AQEA 2R9HD 3OB0K 4K2UL 4KMTH 1GIGL 2IGFH 2JXMB 5DJAB 1Q8MA 4GRWB 1FG2B 2GK0A 1MCHA 1B2WL 3BKCL 4WEUD 4AQ1B 2R8SH 2ESVD 4X9YA 2ZUVA 2OL3H 2V7NB 5HHNB 1ZT4A 2AQ1A 4Y2LA 5CGYD 1URLA 1DBMH 2QPSA 4MYPA 5MP6L 3FUHA 1DQIA 2GCYB 2LU5A 2VH5L 3ZO9A 3CC5A 1F11B 3SSGA 3U4BH 2BP0A 4PU2A 1T1XB 4HJ1A 4GLRH 2F08A 1XCXA 2J88L 4PJCE 4U1IB 4QI3A 3WMSA 1M9SA 1NGYA 2J1ZA 4JM2C 2O5ZL 4DAGL 2WYZA 4QRPB 2E8YA 4NNXB 5LXVB 3TBWB 3M8OH 4I85A 3W9DB 4DZBA 3KLQA 1GGTA 3CXHJ 5IBLC 5K59F 3HRZC 2A9CA 2YGPA 4Z76B 1Y1UA 1A2YA 1ZT7B 5E70A 4LSVL 3MV7E 2CLRB 3BP6B 3LIZL 2R0WH 2OMYA 2NYYD 4FI8A 4HKXB 2WLLB 5JPMB 4IBWA 1L5GA 4OH2A 3BSZH 4HFUL 4TUJB 4CN1A 3STLA 3TEXA 1BQ5A 1EHLL 1IGYA 1HE8A 5BOJA 1ZSDA 1I85A 5DA0B 2WLKA 3LMJH 3LD8C 2WLIB 1NAKL 1QNZL 2GI0A 3GMOA 2X89D 4NNYA 2Y7OA 4JRXB 3SDDA 1N4XL 5GHWH 1ITCA 4ZQKA 4Y5VC 4G43A 4NGHL 3GMMB 3GB7A 4TQPA 2APWA 4APQA 3UP1A 3AGVA 2CAKA 4TYUA 1TTFA 1BX2B 4A63A 4PY7B 5CJOH 4XPTH 2X2JA 1HOEA 8FABB 5I1JL 4F3FA 1U33A 1BW8A 1A1NB 3QFDB 4U1MA 3PWNA 2X4SA 1HWWA 1NZRA 2CWRA 2EDMA 2EDTA 1AGEB 4KK5C 3QDGE 5JLZB 2EDNA 4N26A 2VLKE 4ZMVA 3O6KL 2BRRL 4NNPH 5F6HI 4CADB 3SDAD 2YA1A 2XG5B 5B7EA 2HRPH 1XIWB 2IEPA 3MJ9L 2VUOA 3FJTA 4G8GE 4XXDA 1H9DA 3QHTC 1K8DA 4QJ3B 1XF5B 1X5JA 2XHNA 4AGLA 3CPUA 3D0LA 4B97A 1NA8A 1KGYE 3VWKB 3RUGB 1KPVB 4V1DB 4ANXA 3M1CA 3V5DB 5KVEL 3H55A 2FBJH 1N7MH 1WBXB 3P69A 3T2LA 1D5BA 1T66D 4KTGA 3MJ6A 1FJ1B 2YMTA 2ZKYA 1MWAA 3BQUA 3SPHA 2ADFL 3WFBH 1GJIA 2J5LB 4B5EA 3LX9A 1W16A 4NRZA 5IM7A 2WQUA 4XP9H 1TTBA 1SMAA 2Y23A 4YSAA 3VE0A 1S9XB 1FYTB 1Z3GH 2VE6A 4Y5YA 2XTJD 1S5HB 1WT5C 3HZMB 4NQQA 2FGWH 1U92A 1SQ2N 2APXA 4ZFOL 4IRJA 2XETA 2CDGA 1WA2X 3FFCD 1SYSA 5FM8A 4NQVA 3AG4B 1CIDA 2UXTA 1XBRA 2P8MA 2OTUB 4LDOB 3GZKA 5TDNB 2JCCA 3SCMB 1BFSA 4QDGA 1EGJA 3NJFA 1DJYA 2XICA 5CFHA 2GABA 5KVGL 3V4VB 4D0DA 3ETBF 4KXZI 2VDPL 1A7QH 2X7LA 3UTSA 3K6FA 1QTSA 2EACA 1T5WB 2R0LH 1QX1A 2CUIA 4H88H 1DVFB 3H0TA 3HZ3A 3QZWG 4OCMC 3CVIH 4KZCA 1A6UH 4U33A 3ZL1A 3ZL4L 1CURA 3NJMA 4Q9RH 3P9LA 3V6ZB 2X53A 5HPOA 3TF4A 4K7PL 2OSXA 2QFRA 4FG6D 1H3WM 2NR6D 3ZZ1A 1HH9A 1I8LA 2LT9A 4NAMA 4ZMLA 1NMBL 1PFCA 3EH1A 5DUBA 3E2HB 3PHSA 2ZCHL 5HJBA 7PCYA 5KVEE 1NM4A 1U8IA 2N7SA 2E4FA 2NY0D 5EC2B 4OGXH 2QDWA 2OZ4L 4MVBC 2YGVA 3FQTA 1MDTA 4GRMB 5FKPB 4YO0A 4K8RH 3Q2CA 1GYUA 3X14B 1GY2A 1HK6A 5C0CA 1NGXB 4LHUG 3TCLA 5CUSL 4XXWC 4UIKL 3BVTA 4LCYB 3KH4A 3V0IA 5IHZB 1L7TL 4M03A 4N8CL 2EVFA 2QSCH 4LCWD 1RZGB 5E2UH 5CZRA 1WFTA 4OZFA 1V8HA 4Z7OE 1X5LA 4CVZB 3WDJA 3TA4D 4LHUD 3PJLA 3CDFA 5EOTA 3OXSB 2O61A 5E2WL 1F6AB 5AVVB 3O4OB 4FD0A 1ECZA 4J8RA 2IOMA 3VH8A 5EEVA 3U9PH 2EIBA 1HYSC 3OKMB 1AXSA 4H26B 1B2YA 1WAPA 5KVGE 4G1MB 5I6OA 1EVUA 4KBPA 1H0DB 2H1PL 3VXUA 3V79C 4OM0L 1JXDA 5E8PA 1IBDA 4BJLA 1NDMA 1THAA 1F90L 2P3YA 1EXGA 1YJDL 2Z7UA 3HA0A 2QADC 3ILPB 2YPVL 5LCVH 4RH4A 1XXFC 4U6YA 3WKML 4EXKA 1BYOA 4MDIB 1FFPB 1OD7A 1ZSHA 4TPRH 4YDVB 1JK9A 3BAWA 3O11B 2XPGA 3OLEA 4NHCL 4BSWA 2UUDK 2O6EA 4BGLA 5AVUB 3UYOD 2BS9A 3ZRSA 5HHQA 1F4HA 3D7PA 1KY6A 2W59A 1JV2A 4MNGA 3MRRA 5EIVA 4FDWA 5EO1B 5FO7B 1IGIL 3ULVF 2V3DA 4P5RA 1MFCL 2YIHA 4N6RA 5IVZA 1CF8L 3P73A 3QZNA 4XI5D 1FNSH 2WXQA 5J13C 4RBPH 1P1ZA 4FXKC 4HSAC 5I1CL 4DP5X 4I18B 3SD2A 2VDLB 5IMKB 3CFMA 5DJCB 5HSFA 2P5WB 3ARPA 4UUJB 1MHEA 4Y8DC 1AXTH 3PF2A 1N6UA 3D1MC 3PL6A 4HWZA 4WCYL 4NN6B 5TF1H 3OXRB 3K2UH 3BN9D 2AEPL 3IJYA 4YQXL 2WWKO 2YSSA 3DO7B 4R2GB 5KAQF 3EO9H 3RPIA 3T9WA 5LG6A 2WK2A 4X4XB 5GISL 1WIOA 2A4ZA 1G7MB 2OAAA 4XOAA 4NM4H 3MJWA 1XMWA 3VFOB 4B9GA 1L7IL 2PP7A 3NABH 5HGDA 3NZHL 4MCZA 4OLYL 3L3GB 4NN7B 1QR1B 3LCYA 1XB3A 2C1OA 5FW8A 5HTSA 4WF7A 4YUEH 3ARUA 1W8OA 3HVDA 5FF6A 3A6CH 3L7FA 4K3DH 4HG4K 1U3HD 4GXVH 3DSFH 5TH2A 3KYMA 5IVOA 2BSSB 4U4IA 2DYPB 3CXFA 4JFEE 4FFYL 3OZ9H 5ESQB 3C6LC 1R3IH 3HKFA 2Y24A 2IH3B 4XP4L 1C5CH 4P2OC 1BA9A 4U7KA 1JPFA 2IOIA 4DPCX 2VSCA 4YEEA 1BD2A 4JQVC 2R23B 5AUMA 4XVTL 4E41E 5AZUA 1J8HA 2X4TB 2PXYD 5GGQL 4BSVA 2FJHB 2J25A 4L1DA 3VM7A 3ZDXE 4XPAL 2W0FA 5FO9A 1MRCH 2DLFH 5LBSH 1EBPA 2EE2A 3IDGB 1OAZL 1OP9A 1VFAA 1U8HA 3KW7A 5K9OB 1KIPB 3IFLL 4ODTL 3MSPA 4BFGA 4JHAL 4O2CB 1SBSL 4WO4A 3WFCH 3NVQA 2C34A 2YQGA 5JDSB 3DRQA 1JZEA 2QLVB 4NHUB 4HV8A 4L4TB 2DQCL 1NLDH 2XQYK 4K94L 4KK8C 4JY6B 2C9QA 2HJKB 1H5BC 3O3EA 2EDBA 4PLKC 5C3IA 1Q94B 1RZ7H 4KNUA 1ZJBA 4GY4A 4XMLL 2C9SA 5ICYA 4HF5H 4IBZA 3CMGA 5JZ7D 4H0HB 5TQ0H 4NT6A 5TDPB 1OGTA 5GIRB 2F53E 3I6KB 3RPBA 4TVSa 1TQUA 3L4CA 5C0AE 1WVZA 2JH2A 5DDHB 5AWNH 4L23A 4PJGA 4IGBA 3WHE1 4LGPB 2JKLA 3IVKB 3C8HA 5CM1A 5FUCE 4JPVL 1Y18B 4XMWA 3MAWA 4GQPH 5I1LA 5E6IC 2HWZH 4YDIL 1BFVL 4YBQC 1O5PA 1JYWA 4ERSL 2EH8H 5FUZL 1TZIB 2CMRH 3B37A 3MODH 3D3VE 1RAMA 4LB8A 4C56A 1IL1A 1M05A 4L29A 1LE9B 1PLGH 1VERA 3DARA 1IKNA 1Z5HA 3OV6A 4FXGB 4K5OA 2AW2A 2Y9RT 4GAJL 1FDLL 5HYJA 3BAXA 4HH9B 3T08A 1FZKB 4I48B 4PS7A 4C47A 2VNCA 4P4RB 1TSHA 4PTUA 1NUNB 3VQMA 5KSUB 3EGSB 3RPKA 1N12A 4FNRA 1CL7L 1R33A 3NCEB 4PTTB 2YN3A 5CINH 4LU5H 2YC1A 1DN0B 1X9LA 4RSVA 4Y1AD 2CBPA 3BXNB 1OGAD 4CJ1A 1MN4A 2MTAA 3NBNA 3W5NA 4OCYL 4ZSOE 4UT9L 2KYIA 1FO0L 3Q01A 3M1BB 4UANA 5T1KB 2CGRH 1M3JA 2VM9A 2D7PA 4NKIH 1IAIM 1LO2H 3B9KC 1FAIL 4BUHA 3MHZA 4Z78B 2DAVA 2W60B 5AYTA 3MFFB 4NENA 4CNIA 3T6QC 4DUVA 3X12B 3AQZA 5D1XE 4JAMB 5BQ7B 2WIMA 4Z77B 4E68A 2LLLA 1NAML 1TFPA 3QIWC 4PV9B 4F9PA 4A2FA 4M7LL 4JK0D 5ICUA 1IAMA 2P8PB 5T1MB 4OAWB 2YZ8A 1BJ8A 4Q97A 3QWQB 1IKOP 2ADJA 3MGOB 1MI5B 1CT8A 1I8KB 1WFJA 3OL2A 1WA0X 3U30C 1LE5B 5I2IA 3QWOB 4K9EL 3C5ZA 3MDJA 4NWUH 4K7FA 5I0XA 3BMVA 1TVHA 4Z5RB 1NBZA 4S1RL 5F1IA 3ARBA 4PJAE 1FWXA 4WNQB 1PD0A 4Z7UF 4DESA 1QFOA 3HUJE 2DQDH 1T89C 1C7SA 3V7MA 4FQJL 1J8KA 4XTRC 3TO4D 5C70A 3P4LA 3MRJA 4WWID 3BE1L 3N40P 1OHZA 1DL7L 1S9YA 3RG1C 3G5VB 2WZ6A 2MCPH 5DK0B 4ZPTA 4Q9QL 4CJ0A 5CEZL 2NXZC 3NJKA 4B9CA 4QHMB 4HWEH 1N2RB 4L4VE 5AKRA 3SKJL 4YJZL 1UQSA 3NZUA 3QZPA 1WFNA 3BYYA 5FUCC 5IWLC 2NOYA 1JZ2A 1U58B 1ZE3H 4XP6L 1KEML 4ZO9A 3NCFB 2V6HA 2YD6A 3IJ9A 1HHGB 3A4FA 3NACH 3QIBD 2Q8BH 1OAJA 2B59B 4HQQH 3PQYD 1JGLH 4KXBA 1RJZA 3VNYA 2OK0H 1KXTB 4HJEA 1KXVA 2GSMB 5E2VH 5D1QB 1RPUA 4MB1A 15C8L 2KQMA 3BLKA 3BO8B 1XCQB 3AT0A 3CUPB 5E8EB 3SHSA 3UPCA 4AYFA 1FVCA 2QGEA 1JZ5A 3KPRB 2ARWA 2VL5A 3WD5H 4V2CB 1I7RB 4XWGL 5KYXA 4YDKL 4DHLA 3P0VH 3UX9B 1QSFB 1QPPA 4OGQC 3U2JA 4OLUH 2ZYRA 3FONB 4HXBH 4PWEA 2VDML 1IARB 3ROOA 2F19H 1AZUA 2F7PA 3O9WA 1FH2A 1DVSA 3PE9A 1J9RA 2KI6A 2AK4D 4JFDB 1P5UC 1ILUA 4G9DB 2P8LA 3IRZA 3S96A 1FHGA 3MBXL 2PR4H 2JIXA 3PHOB 4YE4L 3IU4L 4MXVE 2NSMA 4UT7L 1A3ZA 1YMMB 3QR0A 1IJ9A 1U8KA 2IVFC 3EOAB 1D6EA 4L8CB 1MRDH 1AQKH 3ENEA 1H3XA 5D1XC 5K1NA 1DQLH 1JZIA 5IIEA 3OAZH 4R3SA 4KVNH 2DBJA 4YK4B 1I8AA 5GS0H 1AIFB 1BVNT 3U36B 1TEFA 5T1DH 4JFTA 2AQQA 2OM5A 4XC3L 1YQ2A 3X1BA 2O72A 1ZGLP 1S46A 3PWLB 4KKLD 2F68X 3PUUA 2J8UF 3ARWA 1T83A 3AY2A 5C0FA 3VFTB 3SPJA 1QQDA 3EYOA 1NGQL 4GRLD 4WI0A 2IANA 3RNKB 3QJSB 3ZUNC 1KPUB 3DMMB 2DBLH 3SO3B 3C09C 2YLHA 4DVRL 1R75A 5HHME 2WQWA 5C08E 4P9HC 5EZOH 4JZOA 4X6DB 3EJQA 4N2DA 5CLTA 5CBEA 2KH2B 5C9KA 5F9WB 4KOCA 4Y4HC 3GMNB 5LB1A 3GIZH 4W81A 2ZSWA 2FWOA 2PCYA 5A2LH 5F88A 4IKJA 2EZ0D 2JJVA 4ENED 4ADGA 3MRBB 1U3NA 4N8VG 3UAJA 2XVLA 5J3HD 1WZ1L 4YX2H 3CK0H 2ZTBA 2ZIDA 2KZWA 4KI1A 1ZKAA 4EN3D 1FAKT 5C71A 3FO1A 1NBYA 2A5UA 3PXHA 4FTVD 4JMNA 4R7LA 5EBWA 5B1JC 4X6CB 3RA7H 2W0PA 4FX5A 4MA3A 4LKXA 3G6JA 1TOXA 4ALAH 2VN5A 1A7NH 2ZNXA 2UZYA 3DTDA 4LKCB 4BFEA 3RFZA 4OFDA 4W9CC 4HLJA 4UQ2A 3ASOB 3R4RA 2CD0A 2EC9U 4KJYB 5F1NA 3UXFA 1FNAA 4PJXA 4LLVA 2FUTA 3QYNA 2ICWB 2FEEL 1A9BB 2GTZB 5DD0L 4IBTA 4PWIA 3FU8A 3ROLB 5LQBL 3VSVA 3BPNC 3LRKA 1XDTT 3CHSA 5I1DA 1KTLA 3N0PB 2EECA 1A21A 1PJWA 1U9KA 2LHAA 4K9EC 4OI9A 2GBTA 3QWRA 5KOMC 2WLJA 3T1FA 1MCQA 1GCFA 2VDNH 4U6HB 4BRJA 5C0IA 4RAUA 1JAEA 2B20A 5TGBB 3IDXL 2AJYH 4MB5A 2B77A 2W9EH 2WMPB 1CPUA 2WO3B 2QBWA 1QNIA 2DQFA 5B1KA 5T3ZL 1VZGA 3VX0A 4A7UA 1UG9A 5SWQA 2APFA 1GY1A 4P23B 4U1NA 4JKWA 1XGTA 3GGWA 3FCTB 4KKNA 6FABH 1WLHA 4FMFA 4ZTPH 4MMYA 2YLKA 1H6TA 4NQDE 5J6GB 5J1AB 1VA9A 1HC1A 2XNAA 3WY4A 3F01A 3MLXH 1FH5L 3MQIA 1FHNA 2A2QT 2XVKA 4BZ1H 2ZZUT 3FRPA 1Z9NA 5DC2A 3W9EB 5BRZB 2G3MA 1H8OA 4NBYB 2F7IA 5CD5D 1J8RA 1QEWB 2BSTB 1YG9A 1E9OB 5C6WH 2J1YA 4XNMB 4R84A 4ZW3A 1IM3A 4YXKL 2YD5A 1L0YA 3KNBB 4KDTC 3L7EA 3VXME 3WTUA 4OLVL 5DJ0A 5AW9B 3T8XA 3UBXB 3VRLE 5LAXB 3IDYB 5D6DC 2CO2A 5HI3D 3K1KC 4IIZA 1F4YL 1QRNE 1K5NB 3EGXA 5F7DB 2H7WA 3ZHFA 3SDDD 5CWSB 1S3RA 1WBZB 2A74C 2E86A 3DK0A 4TUOB 4W9LC 2C4XA 1VACA 5AB0A 2WANA 1SXNA 3O2WH 3BSHA 4OZGF 1I1RA 3W81A 1I1YA 4APQD 3M07A 1D5IH 4S1SH 4WNJA 1G9NL 3BP5A 4ZUWA 2K78A 3K6OA 4TTDC 2YARA 3TBSA 2GPZA 4P2AA 1N64L 3PLYA 4HLZG 5D70L 3V4PL 5G4MA 2J3SA 4W4OC 4PJCF 4XP1H 4LVNB 2LQRA 3ATAA 4LLMB 3BWAA 2HFFA 3T8MA 5BO1L 5AG9A 4RX4A 5C0NC 1SJXA 2DD8H 3GLDA 2MNUA 5T3ZE 1HXMB 2CJUL 2DQGH 3GKZA 3HI6L 1U91B 5DQDL 1RPQA 1X44A 3BZ5A 2YKLL 3MOQA 1NCOA 5AQ0A 3PP3K 3S8FB 5E9AA 4JRFA 3G5WA 1NCAL 5JW4M 3FAWA 1R5IA 4U1HA 5IVNA 3HG0A 4WUUA 4EKJA 3UAAA 1I31A 1GPOL 4ZFGH 4NO0A 2ZX7A 5H37A 3VMPA 1T3FB 3ARQA 4U1JA 3BQUD 3I9GH 1QWUA 3MNVB 4OFKA 1M2VA 4FRWA 4X9BA 2DMCA 5EZJB 4JG0L 4FP8H 4W9DC 4BFIB 4PJ9B 1TJIL 1E4KA 4HSCX 4HC1A 3ISRA 4QRRB 2NUTA 4JQIL 3MLTB 4MQXC 4LSRH 3DNKA 4MXQC 4S2SB 2DLTA 4IRJD 2LAAA 5LNGA 2UV3A 1R5VB 5B7FA 4P46B 4H4NA 4DW2H 4JHZA 4ES8A 5MENE 2AXWA 4NZTH 1CL7I 5ID0B 1AR1D 2O5XH 4UIMB 4U1LA 4G80A 3QRFM 4WFHD 5I26A 3ZT6A 4OCXH 1A3LL 3TT3H 4QRQB 1M7UA 3AT8A 5CJ5A 3H2QA 3KPQB 4FHJA 2VXTH 1UCBL 4Q89A 2YEZB 3ULSB 4LQFL 3DYOA 3INUL 5ELIA 1YEWA 5F7WC 3RZCC 1IC5H 3UTSD 3JWNG 3EW3B 4JDTH 3EYVB 4JMXA 3QUKB 4ABUA 4P2QA 4DGIH 4KKBD 4PRHA 1P7HL 5D7JC 4GKSA 4LCCB 5HGAA 3ULUD 3MRGB 3I9AA 2OMZA 2V5RA 3IF1A 1HYRC 1O6TA 2XX0A 4I1RA 2ZOWA 4H44C 4URKA 1G94A 1FNGB 4HJGB 7TAAA 4OD1L 1O6SB 4O5LH 1ZDQA 3B1TA 1ZTXL 4JR9H 5FFOA 3VD2A 4HGWA 5KSBB 2L3BA 1KLUB 1RJLA 1FC2D 4M4RA 5GRVL 2VJXA 3SYPA 5DJDB 3B43A 2ZP0T 1AIZA 1TJHL 3TESA 2VSDA 2Z31B 4KY1H 1R24A 5CGBA 1Q72L 3GF8A 3SDCA 3WL9A 3CSBA 5GS2H 4DKFL 4WQOA 2QQKL 3GQFA 3TPUA 4IQHA 4AW7A 2CIKA 3W2DL 1VEMA 1VHPA 4OZFG 3TBCA 1T2JA 4FFVD 5L0QB 3GM8A 1LDPL 4BFBD 2OSLA 3AUVA 5C0CD 2D73A 1NCBL 3NOIA 1XL6A 3F62A 4MMZC 3STZA 3IBEA 3VH8G 2CJ3A 1DR9A 2KQNA 2UZXA 4WHTB 3W56A 2XWJA 1IE5A 4FQXA 2WD0A 1GOHA 1L3WA 1M7DB 5TE7H 3ZYOA 4G71B 2Q3AA 1ORSB 1SVBA 4MZIA 4XO3A 5FFGA 1LQBC 35C8H 4HJSA 1GS7A 3H6JA 2ZOKA 3GC3A 4M62H 3OKDB 1SOSA 2MTEA 2D7TL 2ATKB 1OAXH 3FQXA 1BF8A 2ZUUA 3B8SA 4KUCD 3MMEA 2J4WH 3BUIA 2MFNA 2BVOB 4O58H 4DQAA 5LUMA 4Q6IA 5C1MB 4ZNEA 3QEHA 2EYSB 4X98B 4BHUA 3BT2H 2NY3C 3VXUD 43C9B 3MRMA 4ZZKA 1IU1A 2OCFD 2Y07H 3BUDA 1NCCH 2Y4SA 1RP8A 5DHEA 1T6VN 3VXRE 2NNAB 3HR5B 1CTOA 1T2QH 4YDLB 4R7DB 5HBBA 4A66A 1EAJA 1LK3H 2R29L 3KXFB 2L0DA 4FJYA 3HC3L 4QRTB 4F33B 1DUZB 2NY6D 1I8IA 1XH2A 1ZTXE 2Z4QB 3LKSB 3O3BB 4UT6H 5EU6B 5BCAA 1NJ9B 3LNGA 5IFAL 2H8PB 1WFIA 3BC9A 3MCG1 1KN2H 3V8OA 1Q9KA 5CHNB 1ZA6B 3MBEC 1G9NC 4KTYA 3UG3A 1RZPA 4LNRB 3VX1A 3IJSB 5FCUH 3FQRB 5EBMA 4LARL 1RK0A 1I7TB 2BVEA 4IMKC 1XF3A 2KKQA 2DL9A 1CFSB 3D2UA 3T8VA 3LS5H 1YMHA 1FIGL 1MJJB 5D5MB 5IESL 4C83B 1J11A 3WNMA 4QMEA 3PL6D 5H35A 2ZUXA 4X0KA 4LLDA 2AXGA 2RFXB 4GSUA 4TSBH 2FSEB 4ONFH 1JWUA 4YDZA 2B39A 1MFAL 3A5VA 4B9KC 1HFUA 2A1WH 1TCRA 4KZDH 1HI6B 1MLBA 3CSFA 3DUUA 4KQ3L 2F58L 4JFSA 2GKIA 5DHYB 1MFDH 2BNQA 1PU0A 1W72H 2QSVA 4XODA 4OIFA 3SQOL 4N2LA 1OAQL 3G9AB 4KDWA 4NBZB 5ISZB 2DIAA 3S4SA 5FK9A 2HJFA 3WEXA 1P7QA 4TSAH 4X6BB 2OP4L 3VM5A 1JZFA 1FRGH 3GUTB 4NXKA 3RIFF 3U6XS 3F5WA 1FYHB 2IALB 1MFBL 2DH2A 5JW4Q 2ZP8A 2LU7A 4DP9X 4Y8AA 3QA3A 4YPGB 4YFDB 2GIYA 1ZA3A 1BPVA 1BZ8A 1EHAA 3SPVA 1RIHL 2G60L 4OKDA 5EOQL 9CGTA 2VKXA 2GJZA 4HSQA 1CE6B 4KKAC 1WC7A 1J1PL 2V2WA 1BD2D 1FORL 2UWEB 4OIIL 3WS3B 1W80A 1PNCA 4L1SA 5DGQA 4JB9H 5ECGA 4ZXBC 2PNDA 1BAGA 1J8HD 4I2XA 3WIHH 1HIMH 2ZKMX 2A7BA 2IPUK 3X1EA 3R0MA 4OLWL 1E9QA 3IDIB 1NSNH 3DTXB 3FXIC 2PPFA 3SY0B 3QEGL 4WO4D 4FL4B 5GSRB 3MLSL 4QOKA 1YSOA 2HZHA 1YEFL 4GQ9L 3SYQA 3EJUA 1ZHBB 4OQTL 4UV4L 3C9NA 5K9QG 3RVWD 3V6FA 4P3CH 2UZPA 4M7JH 4G6KH 2J2ZA 1BIIB 3QSKB 5TJWK 2DQMA 3VAEA 3ARFC 5IY5B 1FFNB 2FEEI 1FFRA 1XF1A 4YHIA 1UURA 4WEMB 3WJLA 1R9FA 4DQOH 1ETA1 3LN5A 2HVJA 3PREA 2PW2A 4HXAL 5KYYB 3HE7C 4ISVB 2BSRB 4NO5B 3QXDB 1GC1C 2PR9A 4FQPA 4L3EA 4LCIH 1L6ZA 4R4ND 1U8OA 1G6RH 3WSQL 2IWGA 1HEJC 4FXLA 4IGBD 3KPSB 3K4DA 3D85A 5SWZA 1DVZA 2KDGA 4L8SA 3BKML 4LSQH 5F93C 5D1ZC 2R4SL 3VD9A 3Q6FB 5AZ2H 3N6YA 3EG9A 1RMFH 1VCAA 2VDOB 3ZKND 3WE1A 1TZOA 1TNMA 4F1SA 4LSUH 4W4NA 5LO7A 4GSXA 4X7SH 5TFSH 5HYSA 4HS8L 4C56D 3TA3C 3MA7B 1MY7A 2Q20A 4EMZA 5E4EB 3WCYA 5CCKL 4O02A 2O26U 1QFUH 3PXLA 5HYJD 4GRWE 1XGUB 3GJFH 3LEYH 2EDOA 3KJ4B 4TF4A 3H53A 4AMXA 5IW1A 4PCYA 4KVCL 4JKKA 2OXGB 3TT1H 1QBML 2OXHB 1T03H 5E6RB 1D6VH 2C7UA 3QWNA 4GP8B 4J3OC 5FYJD 3O2VH 1AHWC 1QMUA 3FDWA 1QSEB 4L48A 2WVTA 1MELA 2CE6A 2QGDA 2ZOTA 1MCNA 3GT6A 1CWVA 3VXQB 5JDJA 1OTUD 1H3VA 3RVTC 1DHKA 2AMGA 2GUOB 4Y5XC 3OMAB 3NQKA 1YN6A 4OZHB 5E6SB 3WV0A 3DV6A 2DJSA 3SOBH 2DKMA 1OAYH 3U0TA 3VD5A 3E6HA 1YLBB 2K8MA 4IRZL 3Q1SH 1E2VA 4ONGL 4JDVA 5JQIB 4GMSL 2J20A 3MV9A 3IYLW 4NXSA 5ICZA 3LHPL 4JM2A 1NFKA 5DC4B 3F7YB 2N1KA 1XGRA 1SJEA 5IJVB 2DTML 1HHKB 2MCMA 2NY4B 3CHOA 1QPKA 3OKEB 1XTLA 3HRZA 2BIOA 3C5ZD 3S3CB 3CDZB 4L9LC 3QCTH 4I4WA 1R3HB 3HMXA 4R5XA 4D2NA 2YEQA 4F2EA 3NJLA 3N44F 3V4VL 4OB5L 3VFRB 3CDGA 3FT4B 3QZLA 4XPFH 4R90L 1FVEA 4M7KL 3VI3A 1KGWA 3ALPA 1CGYA 3KLLA 2VRAA 5C0RH 5L8JB 3L4VA 3RVVD 3X13A 4UQ3A 4XE0A 3QIUB 3NSJA 5B3JE 1KJVA 4NQEA 4JFFA 1UM4H 2CBQA 3LDBC 5BRQA 1JVOA 4ORGA 4R6UA 3D4YA 4R26H 3R1GL 5CILL 4Z7VB 3TC9A 4DN4H 8CGTA 1XGYH 4ZW6A 2XKSA 3BGMB 4RIRA 3NRFA 2D8KA 5PCYA 3OAUL 2R59A 4B0MM 3RUGE 4V1DE 4Z7NB 2RHEA 3WGUB 1B3JA 2CCVA 4NQSA 1UWEL 2XWBA 4Z9KB 2ZCKL 5D7LE 3VGHA 1KYDA 4NUQA 3KGRA 1PZ5A 2HT3D 2D31A 2A77H 5HD8C 2K4AA 1PZCA 1FCCA 1BGXL 4N8UA 2AGJH 4P2RA 1JL8A 5DMKA 3OKLB 5T5FH 3TH4T 4J5VA 1L9PA 1CLCA 3NFNA 3FN0H 1FYTE 3AWGA 3O9WD 5JQ6H 4PJAF 3OTTA 3BPOC 4MRBA 2F9BT 2IXQB 4MD5B 3IBOA 5EUKB 1FNHA 5EIQA 1L4IA 2EH7H 2WY3B 2XQYA 1PX4A 2JIXD 1KWKA 4E9LA 1MEXH 1H19A 3AREB 5FHAL 4B27A 2EDXA 2MKLC 4ODXB 4GIAA 5MEOA 1LL1A 1RY7B 5F7FA 4ONHB 1JOIA 5GSVB 3QH3B 4BHUI 5IEHB 4WK4B 4EI5B 2QQNH 1MCEA 1UA3A 3RTQC 3O45A 3RU8H 5JPMC 1ZY9A 2H4EA 2X6CA 2XIBA 2W80C 2N7BA 1NEUA 3F7KA 4HZLB 5DSCA 4LRNL 3UC0L 4CMMB 1T2XA 4GUOA 2BVPB 4P59H 4LEOA 1L6XA 1WCQA 3VVVA 3GSVB 4B60A 1WT5A 4K9JA 1PJ9A 1DQJB 1IAKA 4GI9A 1DJHA 2P5EB 3MPCA 4UILL 4B9PA 3IJEB 1OQOA 5CIPA 1C08A 1ETZA 2VITA 5MI0B 3MLUL 4I5BB 2NQDA 4IDJH 3P9WB 3VFWA 5CJXA 2IAND 1RULH 4H13C 4PRBB 1AKJA 3BVUA 1UD8A 2G4GA 5BZXA 4F20A 3MV7A 3JV0A 3LZQA 3U6RA 1KG0B 2HXAA 3UCRA 1IM9B 4M00A 2VN4A 5E24E 3VW3L 2EDLA 5GZOC 1AZRA 3SGDH 3AW5A 1AGFB 5FOBA 1E42A 4MNQB 1GGYA 1HTYA 2WIIA 3QXTA 2I85A 3DURA 3BIBX 2CIIB 4XMKL 3HTLX 3SGEH 5JOPE 4DK3A 3CZLA 4AQZA 2VDLL 3B83A 3FT9A 2BNRB 4WJG3 2ZYIA 4ZTOL 4OGYL 4EZKA 3VU1A 3QPXL 3ZHLA 4PP1C 5TQ2H 1D5MA 3G5YB 3EXLA 1MCIA 4BXVA 4RAVA 3AAZB 3UAJD 3OLDA 5AW0B 4XNXH 1FL5A 1YVLA 3VMOA 4LAQL 3HNTH 3DOSA 5JW5A 3VWKC 4JDEA 5KJRL 3SN6N 4G8EA 4GI6A 3WEOA 1MFMA 4YSEA 2G2RA 5D93C 2Z35A 1BFOA 1PQZA 4N85A 1D5RA 4ODUB 3QYCA 2VXVH 3DX2A 3QAZC 4YNYA 1PKQA 2HH0L 5C8JB 1F42A 2XZCL 4M8UA 4AL8L 3C6SB 2VLKA 5LGJA 1DZ0A 2D9QB 3OKYA 1J0JA 2OMUB 3P3YA 3A23A 3N5AA 1TTRA 4TSCL 3EO0A 5F9AC 3TVMB 2A6DB 4ZMOA 1CBVL 1SYVB 1CLZH 3AT9A 1YC7A 1RUQL 3BESR 3KLKA 4P06A 2D3JA 1NFIB 4G3YL 2CR3A 3BLBA 3L5JA 4RSYA 2WP3T 3FU6A 4HJJL 1BZEA 1P7KB 1OGPA 4MGXA 5B38G 1S7SB 3TYFB 4UQ9A 3QWRD 3QQ4B 2CZNA 4DH2B 3SCMC 1U8CB 1YEGH 3VRIB 4PGBB 3U0WH 1JHTA 3GDCA 2NZ1A 3NAAL 3JWOC 3LIZA 4ZJ9A 1W72B 5AL8A 4PCSA 5F2FA 4KK6C 5IVXB 3L5XL 1CE1L 2ZWNA 4M6OH 4MXWH 4HLEA 5E23A 3AZUA 2P7TA 4BH8B 1T4KB 1TYRA 3ETBJ 4ZFZA 5IMLA 1U8NA 1A25A 4HKJA 4I3RH 2X5PA 1DVFC 1YNTA 2MPVA 5IROC 1I1AB 2HJLB 1CI3M 1JN6A 5SWSB 2P5WE 1ADWA 1YN7A 3QUYC 4TNGA 5GJSL 3TNMB 1E65A 1F4XL 2MNWA 3QEUA 3UH8A 3NFPA 1JHLL 4AYBA 2OMBA 3L1OL 3X3GL 2NY1D 1CD1B 1UB6B 4XO9A 4Y2DB 3R7QA 5JW3L 4FTDA 2B4CL 3P02A 4PJDF 4KXAA 5C0DB 1IM3D 3D39A 1DFXA 3E6FB 2J6WA 1FZJB 4C8XA 1T20B 3QVAA 3E2HC 1K8IA 3MNZB 3IFNH 2V2XA 1KB5A 3SJVA 3UJIL 4CDHA 1DBML 4UU9A 4WV1A 2ARJA 3QQ3A 1BHGA 4R97B 3IKKA 2IDFA 4L3CA 3U4BL 4OZ4A 4ZMNA 4MASA 3VGGA 3BJLA 1JG9A 3PNWA 5TTRA 4WGWB 2ZX6A 3LY6A 3VXOA 4ESKA 4KITB 5FW7A 2I26N 4JO5A 5INCB 3PP4L 3A47A 1LO0H 3NJJA 2C26A 1A4JA 4QXGH 5E1HB 3RWCB 5IOPB 4OI8A 1B0GA 3FHQA 1AR2A 4DZ8A 2R0WL 4AQAA 1NPNA 2X38A 2Q5BA 4PLJD 3O4OC 4MB4A 4F15B 4R0LB 5A3ID 1OTSC 3GMRA 4FG2A 2FVNA 5JW4N 4M8RA 4PUBH 3BSZL 1ACXA 3CFIC 4RX4D 3PAZA 3QG7H 2ZUQB 1VAHA 3Q43A 5FYKD 2ZT9C 1ZHNB 4N0FB 4JGMA 4URTB 5JHDB 2VDRH 3K0WA 1E27A 2V37A 5BUAA 3C6LA 1VFUA 4IMLA 1BZ9B 1U4FA 1Z5LA 3QC6X 4FLRA 4D8PA 5KAQG 2XVBA 4OD3H 3RHWF 1ZEAL 5GHWL 3T0VA 5E00A 3OQRA 1LJMA 4WUUD 1JTTA 1XH3A 3QNYB 4KK9C 3T6ZA 1PIFA 1AH1A 3EDFA 2OX5B 4NO0D 5IR1A 2HFGH 3QE5A 1AZVA 4L4TE 1ZVSB 2DQJH 4JQVA 1NICA 4FMKA 3RVUC 1E9PB 1B9KA 1OPGH 5DJ2A 4XPTL 1YUKB 1I7ZB 3GHBH 4X8JA 3GJFB 1A1MA 2ESVB 3QCVH 4OV6F 5DMYA 2XDHA 3CD4A 5KS9F 3QHFL 1YEDB 4I18C 1HXYB 4JFQB 3S36X 1PNDA 2RGSA 3K7UA 3L3KA 5BZWA 5AAMA 5DRXB 1QI5A 3OMNB 2EUZA 1EAPB 3MXVH 4DGYL 5I16A 2P52A 3FSVA 5HI5D 4HCRH 1H5BA 3CSPA 4NUGL 5T1JA 3F85A 3FB7A 4R2GC 5F7BA 1HZHL 4RRPM 3TJHC 4FQQB 1I8MA 1DE4A 3SBWC 3FYIB 4P2QD 4PRHD 2R2HB 1I9JH 5GPRA 3MR9A 3DVGA 1EJ6A 1G1KA 4CVXB 4BA8A 2BM3A 4NN7C 2HB0A 2NY7H 1A5FL 4NM8L 5AOLA 5EWIL 4EDXB 5ENWB 1TVBB 2NXYD 4AL8C 1FLTX 4GIPD 1EUUA 3LKPA 2H1LM 4KKRA 2WQAA 4P49A 2ARJQ 2AJSH 1HHHB 5JHBA 3GSNB 2AANA 5HYQA 4BZ2A 2NNRA 3QISA 4NQCE 3UJJL 1IVTA 4DK6A 4ACPA 1N3NA 3Q8AA 1QBLH 1PFOA 1IRAY 1ZPUA 4B3VA 2R1WA 2D7NA 3RWDB 3SDCD 2V33A 3TBVB 4Z7QB 5DQJB 4GG6E 5E6ZA 2HTLC 1NCHA 3GWJA 3V5HB 4M9OA 4UOQA 3SPGA 4B6ZA 3TONA 4MZRA 2IH8A 3K2MC 1NEZB 4X9IA 3SKMB 2Q10A 2J21A 1OOWA 5HHOA 3RWIB 4ICXA 5DI8A 1MRFH 2YQBA 2ETWA 1IFHL 4MA1B 3NN8B 5E6YA 3Q2LA 2I27N 1UXWA 3WDHA 2WQVA 3GI8H 4UOJA 2PPCA 3W37A 2E59A 1KTDB 1W0VB 3MOBL 4FQXD 5CP7A 1DQDH 4UTBA 2QVTA 1G7JB 3QORA 2FJSA 3WLWC 4JFYB 5ESVB 3BKJH 4JFEA 4X99B 4ADIA 3GIVB 4X6EB 1WV7T 2D0FA 3SDAB 1X5HA 3FT2B 4PJIB 4R96A 2YK1H 2UX7A 2M2DA 3B9KA 3SKOA 1WH0A 3U0PB 2EDKA 1TEYA 3ZHKA 4C59B 2B5IB 2F6AA 4OF3A 2SODB 3C6EA 2C9AA 1OAUL 1UOWA 3QFJA 4GAGL 5IQ9B 2X2IA 1HQRB 2BY1A 4G9FA 4HX1B 4E41A 2NSQA 1EO5A 3IS1X 4WFEE 3QIWA 2GUYA 1HOCA 1KELH 1OCOB 4KXZH 1JHKL 1XB8A 1N0LA 4RRPA 1JPSH 4PIBA 3TWCH 4PSPA 2BHYA 2DN7A 4TS6A 4WJ5B 4DK5A 1U36A 3DHPA 1ZLSL 2SEBA 3IDMA 3F7QA 1CG9B 3U9UA 1YUHB 43CAA 3WUWG 5I1AA 2PMZA 2HMID 3V5KA 1V3LA 3LXAA 2F5BH 3NCYS 2KDYA 1I1FB 4GFXA 4HHGA 1FFOA 2XTJB 4TNVF 3PGCB 2B1OA 4EQ3A 4GKLA 1OD9A 3BHBB 3WO4C 3MLZL 1T89A 4V2BA 1FGNH 4H25A 3LQMA 3MRFB 5L4MA 2E7CA 1VFBA 4I0PC 3SE8H 2K8QA 3MRQB 4OKVB 3KWXA 2DJUA 5D1QE 5DC9B 3D2UD 2AABH 4NWTL 2AI0L 1DBKL 2WC7A 5C0AA 1U8QB 3KPRE 3GKWH 1SGKA 4UMGA 3U2IA 1AQDB 1XHHA 1QSFE 2Q2LA 5D2NB 4NN5C 3ZTJH 3LRSA 3DJRA 4MJIA 2CUAA 1HCFX 5CN3A 3QQ9C 4F93B 1K2DB 2VMCA 3FUEA 4JE0A 4J4PC 4ABQA 4XVUC 1EX0A 3R4DA 4NZRH 5HDQH 4KQ4H 3TTSA 2GQHA 3SIKA 4JFDE 2BNQD 2IPKA 3I2CH 4ELKA 1GHFH 3DETD 1DFBH 5I8OH 1P7QD 5ERWA 1OCRB 5I71B 4U3CA 4EUPB 3QZWB 4IIQB 2VGLM 2BWQA 1KBKA 2FWLB 1SBBA 3B2VH 3IKCB 4POZD 2ICEB 1AOHA 5I28A 5A40E 5DYOB 5IV2A 4L1BA 2ADIB 1WD8A 2J8HA 1XVSA 4HU8A 1C5DA 1WIPA 1YNLH 5EO0A 2X40A 1MQKL 1CFNB 3GUFA 1F3JA 2NY0B 2XXCB 4Y1TA 3WFDL 1CLYH 3H7BB 4FXTA 4D9LH 4F2MB 5DZ9A 4ZUUA 1B6DA 3ZPDA 5GZNC 1JNHB 1AXTL 3UBFA 2VXQH 1P5UA 2WXHA 4UOW1 3HZYB 5TF1L 3UPAA 4A67A 3NH7L 2ZNWA 3EHBC 1PX3A 2A38A 1K72A 4JQXC 3THML 4TUKH 3V9FA 2AVGA 4LCWB 2EE0A 4FYQA 3EO9L 2FIKA 4J23A 5EUOA 1KPRA 2W0LA 1JIBA 1AJ7L 2IOOA 2WCSA 5D1XA 3KGUA 3NABL 3ORJA 4X6DE 3OVUB 4KAQH 1PLAA 1CVRA 2DMGA 1T1YA 2H45A 3VWJC 5ESAB 1KOAA 2Y3AA 4XHJD 3AJ7A 2C3XA 1XR9B 2FX8H 4HUWB 5GRUL 1E5ZA 2HKHL 3L95A 1ZLVK 3MRHA 4A7GF 2J1KA 2A0LC 2WXNA 4QOKD 1IIKA 3K4ZA 3P1VA 4K3DL 4GXVL 4NKOB 4XO4A 3BGFB 5GGTA 2ALAA 3VCLA 1TF4A 5HY9A 2I9LA 1R3KA 2J72A 2ZXGA 4PJFB 2JK5B 4PHZA 3IMUA 2OJEA 3GMQB 4AY0A 1C5CL 3EFDH 1MZYA 3GMLB 4R7NB 1I3GH 3HUJA 1IC7H 1N59A 1TJGL 3UL4A 2OMVA 4I77L 2HT2C 2OFQA 1P4IL 3P0YL 5EFIB 3FBQA 4M8QB 2V2TB 1T22B 4L3ED 4X6CE 5HYSG 4YWGL 2WBWB 1F97A 2VLMD 4JO4H 4PWFA 3D85D 3GSUB 5SWZD 1CXIA 4Y4HA 2GHWB 4TLKA 3QP3A 3Q2WA 2JNKA 1MRCL 1CFMA 1JF1B 5J8OA 2IQAB 3QPQD 2VISA 4PJ8C 4YDNA 1USQA 4K5MA 3WFCL 3S3JA 2BOCA 4N5EC 1KFAL 3ES6A 1Y1DA 1F3RB 1U2CA 1G7LB 1KBPA 3HJ0A 3MRDA 5EEYA 1ERNA 3RNQA 2VR3A 5B1JA 1XGQA 3BP4B 5FFLA 5L8LB 4XVSH 3LZRA 2VSKB 4BM7A 4HF5L 1KTKE 2MHAA 2W9DL 2Q7YB 3S5LA 1FN4A 5TQ0L 1INEH 2MOQA 3Q1EA 4PWKA 4BKLA 3S2AA 2G2PA 3NT0A 2IGTA 1H15A 4IBLT 2D03L 4YK4C 1H6EA 1WJ3A 2XBZA 1BPLB 1NMAL 3L1EA 3RB5A 2FJFA 3L6FB 3L9EA 3WEBA 1J05B 5KVFH 4K8RC 5DHVA 3S7GA 3MNWA 4CU6A 1PCSA 2OV0A 3D25B 3U83A 4WU5A 4HK0B 5TE6H 3RWEA 4DSYA 2CNYA 1CLOH 2WTRA 3O3DB 4B53A 3QUMH 2EH8L 3AXIA 1D7BA 2CMRL 5BRZE 1YYLL 2RMNA 4JLRA 4HUNB 5L6YH 4Z0XA 3OKNB 5DJXA 4PP2A 5IM7B 1ZV9A 4HIJA 1MCLA 4D0CB 4WW2B 3ABMB 3DMMC 4L1HA 4XAKE 2WLZA 2XI9A 4KY2A 4YFLI 3I02B 4DP8X 3MV9D 1BVKB 3I50H 2X4RB 2ITDA 3KYNB 4JM2D 5E8DL 4OUUB 3U48A 1M6UA 4JKNA 2Z91A 4JFXB 4P57B 1B2WH 3BKCH 4OD2B 5D7SH 2PXYB 4LU5L 3RL2A 3ILQC 2WKLA 5IBLD 1J1XL 1D3CA 5MP6H 3SGJC 3ARDC 4GRWF 1M7IA 4E9RA 3OZKA 3QJTB 5GRZA 3TNNB 5CSBA 3ALWA 4WWKB 1ZS8A 1OT2A 5AZEL 4APXB 2BXYA 1SY6A 2RB8A 4M1CC 4W9EC 4B7LA 4HIEB 4KDTA 5C08A 4PBXA 1HINH 1C12A 4IHOA 4RFNB 5HGHB 2YAEA 4MKTA 5ADOL 2YBGA 3ZSSA 5D6DA 2OYKA 3SQBA 4CSPA 4GSQA 5DU7A 1QABA 4NQED 4PJHB 3PG2A 4JFFD 4N0UE 2A74A 4FN0A 4LSVH 2FATH 1NBVL 1HH6B 3ILDA 1DQQA 4MQ7B 1MW2A 4NO2A 5CEYB 2DM4A 4JGJA 4KX7A 1TQVA 5BW7C 2E27H 3KL3A 4QHLB 2BW4A 4HFUH 1KJ2A 5T3XD 1KY7A 3ABGA 4NI6A 5ANMB 4UF7C 3TL5A 1EHLH 5FGCB 1QAWA 4AH2A 3HOGA 5DJYB 2W92A 4NWUL 1ZAGA 3KWWA 2KERA 5MERB 2W5PA 1NAKH 2Z4TA 4D94A 1QNZH 2EVGA 5T33L 2OZNB 2PWHA 4QGYA 3SD5A 2DQDL 3EOTL 1BZQK 5C0GA 2XQYG 3CVHA 4EZJA 4NGHH 4ELMA 3K5SA 4P2RD 4QXTB 1TZ8A 5F96L 4LL1A 1SDAB 5FLVA 4XZUA 4CMHB 1IVLA 1OGSA 3O4LA 4YE0A 5TPWL 2MCPL 2ISDA 3I3EA 2H5UA 5EC1B 3PGDA 3UGUA 4QTIL 4HWEL 4NZJA 5I1JH 1ZV2A 4PSRA 3FUDA 1TXKA 3ZYJA 4D9RE 4NSKA 3VYPA 3K6SA 2EADA 4N0CC 1IKFH 4HW6A 3VMNA 5IHBA 4Y1AB 4X5WB 1LILA 4PREA 1OGAB 2BRRH 2ATPA 3O6KH 4HS6B 5J6HB 4LEXL 2C5DC 4WKZA 3AY4C 5IW6A 4FFWC 2Q8BL 2HSIA 3M17A 3O2DL 1X5MA 3MJ9H 4YHML 2OK0L 2OMXB 3DOIA 1RK1B 3F6JA 1E90A 2H32B 3BIKA 2Y69B 1Z32X 4J8QA 5E2VL 1ONQA 4PJEE 1SLXA 1XZ0B 2BCKB 3J27A 4UAHA 2KMWA 5KVEH 5CZXC 4LF3A 3MNMA 1G7HB 2CKBA 3WAKA 1OF2A 1RXLA 3G5XA 3IDYC 2Y7NA 4OLUL 5F3FA 2IDSA 1E2WA 3FOMB 2X4UA 3WEAA 5DS8A 1CBJA 2ADFH 4LOUC 4F80A 5HXMA 5KSBE 3KBPA 1AKJD 1ROWA 4HGMA 1KJMA 1THCA 1YEJH 3MV7D 4R7VA 4PGEA 4S1QH 3HHSA 3IU3B 4KJWD 1JWSA 3VFVA 2NTFB 3RZCA 2EINB 3IFPA 5IBUB 3DX6A 2WV3A 3ZKMC 3IMBA 3MA9L 3NYKA 1GZHC 3VXMA 1A1OA 1JJUA 2WBJC 2FHFA 1OK8A 3GZOA 2AAAA 1BVNP 2DWDA 2PW1A 1DQLL 4KX9A 3MRKB 1T5XB 4KVNL 5GS0L 1GMIA 3BUYB 1QRNA 3KEHA 3QUZB 3WUZA 4PRNB 3TO4B 1DANT 4DIXA 3H9ZA 4KUZH 2IDCA 4UNTA 3FL7A 4HJUA 2VZVA 2VDPH 4BQBA 5I1GH 1HHIA 2VLLB 1EHNA 1E8XA 5J11B 3T0BA 3L3DA 3VGAC 4JX0A 3C2SA 3FZUC 5KN5B 3JV4B 3LXCA 3FC8A 1EJ8A 3UTQA 4F7MB 3ZL4H 2A9DA 2VCOA 4RDBA 4MVBD 2DBLL 2DJMA 3KJ6L 3KD4A 1RV6X 3QJXA 3BPCA 1O0VA 1WF5A 3QIBB 4X7TB 5FO2A 2VLKD 3WKQA 4POYA 3B9VA 5I73C 4IJTA 4JFOA 3N43B 3PQYB 4K7PH 3H2PA 1KDJA 1R0AH 1SVCP 2BH0A 1FFTB 3CIQA 2O4EA 2J73A 2Q86A 5CZVL 2BFVH 2DWTA 1TYEB 3KDMB 5J12B 5C0EA 3DXAA 3QG6A 1AGCA 1OTTC 3L3JA 3U82B 4P46C 2C4FU 3VDCA 4UTAL 3US1A 3LKRA 1Q9WB 4PWGA 3RWHA 1MQ8A 3DROA 4L0PB 1NCJA 4JZJC 1Z2KA 1HYSD 2A6IB 5CUSH 3RIKA 1F00I 5CXPA 2JKIS 3CK0L 4UIKH 1DBBL 1PEZA 1L7TH 2AK4B 1D9KB 1ZK9A 2X4PB 3QQDA 4XAWL 5J9PB 3J8F7 1P0SE 3GRGA 2XJKA 2HX8A 3LPOA 5AFAA 4NFBA 1AVAA 4F91B 5J4MA 1EEYB 3FRUB 5FA4A 2GT9B 2QADD 4LCCC 2QZQA 5I6PA 1UVQA 1X6NA 4QYOB 2VW6A 4JFPA 5D5ME 2XZAH 5D4HA 1O7SA 5DEGB 4LXFA 4KXDA 4KWUA 3OHXA 4DP4X 4PY8I 4NKDA 1OAKH 2EYRB 4IOFC 2FSDA 3CQQA 3VFPB 2H1PH 1K3ZA 4OM0H 3D39D 3ATDA 1BOGB 3V4UL 1F90H 2N1TE 3PABA 1UGNA 2E9BA 1YJDH 3UTTB 3BGAA 4CBPA 4IMKA 5ISZE 3RTLA 3MUZ1 3SJVD 1CC3A 2YPVH 3NIFB 2MRYA 3ABLB 3MLYL 3SODB 2QKIB 2ZSVB 3PWVB 3UZQB 2BK8A 2P24B 3E9UA 1OM9A 2W9EL 1FGVH 4AENB 3EZJB 2NLJA 5I8EA 4MBOA 4PJ7B 4ZUSB 3WLBB 2VDOL 1TZAA 1BMWA 4XO5A 4MAYC 2OQJB 5DRZB 1IGIH 1X4XA 4B9FA 2NW3B 4AITA 3SB3A 1MFCH 1LO4L 3ECWA 5GRWA 1CF8H 1UZ8A 5F8RC 4BZ1L 4Z1PA 1PG7H 5D2LB 4K0OA 1ZE3C 4BWWA 5I1CH 5I5RA 4EVNB 3HAEA 3OJMB 3AM8A 3H1ZA 1KNOA 4U0QB 3U46A 2HLAA 4KJPC 2AEIT 4RA3A 2V3EA 4OBRA 3D07A 4H1LA 4EN3B 1F2XK 1ETB1 3F83A 3QFGA 2PWEA 2AEPH 2Z8VC 3NZSA 1YEIL 3CFQA 3LZFL 4FTVB 5FDWB 1OP3K 2GJJA 4AYSA 4M02A 3X3FL 2A3TA 5C0JA 5DTFA 3L48A 3C6LD 3FOLA 5GISH 1LP9B 2ZOLA 3G7TA 3GMPB 3FT3A 3HS0B 4PW9A 1H6FA 2GJPA 1QTYT 2GB2A 3ML9A 4L05A 4PV8A 1Z9OA 4OLYH 3O2WL 4A7QA 4RBPK 1JXFA 4A2EA 3BEVA 4XH2A 2R69L 5CSGA 5FECA 1IEBA 3X1FA 5I8KL 2XQBL 4AKPA 5IMOA 3CC1A 3ZW3A 3MUJA 4AQEB 3EFOA 4K3HA 4ZXBA 2XA3A 1T6BX 2E74C 2HKFH 2E47A 4FFYH 4EIGB 1CK0L 2GK0B 5BVJA 2JJSA 2ZE0A 3MX0A 4XP4H 1ZT4B 1TFHA 3U4KA 4IU3B 1NOFA 3KPSE 3VXRA 2YOAA 3CC5B 3V6OE 2DD8L 3H3PL 1KDIA 4QAWA 5AOIA 4ZZFA 4DUXA 5GS0C 3QRLA 1CFBA 4TLSA 3NPSC 3LOWA 2YEVB 4XVTH 5EF3A 2WOYA 1NGYB 2A73A 4M61A 4KK8D 2LOEA 4FFZA 5FV2A 1AG6A 4XPAH 1UWYA 3ARFA 4OTXH 3DJZA 3BFQG 3K4AA 2CJSA 3IK2A 4DZBB 4ETYA 1IBZA 4Z3FA 4JS7A 3IFLH 1GGBL 4JHAH 5BQDA 3RDTC 1SBSH 3D69A 5M7QA 2EUWA 1EHXA 2NUPA 3CVBA 1TENA 3F05A 2EVJA 2OMYB 4X5LA 1HU8A 2UXGA 2EDQA 3TFBA 5E95B 1L5GB 4QRSA 5EZPA 4Z7WA 2DQCH 2E7HA 2IFGA 4K94H 3STLB 2XSKA 2N01B 1IGYB 4FZ8L 1PY0A 4L5FL 1ZSDB 3IFOA 3KGSA 4JE4B 1DAQA 4LFHG 4OLEA 4YBQD 4BK5C 3LIUA 4ZOEA 2RACA 4FG0A 4ENZA 2Q0ZX 2EJ1A 5DJ6A 4H8UA 1BREA 4HZAA 3RWFA 4W70A 3RY6C 3TA3A 3UZEC 2V3FA 3GMOB 4NNYB 3BD5A 3H9SA 2X70A 4JUTA 1QSEE 3RDJA 2WAQA 3D34A 1TZGL 2K3TA 4I0CC 1UJ3C 4ZQKB 1SJHA 2MOVA 1E7VA 1Q0XH 2XN9E 4G43B 4K3EL 4YHYB 3GB7B 4APQB 4ODWA 4OZHE 3DUSA 1NDGA 3D4ZA 2VXTL 5IP4A 2Z93A 1QHOA 5CD3A 3FK3A 5HHOD 1BFVH 1IC5L 2DQEL 1MPAL 1GGCL 2IPTH 3LNFA 1BBJB 4J3SA 5SX5H 4AQOA 4DGIL 5FUZH 1MAKA 3V0JA 2PCXA 4F3FB 5ES4B 1ECYA 1UZ6F 1HN1A 2XWRA 2X4SB 3PWNB 1HILA 3QORD 4QXWA 3BOVA 4U1MB 4JFED 4ALAC 3L5HA 2E9JA 3QO0A 1FDLH 4JUSA 3FCSA 1AHWA 3D12B 4ZAKC 1M71A 3B9KD 3QDAA 3GXUB 3CWGA 4JR9L 4QNPF 4X6FA 2D0HA 2RALA 4IU2A 3B9EA 4XXDB 5CCGE 2JKJA 3T0WA 1K8DB 3JQOB 4FLHA 1CL7H 5C9JA 2XBTA 1UASA 1OP4A 3QFJD 2WO2B 1P84J 3D0LB 4PS4H 1OSPH 2K9UA 5GGSY 4G9FD 1UWFA 3L81A 4E41D 2VT0A 3CX5K 3B7SA 3KLAA 1ZVNA 3OAWA 2XYBA 4OCYH 2XX1A 2EEFA 4UT9H 3QIWD 2E0PA 5HDLA 1D5BB 3MVSA 3FMGL 2VJ8A 2XU9A 4FC3E 4WY7H 4P5SA 1RUML 2I32A 1Y7VA 2FK9A 1A4KA 3WXVH 5IF0A 2DI9A 1MWAB 3BQUB 1JPGA 4X7CC 4PG2C 2ZAIA 4KMLB 3HPJA 2EUVA 4NRZB 3SYCA 1DJXA 1ZHKA 2WKOA 5AL0A 3V6OC 5TDOA 4IBUA 4QD2E 4ZOBA 2YMOA 2CHNA 3VE0B 4L5FE 3LNDA 2VE6B 4L9LA 4Y5YB 4Z7VE 2GEQA 5AG8A 1XTMA 2V0AA 4F37K 3IXTA 1U92B 1TVDA 3SDYH 35C8L 4IRJB 1FL6A 2CDGB 4M7LH 3SOTA 1SYSB 2P26A 2KPNA 4NQVB 1MG3C 4XTRD 2P8MB 4B41A 1J87A 5AALA 2HA1A 4Z7NE 1AR1B 1HL9A 4X4YA 2BZDA 4ZW5A 2PWDA 3A3YB 1QWHA 1LXMA 4XNQA 5C0AD 1J1OL 2AV7B 2L7UA 3KJ4C 3RBSA 3EGDB 4D0DB 2D3LA 3AQDA 4IBQA 3UTSB 3ZZLA 1K4DA 5G4NA 2Y07L 1IGCL 2BC4A 4GAAA 4BYHA 1NCCL 4MJID 5CLYA 1BP3B 3LH2H 4YL9A 1UXSA 4PWJA 1BZOA 25C8L 5IEKA 1LK3L 1UUNA 5I30L 1TMQA 1EEZA 1S9WB 3QDJE 1E40A 4YC2C 4FCHA 5DLLA 2BLFA 4UT6L 1RFDL 4YZFE 2ZWLT 5A16B 3P9LB 3GSOA 4ZMXA 4QT5A 2JXMA 5CEZH 3SKJH 4ZW8A 4OGAC 1HH9B 4AUYA 4Z3GA 1KGUA 4XP6H 1TDQA 3PWPA 5I1HH 1U8IB 3Q05A 2XUWA 1MAML 3LS5L 5FO8A 3B2MA 4MJJA 5KUMA 3FQTB 4YSSA 3REWA 2IG2L 4YO0B 1NLBL 2GW5A 3MJ8A 5C0CB 3TCLB 1KCSH 3GHPA 4Q4IA 4NNXA 3NJGA 4TSBL 5LXVA 4LVOB 2F18A 2V9RA 4AGOA 2FHBA 3QRBA 4XWGH 4XP5L 2XJLA 4YDKH 1DEDA 2DV6A 4OZFB 1JBJA 1UM6H 5EBLB 4J1UA 2CLRA 5D1XD 1W72L 2YGOA 3JTSA 5EOTB 2VDMH 2O61B 4HKXA 3RTQA 2OPCA 2X6MA 4J8RB 4TSAL 3VH8B 2XV3A 1DBAH 1EUTA 3UROR 5IQMA 1ND0A 1WZMA 2R1YA 4ECNA 3IU4H 1TJMA 4UT7H 3V0EA 2BNRE 1LEGA 3VXUB 5C7XH 1DJWA 5E8PB 1NDMB 1P7BA 3EJTA 4G83A 1X9UA 4C4KT 2QMKA 3VTAA 1JZHA 1OP5K 4R8WH 4YH6A 4XCYA 4U6YB 5GZOA 4PVBA 4XC3H 5D8JL 4TVPH 4U0RB 2NY6B 5EN2A 1XF2A 1JK9B 2XPGB 3LQZB 2LGNA 2VN6A 4BSWB 4QO1A 5HHQB 3CZUB 1D7DA 3DVNA 4Y4HD 1JV2B 3FO0H 3EUUA 4MNGB 4W1TA 3MRRB 1FSKC 5FXCH 5JLZA 2FX9H 2F1BA 1KACB 4N6RB 5IVZB 3I75B 3P73B 4AJVA 2C3VA 1I3RB 3LXUX 1I4FA 2R1XA 1XXDC 3CN3A 2YA2A 1NANI 3AXHA 4I8DA 1P1ZB 3GI9L 3V95A 3OAZK 4HALA 5JYMA 5D55A 3S5LG 1MHEB 2MMXA 4HWZB 3PL6B 1BMGA 1EO7A 3RGHA 4X8GA 3RUGA 1U8PA 4P3CL 4X6DF 3BJ91 4G6KL 5E8OA 2R2CA 3V5DA 3WTVA 3IJYB 4KO6A 2CRMA 3AREC 3IB4A 5D7LA 1XSKA 3RPIB 2X09A 1FJ1A 4DQOL 4MB3A 5BRPA 4M1DH 5KBMA 1JNLH 3ELQA 4A6YA 3FKUS 4LCIL 4L9DA 5HGDB 4MCZB 4PJ5E 4O51A 5FHBL 2DW5A 2C1OB 1BQLH 3LPPA 2FNBA 3NCWA 5FF6B 2CK0H 3L7FB 4M6NL 5SWSE 4LSUL 5TH2B 4NP4H 3KYMB 4QKXB 2ED6A 5TFSL 5EORH 5BJTA 4TQHA 3CZFA 4AEEA 4XNYH 3PY9A 1LD9B 1S8DA 4IBVA 2H2PC 1HX0A 5I75C 5KJ4A 1WGVA 3NJHA 4X8XA 1E5BA 1JPFB 2AK1H 1RERA 5DD0H 1BD2B 1T7ZA 3V9CA 4HUUA 5LQBH 5CFAA 1ED3A 3G6DL 5AUMB 5AW1B 1A9EA 1J8HB 2VTFA 3B56A 1OT4A 4O4YH 5IROA 3U7YL 4BSVB 3NFSL 1DUYA 2HRGA 2W0FB 5FO9B 3QUYA 1INQA 1VFAB 1U8HB 3NQIA 3OPZL 3IDXH 4EDWL 5B39A 1KCLA 3O2VL 5ALBL 3DHUA 3FFOA 7FABL 2EXYD 1OZTG 3GSRA 3K6NA 3VTTA 1RH8A 5T3ZH 4WO4B 1T1ZA 3LQAH 2NSXA 5JOFA 3DRQB 3IN0A 2CH8A 5HHMD 1KCUH 4HV8B 5C08D 4WHYH 2PO6C 2EEAA 1FH5H 3SOBL 5IB2A 1OAYL 3O3EB 3RKDD 2MH4A 2W91A 4B9YA 3ZE2B 5ICYB 4Y9CA 3BCDA 4HJIA 4ZODA 4GFTB 4NT6B 5C2BL 5JMRA 1OGTB 3QJFB 5TD4A 5FYKH 1J5DA 4MD0A 2GIMA 3TVMC 4YXKH 5JHDE 5FGBA 2IPUG 2Z7WA 5IK3A 4PJGB 4IGBB 2O93L 4TN9A 3GSNL 2FNWA 4P2YA 2QDVA 4OLVH 1JSYA 2YPKA 4XWOC 3LKOA 5BZDA 1ODAA 2R4RH 5I1LB 4XB8A 4CVZA 1SNRA 4LLQA 1JZJA 3QCTL 5E5UB 2APVA 3CGTA 3U7WH 1F4YH 1GL4B 3ESOA 3UJTL 4Z3EA 3HG2A 4RMTA 5G55A 1UFUA 5F0PB 3EJPA 4ODVH 4C56B 5DGRA 2WO4A 1IL1B 1F8TL 1M05B 3AG2B 4L29B 4XPFL 1S7VA 2WAHA 5DR5H 5C0ND 5L4JA 2C7FA 5GXBB 1B0RA 1N6QL 3NIDB 5HYJB 3O4LD 4XPHL 1T7XA 2G0LA 5FOJA 2VL4A 5C0RL 2MQ0A 2ESVE 4H8WL 1NEPA 4PTUB 4BCXA 1N64H 3QI9B 3PV7A 5D70H 5DA4A 3V4PH 3SDXA 4OJCA 3WNPA 4NPYA 1UM4L 4BFNA 3HB3C 4LLUA 1J88A 1WWWX 3TOPA 2E75C 1KTRL 1A4AA 3A22A 4OJFL 1IGTA 5BO1H 2XXFA 2WPGA 5LGYA 3O11A 2CJUH 4Y2DC 5DQDH 4LEBA 2EYTA 3CH1B 2YKLH 2OYPA 1VKXA 3POHA 5B1CA 3KPPA 1NCGA 4NENB 4CNIB 1KV3A 2A77L 4MXQD 3DPBA 3J2PA 1GPOH 2XN1A 3ELAT 3U1PA 2C9XA 1WHOA 4Q6KA 3F12A 4R97C 5DF0A 4I18A 2Y7MA 1OF0A 5DJCA 2TSBA 3CHQA 1J0ZA 2VDQB 4JG0H 2H9GA 1E4XI 1QFWL 3NSDA 3C8KB 4DFIA 1TJIH 2ADJB 2EH7L 2CPCA 2H3NA 3LKNA 3T09A 1CT8B 4JQIH 3RZCD 2PYFA 4C4BA 4AIOA 3F58L 1MNNA 1WG3A 3C5ZB 3EZ8A 4K7FB 1E6JL 1TVHB 3LS4H 3VXMD 1NBZB 1EXUA 5F1IB 2CRIA 3ARBB 4NPKA 4CUCA 2NZ9C 2FWUA 2IF7A 2AQNA 3VQLA 1V10A 4WI8A 4NOFA 1O9VA 5IB5A 1MHCA 1QRND 4YPJA 1OM3L 3W82A 4JGNA 3MRJB 1HNGA 1DQMH 1A3LH 2X6UA 1OHZB 3TBYB 4DKEH 3I84A 4P59L 1JPEA 1OY3B 3T4YA 1UCBH 1S9YB 5HJGA 4MSWA 3K71A 3INUH 3B2XA 4ZPTB 5DFWH 3L2NA 1Z0MA 4QEGA 4ELMF 2CO6A 4F7KA 1UQSB 4G72B 4ZTEA 4Y16B 2ODIA 4P5KA 1AZNA 2ORBH 1DVQA 1V7MH 4RAHA 5A1AA 4F2FA 1GZQA 1UENA 1MKFA 4OD1H 1LDSA 1EDHA 5GGVY 4WHYG 4P2CG 2P1YA 4KKPA 2OMWA 1UFGA 5F6IC 4EIBA 4N2EA 1G0DA 2FJHA 5E51A 4YSCA 4IK6A 1TJHH 4AYFB 2EEDA 4G8IA 1FVCB 2VL5B 3DXAD 2QQLL 3JT0A 5KYXB 5EDSA 1KIPA 1C1EL 2DMHA 2QQKH 1BG1A 1WUZA 4UINL 1JZGA 1LDPH 2X10A 5C07E 3ROOB 1NCBH 4BFKA 4RMUA 3O9WB 2XTJE 5M94B 1F4AA 1VZIA 1O6VA 3GXNA 3BD3A 3HNTL 2P8LB 3M45A 2KLRA 3S96B 4E9YA 2NY3D 1J5HA 4XHQA 2JIXB 1R46A 4UQIM 3ERXA 1PDKA 2YAPA 5BVPH 2VZOA 2VXVL 1NPUA 3TIEA 1U8KB 4NX0A 2OL3A 1D6EB 2IV8A 4GNKB 1BQRA 3VQ2C 4GW1A 5IIEB 2VKWA 4PRDA 4R3SB 2YAQA 2GITA 3GXPA 3GBEA 4PJ6A 1CLZL 5AOKA 4N22A 3QUGA 2ZJSL 1S78C 1P4BL 2Y3NA 3K2IA 4RFEA 1UACL 5B21A 1TLMA 3ZOAA 4M5YL 3QEQE 3Q2NA 5D7IA 5AVXB 3K74B 3Q48A 2XIIA 3Q0HA 2DLGA 5EB9A 1QQDB 5F44A 3EYOB 5F9OL 3VG0L 4I0PA 2V8LA 4WI0B 5ITFA 5B22A 2IANB 3U0WL 2R29H 3CNKA 3KPMA 1FZKA 2UY6A 5GRJL 3MLPA 5IFAH 5DRNA 4JZOB 4DP0X 3DV4A 2KL6A 1Z9SB 5CBEB 3Q2VA 3C5JA 3CZGA 1DN0A 1RIVL 4RMQA 3TIDA 3FF7A 4YGAB 2JKSA 4G7VL 3UERA 4LARH 4J4PA 3TM6A 1AO7A 2ZSWB 2FWOB 4U6TA 2WXLA 4NQCA 5F88B 3V7AE 4PJDB 2AQRA 3GRWL 4OT1H 4DN3H 1MSPA 4NUMA 4XZ4A 1XF4B 4KHTH 1G84A 1XGPA 4GG6A 1OZUA 4E5XG 2B5IC 4JO1L 3T71A 2AJ3A 3Q6GH 4M1GL 1CI5A 3X12A 1MFAH 3EH4B 3FO1B 1NBYB 4JAMA 4EO5A 3AGWA 4YGVA 5IHUL 5C97A 1FIEA 4KQ3H 4MA3B 5HDRA 2Z7YA 4LKXB