4WKZA

Complex of autonomous scag cohesin cohg and x-doc domains
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
231
Chain Sequence
VTSAVKTQYVEIESVMGFYFNTEDKFDTAQIKKAVLHTVYNEGYTDDGVAVVLREYESEPVDITAELTFGDATPANTYKAVENKFDYEIPVYYNNATLKDAEGNDATVTVYIGLKGDTDLNNIVDGRDATATLTYYAATSTDGKDATTVALSPSTLVGGNPESVYDDFSAFLSDVKVDAGKELTRFAKKAERLIDGRDASSILTFYTKSSVDQYKDMAANEPNKLWDIVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cellulose-binding protein
publication title Complex of autonomous ScaG cohesin CohG and X-doc domains
rcsb
source organism Ruminococcus flavefaciens
molecule tags Structural protein
total genus 66
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18244 CttA_N Cellulose-binding protein CttA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wkzA02
2.60.40.3810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wkzA01
4FL4C 5G5DB 4WKZA 2VN5B 4WI0B 2B59B 2VN6B 2Y3NB 4U3SB 4IU2B 2MTEA 4IU3B 4UYPB 4UYQB 1DAVA 2JNKA 1OHZB 4DH2B 3KCPA 5LXVB 2OZNB 4FL4A 2CCLB 1DAQA 3UL4B 5K39B
chains in the Genus database with same CATH superfamily
1ZLDA 5D7IA 3CDGA 1NZRA 2RA1A 1URIA 2ALAA 3L2LA 5DSCA 2OCFD 1EDHA 3D4CA 5DLLA 4X5WA 3D25B 5D7LA 1N0LA 2X4QA 3VDAA 3GMQA 4XXDB 1EZSA 1JD9A 1KB5A 4HISA 3O3EB 2BHZA 1Q1JH 3QJVB 4PP1C 4U1NB 1MXDA 4U1HA 1B0WA 2X4OB 1P6AB 1FC2D 3MZTA 4X7EC 1E30A 1HHKA 4BZ2L 2WXQA 2RACA 1JGEA 5D2NE 2IG2H 3OR6B 1ES0B 3QEQA 3ZQ9A 1HTYA 4LESA 2L4OA 4N6QA 3NJHA 3EG9A 3M17A 3VO0A 3ZIMA 2I60H 5HHXH 4HUXB 1S8DA 3BSZL 1FLTX 5JNYA 1U9KA 3FB8A 1JYNA 4M62L 2DL9A 1TQVA 3ATEA 3ARDB 4ZSOE 3VXRE 2ZF9A 4BFBD 1XGTB 1NJ9A 1OB1A 4KO9A 5ISZD 4QAWA 4KTYA 5F1OB 5T8IA 4F24A 3MRQA 1NGZA 1Q8MA 4M3KB 3S4SG 3M8OH 2V7HA 4UTCA 1LILA 4KDVA 2HH0L 4PJEE 4NNPL 4WW2B 3PDDA 1A9BB 1YQ2A 4EUPB 2A6KA 3AW5A 3FT9A 3QZWB 4GOSA 4J3BA 4YDIH 3P3YA 3KW8A 2WZPA 3QA3A 2HRPH 5J12B 1MG3C 2XVKA 2J44A 1OSPH 3P30H 5DS1A 4MJ2A 4KTEL 5J11C 2CPUA 3VD4A 2PXYB 2YOAA 5IGXL 4DVRL 3MRCA 3G08B 1FV1A 3QJRB 4N0UB 3UTSE 1FH5L 5F7AA 3BUPA 4G80B 1ZVYA 3GXDA 4N2FA 5K9OB 5DHVA 3JTSB 5C07A 2VN3A 3AABA 4HJGB 3GYRA 3ULUE 3GMPB 5D9SA 1I3GL 3S7GA 1OSZB 1ZHNA 1JGDB 1XH3B 3DX3A 2AJ3B 2JKIS 3LQZA 4W9JC 5D5MB 5CP7B 3VYPA 1NEZG 4QO1B 3UJJH 1BFSA 4OAWA 1RZKC 1ZGLA 4DUXA 1EHKB 4JPKL 1IBGL 4PS7A 4AQZA 1YMMA 1JZ6A 5KVMC 2DIJA 4PRAA 2AS5M 3ECBA 3MLUH 4EJ1C 2X0WA 2ED6A 3IS1X 2GBVA 3WDIA 1SDDB 4AENB 4I77L 4PJXF 1WCBA 3HI1A 2CK0L 2X70B 4LEXH 4QAMB 5EDXA 3H4FA 1CFSB 3BLBA 2XWJA 3LDBC 4AOFA 1BVKA 1T80A 2F1AA 5F8RC 3DDGA 3W11C 5EN2B 1LE9B 12E8L 2FYVA 3HZVA 4M7LT 15C8H 5E1HB 4IMLA 4KNQA 2COVD 5DJZA 5TTRA 3RUGE 3BKMH 1YHPA 1P7KA 3G3LA 4N8CL 4X8CA 3E8VA 3V4VH 3WG7B 3RVTD 1A3QA 1J10A 2GCYB 1ZLSH 3IDYB 5D4IA 1WICA 2XN9B 5C0IB 4CDHA 2QHRH 1MCWW 5HGDB 5ICUA 1QRNE 2JJSA 2K70A 3FRPA 1BQKA 1VSCA 4JM2F 4ZTOL 3NIGB 4YAQB 4F2MA 3MOAL 4UOW0 1I7UB 4PJHA 3GUTB 4JJHA 1PY9A 3MUHL 3WFHB 2F19L 3HS9A 2W07A 2RIKA 3RRQA 3TF4A 4IIQA 2VDML 1R5WB 3PWPA 2K6WA 3S9DB 3I9PA 2E7DA 3KPSB 3B2VL 4QHMB 4PJ8B 4MAYD 5AOJA 1DO6A 2XWTA 3C8KB 3NGBB 5FYKE 3TBVA 3ZT6A 2NQ3A 2KLSA 1NANH 3S5LG 1DQQA 1MJ8H 5LN8A 4XP5H 3QE5A 3MSPA 1KIQA 3NDYE 1Q94A 4P3DB 4JO2H 4P3CL 4FQPA 3BPOB 4LQFH 3BPLC 2MPAL 1RK1A 2H1PH 2GI0A 2NSQA 4QTIL 3GKZA 5IVOA 1LO4H 4F7MA 5D70H 2WSDA 3L48A 4K0OA 5AQ0A 5LXVA 3K8MA 3OXSB 4DPCX 4NQXA 4GW4B 3HZ3A 3IRCA 3N44B 3P3TA 3O3UN 4FFWD 4ISVB 3QZNA 4YS4A 1MQ8A 1XQ4A 5D1QE 32C2B 2J1YA 3CQPA 4DF9A 5KSVB 5AW8B 1GGBL 4ODXA 1JGVL 5AOMA 4B6ZA 2FQGA 5D7SL 4GKNA 1YEEL 5E8EA 1AGDA 3DETC 4RZKA 5BOJA 3LZLA 5I76A 1DL7H 5DJCB 1CGUA 5EBWB 3QDME 4YBLC 4OM1L 4ZUUB 5LQBL 2IANB 3WJLC 1JZ3A 2AK1H 3QSKB 1G87A 1YO4A 4FCAA 4QRRE 3GWJA 4A1RA 2GUYA 1G7MB 3DSFH 3LRKA 3MLSH 4PV9A 4CRPA 4U0RB 2JK5B 3D2UA 4NUPA 1BVOA 4BKLB 3AAZA 3VRJB 3WTXA 1BQSA 2R27A 3WKYA 4ETYA 4J7RA 1CXIA 5E6RB 5F6IC 2JKRM 2YKLL 3MA9H 3LPPA 4I5BB 2WNXA 2KDGA 2H32H 4LZKA 4TPRL 3FZUD 3VD9A 4Y5VA 4LLMB 5GS0H 2GJZB 3CNKA 4MNHB 3WFBL 1OP4A 1KJ2L 4BZ1A 4LCIH 5IVXE 1E7UA 3TH2T 1ZJBA 1VHPA 2BERA 4WEUD 2UXTA 4YH6A 2QPDB 3M46A 2QTVA 3MREA 3QUXB 4S1SH 3APDA 3NFNB 1WWWX 4WI3A 3OC5A 1UGNA 4I3SH 2AK4D 4KQ3H 1BZ8A 1RXLA 4X5XA 5I73C 3BUBA 3F6LA 3VW3H 2Z4QA 4OGXH 2NY4B 1KIRA 4WUKH 1J9TA 1ETA1 4H8WC 5IMOB 1MELA 3VAEA 3V55A 4M3JA 3FONA 5IUSA 3JYCA 4MD5B 5KN5A 2BNRE 2G75B 3HHSA 1OKEA 3F62A 2MTAA 4R26L 4JN2A 3SDXB 2ADFL 2AGJH 4U6HB 4IK6A 4MAUL 4IHOA 1RU9H 5C09D 2JELL 3F00A 4CADB 1OK0A 2E0PA 1T6WA 1UXMA 4WK4B 5EU6A 5EZOH 5FKPA 2AEPL 5BOZG 1B4JH 2SEBB 4F20A 3L9RB 5JW3H 4UINL 4OCLC 5IV2B 1YNLL 4YSDA 2DOCA 2Q3XA 2F0CA 4LLUB 1IB5A 2LE9A 4LLQA 1AS8A 1OF2B 3FF8A 4ZO9A 1XFPA 3O8XD 4I0PB 4NHCL 1ND0A 3VG0H 3L3JA 4UM9D 4XC3L 1FFTB 3TL5A 1W8OA 5TDPA 4ZD3L 4N0YL 2Z0BA 3VMOA 2FATL 2HT3D 3E7JA 2BVEA 5FKAA 5GHWL 1PSKL 1U8LB 1EJOL 1R5VB 1MRDL 5KJRH 1QEWB 4G7SB 4Q9QH 3UTTB 3WFDH 2WNKA 2X05A 4Y19D 2XT1B 2AI0H 3L5WA 3UDWC 4OVUA 5L8JB 1KBPA 2C1PA 5D2NA 3FTGA 3PE9A 3D25A 3IAGC 1A65A 1MVUB 1RJYB 3ARGC 1OP5H 2VLJE 5C86A 3O3EA 4X8GA 2AP2A 4HWEH 2X4OA 1Z9SB 4CNIB 2F53B 2DQDL 3GDCA 2B3IA 2ZSVB 4XRCA 1X5JA 4LARL 5FUOL 3OR6A 5I6NA 3NT0A 1ZS8A 2HT4C 3QNYA 2BSTB 3CZUB 4HUXA 3B6SA 1GAFL 3ZOAA 2HJLA 2TSBA 3IJSB 3MACL 2X88A 4NZUH 1DZBA 4PJEA 3DYMA 4ZMOA 2O5YH 1SM3L 3MV8D 2K0RA 3ARDA 6PAZA 4OF5A 4LO9A 3NCJL 1SYSB 4YSQA 1HESA 2ZUVA 3KYNB 2VDLB 1MCKA 5C7XL 2ICES 4WW2A 4PGJA 3VA6A 2QSVA 3P9WB 3QZWA 1MCHA 1OLZA 5E24E 2WINA 4OB5H 4UT6L 2YPLD 2R23B 4RGNC 2DH2A 3LPWA 2VRAA 4PHZA 1FJ1B 4DEPB 4HJEA 2PXYA 4FG2A 4XCFL 4HH9B 3RGHA 3KPOB 4N0UA 4XMXA 3BP5B 4YNYA 2MOGA 2Y7QA 7PCYA 1UXWA 4U6YA 3BQUD 4QHLB 3AITA 3JTSA 2R1WB 3H6AA 2Q2EB 4YXLH 4HJGA 1U8CA 3KVDD 3QI9B 5KTEH 5AB2A 3GMPA 3HE6B 3MOBL 3TCLA 1OSZA 5CD5C 1XH3A 2Z93B 2AJ3A 3QIUC 2VJ0A 4RMUA 3VX1A 4FQ1H 5CP7A 4DP8X 4QO1A 2VR9A 1JZJA 4JG1H 1PX8A 1MFUA 1KELL 1YYMH 4OD1H 4HHAB 4DQAA 1D5MB 3LEVL 1ODAA 4Y4KC 3DROB 1SDDA 4AENA 5A2AA 5T1DL 4OD2A 3ILPA 3RL1B 3WJJC 2X70A 3MR9A 5T1KD 3VE0B 1CFSA 1E50A 4LVOB 1OP5K 3LEXA 2XXGA 4NLAA 5FYKU 4Y4HD 5EN2A 4YHKL 1LE9A 3NK4A 4KPHH 1YN7B 2XQYA 4YQXL 4PRIE 5F88B 3VXNB 1NCWL 2FRGP 2EXYC 4XBEH 4ORGB 1IVLA 3UMNA 3VGGA 2KQMA 3D7PA 1F90L 4FMVA 4XNQB 4H0LC 4HAFA 1QO3B 1DQVA 5JDJA 2GCYA 4WDIB 3SO3B 2XACC 3DIFA 2XVLA 2P9RA 4QGYA 2ZNXA 3QC6X 4N25A 2EDWA 4WI8A 4ERSH 1PZSA 3SYQA 4P2QD 4UV7H 1G0YR 1DBMH 2DMGA 5DXWA 3U0WH 1KGUA 1PQZB 1S7TB 4R6UA 3R1GH 1R5WA 4WFHE 4AQ8A 1AY1H 3MJ8A 2ARJB 4QHMA 3MRMA 5I6XC 4P06A 4PJ8A 4XHQA 3DX1A 2JB5H 4GSQA 1BJ1J 5FGCB 1WS8A 3QIWB 3VFVA 1FNLA 3MFGB 4JY6A 3Q6FB 3LD8B 3LH2H 5I5RA 4XTRD 3EYQD 1B4LA 1WHOA 2R7EA 2E7LC 4P3DA 1DQDH 3NH7L 1FNEB 1WIOA 4M93B 3S88L 1HT6A 2VERN 4IK7A 2XVBA 4LU5H 4JDTH 2YD5A 2Z7UA 4XMVA 3ALWA 2YPVL 4O4YL 1XZ0B 3G04B 3OXSA 4IRJC 2JKWA 2H41A 4PJXB 3D3VD 1IGFL 3WS6C 1E9OB 1NC2D 2O1AA 4KWUA 3VGAC 4ISVA 4I2XB 4DHLA 3GT6A 4R7NA 1I7TB 3V9CA 1YEFH 32C2A 3ME0B 4Y1AD 2GHWB 4WSKA 5KSVA 1OAUL 3WLBB 3HS0B 2I24N 3SE6A 2YBGA 3P40A 4QRRA 3DHJA 3WUWB 4A55A 5IB4A 3EH3B 1PZCA 2C4FT 1BVLB 4PW9A 4LCWB 5DJCA 3OKKB 1DVQA 2K9FB 5EBWA 1C9SA 1BGXH 3A21A 2YO3A 2Z8SA 4ZUUA 5AB9A 1ZLVH 2IANA 1E3FA 3ZW3A 1BQ5A 2EC9T 2VDRB 1N2RA 2WBJC 3FMGH 4OUUB 2PO6B 2EO1A 1NCDL 1WQVT 2ZXCA 1PEZA 1G7MA 4RDQF 2C5DC 4JM2B 4U1KA 2CHXA 4KQ0A 2JK5A 4ETQB 4BKLA 4YEEA 3VRJA 3NABH 5AUMB 2ADYA 4I0KA 3TT3L 2APSA 1A21A 1UQSB 3E1F1 4I5BA 2O5XH 1LO0H 1LM8V 2BP3A 4LAJH 4H1LA 4A2GA 1JXFA 4JFZH 2GJZA 2LR4A 2FGWH 2OYPA 3TVMD 1ZANL 4MNHA 3STZA 2CLZB 1ZY9A 1VCAA 3N42F 2Z1KA 1RLBA 1I3RB 4UQ9A 3QUXA 3NFNA 3T3PB 2OR9L 4XPTH 5C0AE 3F6IA 4P5MB 5GRJH 3C6EA 5H94B 4FI7A 3HAEH 4HCRH 1Q0XL 2CO1A 2WTRB 4YBQD 4AIEA 4W1TA 4LOEA 4IGBD 4WNQB 2HFGH 5F7DB 1CBVH 2YGOA 4Q6KA 3SDXA 3K2UH 4U6HA 4X80H 4CKVX 2FX8L 4WTQA 5JHDB 1BZOA 2YC1B 4GAFB 4B9IA 4CADA 5CBAB 3BC9A 1L0QA 3WELA 2SEBA 1DUYA 1Q0YL 3ML9A 2WXHA 4LVHB 4RVBA 3MNVB 3L5XL 3K6SA 3S98A 4LLUA 1CFVL 4HCFA 1UOKA 1JMZA 2WLIB 4ODVL 4QRFA 4O02L 4JFPB 1E4WL 3V4UL 2WKOF 2AVGA 1TUPA 4M7KL 1CO1A 4L4VB 1IU1A 3BN3B 3QULB 4R4BB 4M5SA 2EE9A 4UNVA 5I8EB 1F4WH 2DF3A 4O2CB 4UT9L 3NK3A 1NIEA 3GSNL 4JG0H 1QEWA 4D94A 1U8JB 5D1QC 2VLJA 3ILQD 3UTTA 3WFEL 5AZ2H 4CVZB 4IKJA 3IXAB 4CGTA 2X6BA 3CZSA 1BEYH 3VI4F 2WYIA 4ZAKC 4ZO6A 4G8GB 4PJ6A 3NJNA 2QQNH 5C0CB 1MVUA 1RJYA 3FO0H 1BXUA 1IKNC 4K5MA 4NUGH 4NC1C 3ZYJA 1A7OL 3MNZB 2NDFA 4N26A 3ZUNC 1NPNA 3V5HA 1WZ1L 1BJMA 4KFMA 3Q48A 4GSDH 2ZSVA 4Q7DA 1ZLWK 1ILSA 3GBML 3SGJC 4CMMB 4C56B 1HHGB 4G11A 3GRWL 4KY1H 4P57A 4PI0A 4S2SB 4Y7OC 3B2DC 1JZEA 1KJMB 4JRXB 1CYXA 3D0VB 2N4IA 1RD6A 4FYRA 1UACH 2J6EL 5JHAA 3FHAA 5CP3A 4ODTL 4L05A 3QPXL 3SDYL 1A7QH 2GK0B 2PYFB 1HE8A 1A14H 3CZLA 1NMCC 1BWWA 2W9EH 5ESQB 5KWYC 3OV6A 4AYMC 1SYSA 3PJSA 1WTGT 2HFFA 3KYNA 3LQAC 4FFWC 3VM7A 4YPJA 1A6TA 5EHFA 4IEFA 1RZFH 5JOFB 3OM3B 4O58L 1CBJA 4KROB 1ZCRA 4WTZA 2R23A 2E4FA 5B22A 4KDWA 3SJVE 1R9FA 4EN3B 3SD2A 3WFCH 2GJ6E 3HNVL 3TWCH 2B1AL 1BZQK 4NZFA 2LAGB 3FHQA 1IGIL 3ZKNC 4E9QA 3BZDA 2OMVA 4E41D 4M61A 5EEYA 3SODB 1JXDA 1G6RA 5IBLC 4BFOA 4QHLA 2IGFH 4XGZB 3T71A 4BK8A 3FB5B 4QDGA 3AQZA 3RPKA 4AMKH 2R1WA 3SKNB 1AGBB 1SXNA 3HE6A 1DEEB 3RX7A 1BFVL 2Z93A 3AQDA 3D39D 3L5JA 4X9GA 4CN4A 4HETA 1IILE 5IW6B 3QWOB 2VZ1A 1GJWA 1UJ3C 4HHAA 4DKEH 5D71H 1WK0A 2YEZB 4NBYB 3AACA 1LEKB 4XAWH 4PR5B 3BP7B 4XPHL 3ABKB 3DTDA 5CEXB 4HBCL 4UIMB 1DANU 3HG1E 1AD9B 2APTA 2J2ZB 4BSWB 2C7FA 3F6JA 4MJIE 3VE0A 3BUQA 2XYCA 4G6MH 2D31A 1U4EA 3BYYA 4I4WB 4YXHL 3SE3A 3VXPA 5LGHL 1Q38A 4I3RL 3B9KA 4UQ2A 1ZT4B 1TYJA 2NY5H 4HSQA 3FCBA 1TJGH 2QVMA 4FFVD 4B5EA 5AEAA 5HYIA 3QNZA 4LK4A 4QT5B 4L9LB 2NUPA 4ORGA 4B41A 1UZ8B 1G9ML 3M88A 4XNQA 1MCSA 3SDAC 2FEDD 5D93C 5BPPA 3LIZL 1QO3A 2ZOTA 3GK8L 3F8UB 3X3GL 3DX8B 1AVAA 1VGEH 3S6CA 1W0WB 4G71B 3OHXA 4JX0A 2ZXBA 2DBLL 2ATPB 3EYSL 3FB7A 2R83A 3T4AC 2H7WA 5DJ6B 3CC5B 4HT1L 2YPKB 2YMXL 3QRGL 1PQZA 5AYUL 5B7FA 1F86A 3T2QA 5M94B 4TNFA 4YE4L 4LOUD 5FWQA 5C9KA 4NIYE 3QIWA 4CBZA 1KCRH 2Q8BL 3QUYD 2Y07L 4PGCB 3U1SL 4EIUA 3PWVB 1S9KC 3ATFA 2P8MA 2LTQB 1GKOA 2G9HB 4IKNA 4J3OG 4HC1L 3U1PA 4Y2DB 4ODSL 5I6OA 2HT3C 4LLVB 1EX0A 1KGWA 5JR1L 3MRJB 4Y88A 4HEME 1PLGH 2BDNL 5DJAB 1XZ0A 3G04A 4UV4L 4GI9A 4JVPA 3FCSB 5AW2B 5IWLA 5HGGS 2JXMB 3KLAA 2WSPA 3GBNL 4PJXA 1ACXA 4TSBH 1E9OA 1T21B 2FZ3B 4NRYB 3II2A 2CA3A 3QO1A 4I2XA 2BOCB 3T04D 2D03H 2FD6H 2OJZH 1SUHA 1M9SA 4JQIH 3LRMA 3ME0A 4KKRA 4WV1B 1AXTL 1MWAB 4DWHA 3IPBA 2DLEA 4K7PL 5E00B 3WLBA 2MCAA 3A24A 4K71C 4KUZL 2F74B 4AEIH 4GRLB 2H0EA 4OF6A 4R83A 3UYOD 3WUWA 2Z7ZA 4F8NA 3FTUA 1GYWA 4JFOA 3OKKA 4PGBA 3WKMH 3N1PC 4KKQA 5K1JA 1F4AA 4FTDA 5INDB 2JKLA 2BW5A 2E9JA 1HWGB 2HLFC 2VLRE 3KPLB 3QJXA 4DEWA 2Q1EA 2PO6A 2QMJA 3UYRH 2I27N 1MFBL 4JM2A 3L3OC 2BS71 4ETQA 1T3FA 3GLZA 2D0HA 2W91A 4AYEC 4DQOL 1AR1D 5AUMA 1YEIH 2J25A 3U9UB 4R84A 2NXYB 3FKUS 4XPFL 1BJ8A 1UQSA 4F9LC 4AG4L 3EGSB 1TEYA 1D5XB 3JTTB 4OLUH 2Y9RT 4OZGB 1DVTA 1HDMA 2IFFH 2ZX5A 1O7DE 1RV6X 2L7EA 3CX5J 4WI0B 1JTOA 3DBXB 3ZYIA 1QZ1A 3UBXI 4OSUL 1FVDB 2CLZA 4ZYKB 1O5DT 2H6UA 3LRSA 5ALBH 3VFSA 2IWGA 5HHME 5I0YA 2VERA 1E2VA 2VCOA 4FQXC 4ZW8A 1IGML 3ZO9A 2XQBL 4JO5A 5FA3A 3FC8A 2Y7SA 4NCC1 4FADA 2GITB 2N59A 1SHSA 3O3DA 4NQCE 3C08L 4G7RB 4P5MA 2BZDA 3U79A 4ZPTA 3S97C 4YVUA 5ADPH 1RUKH 1X9UA 1JPSL 2WTRA 3SBRA 3S5ZA 2BS8A 2MNJB 5K69A 4KXZH 3KHQA 4FKHA 2EH7H 2OPCA 3BAYA 2CGYA 3W81A 2IO5A 1IIKA 4UU9B 1NMAL 5AW3B 1U8IB 4WNQA 5F7DA 4BFIA 4J3WA 4EXKA 4PRHD 4NJAL 4OLWL 5HHPA 5GZND 2W80C 3WHXA 5JHDA 4R96A 2WXPA 3GZKA 3MA7B 4OI9A 5DVNA 3T3MF 3TOPA 4WI7A 1ZGLP 3LNEA 4TF4A 1BCIA 3KPPB 4OVVA 2EVFA 1CFNA 1LNUA 3MNVA 4UNIA 1KXTB 2R0ZH 1V3JA 4Y4HC 1XIWC 2V0AA 4FZEH 1COBA 4NKIL 3W3BA 1T6BX 3FOLB 5L4MA 1KSRA 1HVXA 3BH9B 3ES6A 3Q43A 4FFZH 3MJ9L 5KZCD 1TSRA 2HRLA 4UZSA 3BVXA 4KHXL 4UDTB 2AANA 5LB1A 5T3XD 2ZOLB 1HI6A 3REWA 5D7KE 4O2CA 5CWSB 2QQKH 3IDJB 2VXQA 5SWQB 2XX1A 5D1ZA 2WMPA 4WZ9A 3MLVH 1C08B 1IFHL 1ITCA 2OSWA 4M8VA 3IXAA 3BT2H 2LU5A 1N7MH 3ECQA 1WV7T 4FL4A 5B3SB 2AJVL 2WHVA 2YWZA 5J11B 4GQQA 1Q0EA 2A4ZA 2JB6A 1FAIL 3IPEA 4EI6B 4B9PA 3MNDA 3MNZA 1BM3H 1JI1A 4FKEA 4OLVH 2BXZA 3BE1L 4CMMA 2GSIA 2UWEB 4NI3A 5HYSG 5J6HB 4C56A 1HHGA 4EI0A 4S2SA 5J8OA 4EAEA 1QD0A 4ABWA 2DM2A 3KWTA 4P5KB 4JRXA 3EZJB 1C16B 1MRCL 1OCCB 3QQ3B 3OLGA 1NWPA 4MMZA 3NTCL 1HNFA 3SDDC 3WKPA 3ARED 1I4FB 1FYTD 4BZYA 3VI3F 1NL0L 2GK0A 1QLRB 2PYFA 2DQCH 1J8HE 1UKTA 4QXUH 5I26A 4L1TA 4U1SB 1Y1UA 5IHWA 1KC5H 3ZRSA 2WC7A 1Q9LB 1S5IL 2AMUA 3O4OC 4S1RH 5I8KL 2KZWA 3SJVA 3MDJA 1YMHB 4YLQT 3TXAA 1SHWA 4MCZB 1NCHA 3RVVC 3F01A 5K59F 3N0PB 1AGFA 4AL8H 5JOFA 4Y5XC 4L8SC 4XP1H 5BMFH 4PRPB 1SBSL 3KJ6L 3WDHA 5A2KH 4EN3A 4ZK8A 4MNQB 4AJYV 4S1QL 3C5ZC 2NX5D 4MA3B 4CILA 2EO9A 1JNLH 2DTML 3BRFA 2WCGA 3I9IA 4LHUA 3RU8L 4EZKA 2P47B 3VSQA 1WZMA 3DJTA 3H42L 3FT2B 2DWDB 3DSNB 3LAFA 5KVDL 4QHUB 4K3GA 2BX5A 5C0EB 3SKNA 1BF8A 4QD2E 3SPCA 3KYKH 4KH2A 4PV1C 1UADC 1U36A 4X5LA 1KZQA 4UYPA 4NKQB 1BF2A 2LVCA 4UI2A 5A2JH 3DTXA 1E27B 3MJGX 4NWTH 2ZUXA 5IW6A 4AE0A 2ITCB 1WH0A 4A68A 3WAJA 2L7UA 4XVUC 1HILB 1O6SB 5I6LA 1WEJL 3U0PB 3L81A 3VSTA 1OO2A 3VFRB 3TVMC 2VR4A 4PR5A 2HPOA 3VI4E 4C55A 4LSSL 5CEXA 4YX2H 3BJ91 5LHDA 1INEL 2CO4A 2A38A 1U8HB 2J2ZA 4TXVB 3W0WE 4FEMA 5BRZE 4HSCX 4I4WA 4DKFL 1IBBA 3ARYA 2GTZB 2WBXA 1I8AA 2GFBB 3PXLA 1NC4D 3QPKA 3QJTB 1ROWA 3V0FA 4BFJA 4QT5A 4L9LA 1J11A 1T83C 2VAAB 3ZE2B 3TIEA 3JWNC 1B88A 3BMVA 4UTBH 4GAGH 5IMLA 5F2FA 2NYZA 4M43L 4MDIB 4JN1L 1FRGH 3GPEA 3MV01 4KVNH 3ZK0A 4H20H 4XP6L 4N1EA 1FFNB 4MMXB 5TF1L 3MLWH 4QRPD 4RAUB 1MVFA 4TRPH 1AO7B 4GXFA 5AG8A 1JWSB 1GW0A 1FH2A 1KJ2B 3F58L 3A4AA 4M6NH 2NNRA 3RKDC 3DC0A 3N6YA 4R7XA 3TCXA 2VJXA 3PF2A 2ESVD 3DURB 3JWDH 4UANA 5HY9B 5DMYA 3MRFA 4YBLB 5T3ZL 1R3LB 1MOEA 1QWHA 3Q2VA 4MNGE 3V8OA 3FT0A 8CGTA 1Y7VA 3WBDA 2IAAC 4YL9A 2EECA 3PWVA 4YE0A 3JYBA 1AR2A 4HEMA 1AD0A 2YD4A 3BIAX 2RQEA 1K6QL 3M8OL 4E36A 4F1SA 2NNAA 3MC0A 4HAGA 4Y2DA 5F6IB 2IPKA 4LSTH 3PAYA 4LLVA 3HRPA 3RILA 4DSYA 1CLZL 4YDIL 4LF3B 4LFHG 2HRPL 2XZAH 1UWXH 4H2AA 5DJAA 2QKSA 3FCSA 3BGMB 3ILQC 1JZGA 4YZWA 4ALAC 1ZPLA 2FJHB 1L9OA 3GSXA 3R4DA 4Z9KB 3CDZA 4AGLA 1I3UA 1T21A 1U6AH 2XBZA 5D6CB 4NRYA 4FNLL 2BOCA 3GNMH 3UJIH 3MXWH 3MV7E 4JLRB 3VFMA 1P84K 4KK6C 5E00A 1ZOXA 5E9DB 4GRLA 4N2IA 5I73B 5KVGL 2M8XA 5F9AC 1NQBA 4M1GL 1A8JH 4LIQH 1MREL 5G55A 1SQMA 3KPLA 3CFJB 1J0YA 1XCTB 2VE6A 4K94H 2MTEA 2PP7A 4F57L 2J8UF 4RQQA 5HYJB 5E2UL 1PG7W 4ZUVA 5I1LB 2BHUA 4G1EB 3NJMA 1P9MA 3ARBC 3U9UA 4X6CF 1DSFH 3BVUA 3QQDB 3OHMB 3SZKC 1DZ0A 4OUOA 2K7QA 3EGSA 4M03A 1CD8A 1C8PA 3JTTA 4JE4B 4OZGA 2EKSB 4PJAB 4PGDB 4W4OA 1TTUA 4FLQA 3KLDA 1DBJL 3DBXA 3I6SA 4LCYB 2B4CH 4CVXA 1YNTF 1FVDA 3G5YA 4ZYKA 2BH0A 2FBJL 4RX4D 3RJQB 3K81A 1XGUA 2Q0ZX 4G9FE 1WA0X 4QRBA 1XH1A 1T1ZB 5DJ8B 3ZQXA 3QORC 4JO3H 4ELME 2N56A 5E0QA 2G2RA 3SBQA 2FQEA 2GITA 3T0ED 1KB5H 3OMAB 5FCSH 1HFUA 1VKXB 2BY2A 2VTFA 5EU4A 3OB0H 2EH8H 4UZGA 5DZJA 1UZGA 3EGXB 3TPUB 3RDTD 1FIGH 3PL6D 1U8IA 2DLFH 5C08E 3ZZ1A 5E6ID 2IVFC 1UWXK 5DURB 4L2YA 4CUCA 4TSAH 2IBBA 1XTMA 2NR6A 5ACZA 3WCYA 3T4YB 3LKPB 2W1NA 3ZQWA 5LO7A 2BRQA 1DBAL 5LBVA 1IEAB 5FX3A 4RZCB 3D08A 1YECL 1UKQA 1KXTA 1OSYA 2X9ZA 2IAMC 4AYID 1JHLH 2EABA 3QJSB 3O9WA 2XBDA 3SN6N 4NO3B 1A7BA 3QFJE 3BH9A 1NLBH 1TZIB 1XR8A 2RMNA 5AWNH 5DEZA 1INDH 2XJKA 5TQ0H 3MLRL 5FO8B 1TETL 4XBGB 4YOKA 5IEHA 2FEDC 2OMUB 3M6DA 3MYJA 2ZXDA 4X5PA 3SCMC 3ISWA 2NYYC 2ZOLA 1XH0A 4OJFH 1F97A 3RG1C 5CWSA 5ACLA 4KRPC 3TNMA 5SWQA 1OEZW 3EGDB 1C08A 3P11H 2Z31D 2N0MA 4AEHH 5DHVH 4RGNB 4P2RE 1DL7L 3FB6A 1GCYA 3KYOB 4RRPA 1NCCL 3EAKA 2RFXB 3VSUA 3TJEH 3HI6H 5A6LA 5EF3A 1KCVL 2NXZD 1T5KA 3GSVA 5F1NB 1SXBA 4JHWL 5ADOH 5AAWC 1ZA3B 1IZJA 2JSFA 3Q01A 3QWNA 4MS8C 4L4TE 5GGTL 2WVSA 5DZNA 3LZQA 1CGTA 2W92A 5J6HA 4YWGH 1JNHB 3ZU8A 5DJDA 1T5XB 1S7VB 2YGPA 3W37A 4ZOAA 3VTAA 1Z9PA 3UJTH 3QQ3A 1PZUB 3DX6B 2GIYA 1YPZF 3MCLL 4J27A 1MCJA 2FL5B 3B9EA 4M8UA 2DICA 1NAMB 3DRTB 1WF5A 1I4FA 5GS0L 1CXLA 4HIJA 1V27A 2X6CA 5F9DC 3IFOB 5BQDA 1AGEA 2NY7H 4Y4KB 4U1SA 3V0HA 2QSCH 5DFAA 3T3MB 2VISA 5SWZB 2K9UA 4W81A 1BZ7B 2XWRA 3GHEL 4MXWH 2ZJSL 1NAKL 4MCZA 3G6AA 4UQBA 3MRDA 4WWKB 3HFML 5AW0B 4JJOA 4KNUA 3OG4B 1AOHA 2H8PA 1PBYA 1L9MA 1CS6A 3QG7H 1MY7A 1T1YA 4PRPA 1JFQH 2BW4A 3DGGB 4OV6F 1AXIB 3ML8A 1N68A 5BS0B 3UGEA 2WKOA 4MA3A 2EDKA 2AQSA 5TE6L 3QDGA 4HQQL 1E6OH 3T6WA 5F96L 1NBYA 5HI3C 2D3LA 3V5KB 1G7JB 2AGJL 1YYCA 1RURL 2DWDA 3DSNA 1KXQE 2DMCA 3L08A 4QHUA 2AJUH 5I24A 5GZOA 3PGFH 2ZCHL 4CVUA 5ETUA 2PR4H 2Q8AH 4YR6B 2LLNA 2KERA 3K4ZA 1GJUA 1KOAA 3GLEA 1MLCB 5LN4A 1AR1C 2G2NA 3VI4A 1BZEA 1E27A 2F08A 2R1XA 3ZKMD 3IDMB 3KEDA 5I6XB 2APFA 2OX5A 3UTPD 3U0PA 2OR7A 4MB5A 2VUOA 5E8PB 4Q6IC 1E42A 3VFRA 4LLYA 2M26A 2IGTA 3HJEA 3W39B 2ZQKA 1QSEE 1MCOL 4OT1H 4DGUA 5AB1A 2EDYA 1IT9H 5FF6A 2BC4A 4ATWA 4ZSOB 5E99L 5G5DB 2GTZA 4GMSH 2NW3A 5CO1A 1OQXA 1KGXA 2KLRA 3WFDL 4U4BA 1MW0A 2A99A 5BV7L 5SX4I 3T5WA 3FU5A 2QVKA 4IRJB 2ZUQC 2A74C 4MSWB 1HK6A 4GG8A 1W16A 3U36B 3LSOA 3RLSA 4I1PA 5GRXG 4MDIA 4GO8A 3VI3E 5IHUH 4AYSA 3B5GA 4MMXA 1HH9B 2OQJB 2BVTA 4RAUA 1AO7A 1DQMH 4KZDL 1KJ2A 2KS0A 1DLFL 1V05A 5ILTH 1FZOB 3AM8C 4A7VA 2KPWA 3L17A 5HY9A 3DURA 3RVXC 4XO5A 3VH8A 3WJLA 2WBJB 3FQXB 2BSSB 3CXHJ 4D8PB 1AIZA 1EJ8A 1QP1A 3B7YA 2QHLA 3QRLA 2HX8A 5E7BA 3EDJA 1SGKA 4YDKL 2RGSA 4BZ1H 1WS7A 5ICZA 3SGDI 4FZ8L 3F5WB 2F18A 1S78C 4N9GA 4DK5A 5IP4A 5SWSD 3MBXL 1DCEA 1MFMA 3MV7A 1TVHB 5JZ7C 2J55A 3BGMA 2N7SA 4B5ZA 1CL7L 2FJHA 4RMQA 5ISZE 3D1MC 1GYAA 4B9JA 2CD0A 3WNMA 4YLBA 3U6RB 2CIIB 5D6CA 3GFUA 4XNUH 2R69L 4MS6A 4QEGA 4KUCD 4DP7X 4OIFA 1KXHA 2BIIA 1E7VA 2E6JA 3OX8B 3ISRA 3FT3B 4JLRA 4URTB 1T03L 3X1FA 4K73A 4NFDA 5E9DA 5F7WC 4NQVB 1M42A 3TU6A 5KTEL 3H56A 4O02B 1DQLH 1QLEL 1QRNB 4G42B 5JYMA 2A9BA 3DXAD 2V5MA 4ZW5A 4JG1L 5EWIH 4YHMH 2ZCZA 1YYML 3UTZB 4AH2B 3CFJA 3QXDB 1VAHA 4D9LH 1F4XH 3OMZA 2X1QA 4PWGA 5T5NG 4B3EA 3GSNB 3FRUB 5HYJA 3HB3C 4ODHH 5FB8A 1AHMA 4NP4H 3VWJC 1VACA 2WIIA 4JMNA 4MYWB 5I1LA 4KKLD 3APFA 3MAWA 2KQNA 4N4YB 4IRSC 4WNSA 4FHJA 3ZXAC 3PGCB 2Y2TA 3F7VB 1WFMA 5EEZA 5IQ7L 4PHXA 1DSWA 4G9FA 4NZDA 1XF2B 4KPHL 1E4KC 1FYHB 3TWYA 1BMGA 3ULSB 2CCLB 2EKSA 2DYPA 3A67H 2EVGA 5EV7A 2VIRA 1AS7A 3BJLA 4LCYA 4BH8A 2DIBA 2BMKA 2I9LB 3BGAA 3U6XS 3TONA 4M4PA 4HVBA 5E1GA 3DO7A 5DC2A 1T1ZA 5FUZH 3GSWB 4FQLH 2WP3T 4HKBB 4YDLB 4R8WL 1JNJA 5FYJD 1ZT1B 3P0YH 4D9RE 5C08A 1GRWA 4HJ0D 5D1QB 4L4JA 4GFXA 3BDYH 2UXFA 1IV8A 2CWRA 3TPUA 1VDGA 3L3IA 3MUUA 5E51A 1QQDB 1N6UA 5HPMB 3TO2B 2JB5L 4R90H 1A6UH 1S7WB 2AMGA 3RWHB 3AUVA 3LB6C 4UT6A 4Z7NF 3BXNB 1G9NC 1XF5B 3LKPA 5EBLA 3RVUD 2UY7B 5FW8A 3QFJA 3QO0A 5I5JA 4AKPA 4L3ED 1IEAA 4PS4H 4WO4C 5C70A 4LU5L 5IHLB 1OGTA 4K7PY 4NO3A 1WBXB 2J8UB 4JZJA 1CT8A 3I9GH 2EE3A 6CGTA 5FO8A 1ANUA 1F02I 3L5HA 4XBGA 1D5IL 1RVFL 5C71A 2OMUA 1CYWA 25C8H 1NMCB 5FGBA 4X6CB 5JXED 2N1KA 1TTAA 4P2RA 2IMMA 3BFOA 4N86A 1JGIA 4OCXH 3HLKA 1UM6L 2EDFA 1OPGL 4XH2A 1FBIH 2A9DA 3KAAA 4AYBA 4L4TA 2P24A 2JIXD 3ZE1F 2F7IA 4XVOA 2NDGA 3LPGA 5CCGE 1AH1A 4K9EC 5E5MA 3FMGL 2X6MA 5KG9A 3GIVB 1ZA3A 1E4XL 4IJ3C 2VAJA 1IAII 1A3ZA 3G9AB 3RL2A 5JA9A 3VRLF 1ED3B 1P4IH 1HEHC 2R0WH 3I85A 2APVA 5E23A 1S7VA 4Z3HA 3HS8A 3U7YH 3IDNB 2YA1A 3DX6A 1E67A 1VFAB 1F41A 2C9PA 3EBIA 2F54B 5HGBB 2AABL 2FL5A 3HAEG 4PU2A 2C9VA 1Y18B 4ESKA 1UJ3B 2DMBA 1TCRB 5AOLA 4BGLA 3IFOA 3OPZH 3ARTA 4Y4KA 3FUDA 1MHCB 4N6RB 2DL2A 2JI2A 2ZG3A 5SWZA 4J4PC 2EEXA 4Y9BA 1BZ7A 1LO2H 4HALA 1GC1H 1OL0A 2ZAIA 1G43A 1F1GA 5DHYA 3CCHB 4J3OD 5HGAA 4HOWA 4WWKA 2BNUA 3DX4A 4MCYB 1RHFA 3CPUA 1NGWB 4IKLA 4QYOA 3VWKD 3VXMB 4HCRL 1KXQA 3DGGA 5BS0A 4GI6A 2ATAA 3O6FC 5JUEL 4Z7QE 5IJKA 3SDAB 1OAZH 3RTQD 1NWOA 5TF0A 4GFTB 2ZUUA 5DRXA 2X4SB 1F18A 3V5KA 5GGQH 1G7JA 3K2UL 4W9LC 4HIQA 2AK4E 3AUWB 2XTLA 2YPVA 3EOAA 4HFWB 1HHJB 4YR6A 3A4EA 2H0PA 2NTFB 3C8DA 4FYQA 3H7LA 1CWVA 4IHBA 3RZWA 3RYMA 4QR7A 1MLCA 2PMZA 5KVEE 3AC0A 4KMTL 1KB3A 2ZTBA 3LKRB 4D3CL 4DIXA 3QFGA 4JM4H 5F3BB 5KYUB 5ICYB 2A5UA 5ID0B 3IDMA 4MD0A 4JGJA 4K8RD 1RUAH 2FSDA 4QXTB 4G82A 4BXVA 2LQRA 3HMWH 3HE7C 5C09E 1MCPH 4FXKC 4HKXA 1T1XA 3F64A 3OKOA 2G60H 4U1GC 1MFAH 3KBEA 2ZKXA 1MCRA 1CDJA 1QLFB 3O8XB 5DD5H 1XGYH 3BDXA 5E2WH 3X1NA 1N0XL 1BIIB 1L0PA 4KV5E 4KI5D 4N3UA 4P9HL 2HAZA 2WCSA 2VDPL 3GGWA 4U05A 1GY2A 3T0EC 5AZ2L 3VI3A 4ZMTA 4IRJA 2VSKB 2DQGL 1JUFA 5DHMC 1YPZE 1WD9A 2WGXA 1A66A 5ESAB 3GSOB 2QQNL 3RDTC 1P53A 4O2FA 5HXMA 1RZJC 2WXIA 3MRKA 4ZFFB 1PX3A 2VSDA 1G6VK 4U49A 3QHZH 2YQGA 3AGVA 3QIBC 1WFUA 3TV8A 1CCZA 1P6FA 2PWFA 4NQQA 3UACA 3O3AB 1ZE3H 4K71B 4Y19E 4KY1L 3I50H 5E94B 3EOTL 4KKAD 1FZOA 4KGJA 3IMRA 1ZTXE 3QG6B 1XL4A 4BK5A 3N04A 1JTPA 4B0MM 1SXSA 4N2LA 2E74C 3FQXA 2FVNA 5JPNA 2NZ1A 2BSSA 1SHXA 1YCSA 3QR0A 4H1LH 1KPVA 4HPOH 3W2DL 3D0LA 1SQ2N 1RMFL 2UVFA 2EQDA 1KTBA 4O51A 4UUJA 3S2CA 2D9QB 4DP0X 2P43B 1E5BA 1I1AD 1UA6L 3NFPB 4IBLT 4NAQA 3DVFA 4XAKD 2QELA 5ISZA 3ZO0A 2AJSH 2HMIC 3BAEH 3F5WA 3C5JB 4PAZA 1HOCA 5J4MA 3NZHL 3MV8E 5DVOA 1W0YT 3D9AH 1QFWL 4NYLA 2LVEA 1X9RA 2WKGA 2OXGB 1MIEH 1U91B 2NY2D 4X6FB 3U6RA 1Y6NR 4W9HC 3ALXA 3OF6D 3MX0A 4FQXB 5F0LB 2NXZC 1MFCL 3OX8A 3CZNA 3FT3A 3QHFL 5L4IA 3K0YA 3AU1B 1NSNL 3BAJA 1IJNA 3C5SB 4NQVA 1CD9B 1KIUA 1FPTL 4O02A 5IESH 2FIKA 5IHZB 4L8CB 4MB1A 5GRWA 1DAQA 2CH8A 1IX2A 2LU4A 4WO0A 4X4ME 4GT7A 1AHWC 1L0YA 3NVQA 1CL7I 1A7RL 3GSNA 3X12A 5LAPA 1QYGL 4JKPL 1WFTA 2Y7OA 5TH2B 5M7QA 4EI5D 4X42A 5H37G 1LYQA 4G6ML 3CN2A 5DQ9B 3ROLB 4IBYA 2Q7YB 1TVDA 4H88H 3VXUE 1XF2A 1TNMA 2ZCKH 4HIIB 2NY5L 4MASA 5ES4B 1YEHH 4Y4HB 1EH9A 1NCGA 4ZX5A 3KPRD 5DZPA 2M1KA 2UY6A 4B50A 5L9DL 3NA4A 4A38A 3L3KB 5D2LB 3GRWA 2G5UA 4TLKA 2CZNA 3CWGA 3IMTA 5I30L 1KYDA 3FO2B 4LSUH 5GGSY 2J6EA 3GSWA 4HKBA 1N8OE 1CD1B 1OP9A 1UA7A 2B7DT 1ERNA 2ZKYA 4FGMA 4M3HA 4YXKH 1ZT1A 7TAAA 4G83A 1QVOA 3FF7A 1OT1A 3VXSD 2MQGA 1MCFA 2AXWA 4LPYA 1VFBB 4XN2A 5EU3B 1BOGB 1FVEB 4N0RA 1HINH 4P2QB 1A7NH 5KYXB 1JPTH 1T89A 4PIBA 1QQDA 1R19A 3IKCB 4ONFH 2UX7A 3A6OA 5DRZB 5TJWK 1KCRL 1QKZL 3P77B 4MAYA 1RCYA 5CP3H 1PZ2A 2NCMA 3DMMD 3BXNA 4ZFOB 1XF5A 3BAWA 1L9NA 1FCGA 4WKZB 1QUNB 2X3CA 1LWHA 2F5AH 1JBJA 3WMQA 2BCKB 2CIKB 4OZHE 2BWIA 3TV3L 3ASNB 3V7MA 5D6DC 3SDDB 3IDIA 5DZLA 3WIAA 5A3IC 1W15A 5I19L 5MP6L 2J8UA 3P4OB 3KLQA 4P05A 2C4XA 2W38A 2GT9B 4ZUTB 3EYOA 1N12A 1KB9J 3RGVD 2X4UA 4X6CA 3L9BA 3D3VB 3O4OB 2PR9A 1X5LA 5TPWH 1NC2B 2DLIA 4UOJA 4FQ2L 1CXKA 2JCCF 4X6DF 3BH8B 4L1DA 3B8YA 1G6RH 2FHBA 2X7LA 4Y5XB 5MEND 1NUDA 2QKIC 4OZFB 1GXEA 1J1PH 3EH5B 4JFSA 1RH8A 2YD0A 4G6AC 3L95A 3EDFA 3C5ZB 3CVHL 2P44B 3FS9A 3IAQA 4Y1AE 3UL4A 3GIVA 3UPRA 3L8QA 4P2OD 4RIRB 2HZHA 4DW2L 1ZVNA 5CJQH 4PSPA 3BKYH 1XCQB 2R56H 5E08H 1IL1A 2G5BB 1E90A 5I6PA 4LNRA 4KKBC 4H26A 3LIZA 3UH8A 4N0FA 4MLSA 1CICA 2CNZA 1EZUA 5DFVD 3CDYA 4BRJA 3RWDB 1IKFH 4OCYL 5D1XC 4PJDE 5HGBA 2BP8B 4PLKC 3CDCA 5H4YA 1TCRA 1KV3A 3DKHA 4WSJA 3ECWA 4Z7NB 1N8ZB 3L3HB 5ABDE 4N6RA 3TVMB 5C0ND 2CLVB 1E3ZA 4DPRA 1A3RH 1A6PA 2WN3A 4NQSB 4Z3FA 1TQUA 1W2KT 2WY3B 3N41F 5AVWB 2UXVA 3WD5H 1T6VN 5I1KL 2EIKB 5B3JE 1FFQA 1RUKL 2YA0A 4WENB 1EHLL 4G6FD 4YSCA 2AK4A 4Z7WF 3WY1A 1FWXA 3NDZE 4HX1A 4FS0A 4JRLA 2AKRB 2VR3A 3QPQD 2YD9A 4R7VA 3NSDA 5T3ZE 4AV0A 1QTYT 3U0TB 1KEGH 5DMJB 2BVQA 5IT2L 2OSLB 2V8MA 4UAOC 3RWJB 5DUBB 5E70A 5FEBA 4FTVE 3I6KB 4HFWA 1FG2A 2A83B 1A9EB 1HHJA 2ITEA 4NFCA 4XO3A 5C09A 5ALCL 3ZE1B 3MLXL 4WY7H 2PTTB 5F3BA 1U3HD 2E9GA 4JRYD 5LNDA 1MJUL 2G3XA 2R0ZL 4H7VA 4R2GC 2WLYA 1NKOA 4XE5B 2IC2A 4FZEL 2DJUA 4AYFA 4QXTA 1ID2A 4G7YL 1TVBA 3OSKA 4NKOA 3ARXA 3BZFB 4O2EB 5EU5B 2DN7A 3OKYA 4UYQB 2VR8A 3O8XA 1QLFA 4UCFA 2XWZA 3BOVA 1BIIA 3NJGA 3C09B 5T1LD 4X99B 4UM9A 3OJMB 1S4IA 1YPZA 3VCLB 2RCSH 2X42A 2QQKL 3O11B 1DEDA 2BK8A 5BZWB 4F1ZA 5JLZB 5F7NC 2VOTA 5EO0B 3RY6C 4HU8A 2Y1YA 1WT5C 1IC0A 2OTUB 1N7ML 5CSZA 4OH2A 1U8PA 5AVUB 3QZPA 2AFNA 4Y19A 5SX5H 3X1GA 4HMCA 3KXFB 4B9GA 4JFFB 2XJLA 5G2NA 1V5JA 5CCKL 4NM4H 1I1FB 4FLRA 2VDRH 2V9QA 1UYWH 2JQAA 4LRNH 4WHTA 1GGCL 3BDBA 2OTPA 3STLB 1E40A 3BD4A 1F11A 4HIEA 3W82A 5E6UB 4L37A 3RVUC 3G5VB 5ELIA 4N2OA 5EUKB 1KDJA 2WVVB 3DTUB 4FERA 5EA0H 3C6LD 4Q9RH 4JHAH 5DD3L 2DPKA 5FYJL 5F7KC 5DC9B 1WZAA 1AZZC 1BYNA 1JE6A 4KQ4H 3EDKA 3RDJA 3L1OL 1YN6B 4OGQC 4A66A 1KY6A 1F4HA 2HP4A 3MRRB 4UAHA 3MV8A 5MEQB 4M6ML 5JXEC 3ARBB 3NFPA 1U30A 4PY7A 3EJZC 4JFED 1C12B 4AY0A 4UOW1 3LCYA 4JO4L 2BZCA 4N5ED 5FO7A 2XNAB 1RQ5A 3BESR 2XA8H 1EQWA 1MEXL 2OXGA 2YPLA 3FH8A 3GC3A 3NN8A 4X6FA 2CRZA 3L7FA 5I18H 3HBQA 3BN9C 2EILB 1G9EA 4NAMA 4H0IA 1OY3B 2PPCA 4OZIF 4E41B 2VITA 2XQ0A 2DQTL 1JGLH 5CUSL 2EDQA 4YJZL 1S7UA 4NP9A 4EXPX 4JBSA 3K6IA 3BQUA 2DMHA 5D8JL 1XMWA 5D72H 2WO3B 5IHZA 1E4HA 5KANI 4L8CA 5TE4H 5DK0A 1R3KB 1Y07A 1IC4L 5DGQA 5DS8B 4PJGB 3OJVC 1YYLH 4NWTL 4OF0A 5HHOE 3D39B 4D0DA 2XPGB 3CFDA 1FL5B 1V3LA 1N6QL 1EO7A 1JF1B 1UFGA 5CS7A 3N0AA 3ZL4L 4U1MA 2MHAB 4ZMQA 1XGQB 3AMLA 3NRFA 5D4QA 5TH2A 1Z9LA 5SX5K 4ZNEE 4PN6A 1FL6A 3H3KA 1MNNA 3SE9L 5DQ9A 3ROLA 4U1IB 1R33A 4FDWA 4K5LA 5T1KA 1S3KL 4NRZA 1NIDA 3WNNA 2I32A 4BFFA 2IAMB 3S34L 3C60D 4Y4HA 3LS5L 2VXQH 5BRQA 4GPVA 2CRYA 3RA7L 5FECB 5JHMA 4J3VA 3WDJA 1IQWL 1V3KA 4JFXB 3FO2A 3SCMB 3J2PA 5C0RL 4H8VA 1HXMA 1CD1A 2F6AA 1Z2KA 2J56A 1QNZH 1FRGL 2WZ5A 3FT1A 4XCYA 2ODHA 4KRPB 2H5UA 3HR6A 3ZZLA 3Q1SH 1CTNA 4PTUA 3SGKC 1VFBA 5EU3A 1BOGA 2YXVA 4X0NA 3LN9A 1CGSH 4P2QA 5KYXA 3KW7A 4I8DA 2XN9D 5AW5B 4GBXA 4R4FH 4QRUB 1DVSA 4AYDC 3IKCA 2E7HA 3UEZA 5DRZA 4E5XA 2QV2A 3NP3A 3P77A 1HJBC 4K8RC 1QPKA 4F27A 1NKGA 1H3GA 4WKZA 4QUOA 1QUNA 2VDNH 1P5UC 3QUYB 2IFGA 1KMGA 1EWHA 5I1GL 2BCKA 3KPSD 3H9SD 1GIGL 2CIKA 4HEPA 2VN4A 2EP6A 4KI5C 3IMVA 3MXVH 1G1YA 3QDHA 4P9MH 4PV8B 5J6SA 5F1KC 2F9BT 2H2PD 2MOQA 1VPOH 3P4OA 3C2SA 2J3SA 1DAVA 2Y25A 4DGVH 2I07B 4OD3L 4WKXA 1PLBA 2YRPA 1LK3H 3PGDB 4Z7VF 1VRSA 3D3VA 4N2EA 3NEXA 3U4EB 3COOA 2MPVA 1RZQA 4JFYA 1KN2L 5FFOA 1XTLA 1JWUA 3BH8A 3G5XA 2EVHA 5CIPB 4Y1AA 4Y5XA 2Y06H 4F2EA 2XYBA 4OZFA 3TBYB 2L7JA 1CGXA 4LLDB 1S9YB 3EJRA 4I3GA 4LIQL 1UATA 2IBGA 3TIDB 5DTFB 2KT6A 4I1NB 1CU4L 3REVA 4HF5H 3PU7A 4J6RH 2WJ5A 2NUTA 2DQJH 2UZPA 4KU1A 4Y9GA 2UZXA 4FF9A 3NCBB 4KK5D 2EICA 2YSTA 3TT1H 1AR1B 2X12A 1N3NA 3RWDA 3SE8H 2YWYA 1MWOA 5FW6A 3FTXA 4KNTA 4HOMA 2DDQL 3B9AA 2J88L 1QFHA 1ZV9A 2W0LA 1MHPH 4Q6IB 4DP2X 3TVMA 3R0NA 4JHVA 4NQSA 4A37A 5AD0B 3N5AA 4LDOB 4PGEB 2DQ6A 3JWOC 4YZFF 5KS9E 2P4AB 3FQWB 1X5ZA 2C1OB 4FNPA 2FBOJ 4E9LA 3ZT7A 2BY1A 4NM8H 2W60A 1YVLA 3BKJH 5EO9B 3I75B 3DJ9A 1KJ3H 5EOQL 1BG1A 3V6ZB 2I26N 2EH8L 1X6NA 3SKJH 2XV6B 2D2CC 3VXOB 5ANMB 1T83A 3BAXA 4S0TD 2Y24A 1CG9A 4ADGA 4Z7UE 1UEYA 2A1WH 2A74B 2K45A 3K6DA 4X7CC 2DLFL 4ILDA 4PVNA 5IM7B 5DO8A 4IGBA 1NFDB 3I6LE 2NY4D 3G5WA 1SLVA 4Y0GA 4YSOA 3GJEA 3TPKA 5I8CB 3NFSL 5EC2B 1A1NA 1OAQL 4PRHB 5C92A 3SO5A 4HXAH 1XF3B 4EI5C 1YY8B 4BEIA 3FPYA 2RHEA 1F0LA 2JCCE 4X6DE 4YUEH 4MRCA 1JYWA 4Z3JA 4YDMA 1NEZB 5J1TC 1PKOA 1CE6B 1DVZA 3KYAA 4QRTA 1INDL 5AWNL 1E28A 5D7JD 2N7AA 4KBPA 5EU5A 1AXSB 2EADA 3B1TA 3IXTA 1NBZB 4LVNC 4UYQA 1CXHA 3ZKXC 4JFTA 4JPIA 4A63A 1XB6A 3OMNB 5MI0C 5KZCB 4X99A 4LE8A 4OJFL 2E7MA 1HSBB 3MLTA 2ZKHL 3LXUX 4BCXA 4BSVA 3VCLA 5L0QC 3W39A 5PCYA 4PFEA 4IDJH 4KY2A 5BZWA 5JLZA 1Z0MA 2B08A 5EO0A 2BSDA 4I0PD 1TIUA 2OTUA 2Z8WC 4WHCA 3FFCE 4E9WA 1L7TH 4AEHL 4ZMZA 2O6DA 2JKJA 3HNSL 4PM1A 3KM2A 3HI6L 5E2VH 3B1UA 1WBZB 1I1FA 3MN8A 1W72B 4HIHA 2A9MH 3KPQA 3BX7C 2AJYL 2IDSA 1KXVC 2WQAA 3HG2A 3L45A 2EIJB 3GRGA 1PG7X 1YEKL 3QDJE 4YWGL 3FUNA 4YFLF 2W0PA 4HJTA 2O6FA 4CSZA 3ARZA 3NIDE 2Y5TB 2J1XA 2IH9A 2XFXB 2WWOA 4HD5A 4O9HL 4X9HA 5EUKA 2UUDH 3FRPG 4EE2A 2EYRA 1FVCB 2F53D 3L6FB 4Z7WE 1ESOA 4YHIB 4XCNA 4P46C 1YN6A 2EE2A 4K7FB 3RNQB 4BZ2H 4FNUA 3MUZ1 3TN0D 5L8KB 1NPUA 1E9PB 2FT6A 1C12A 1FYTE 1RJCA 4FXTA 2ENQA 3W0WB 3BZ4B 5AB0A 2O5ZL 3QG7L 4P4RB 4R0LC 2WUCL 4M62H 1E5UI 3QNXA 2XNAA 4WEBH 3QUZC 4JCLA 2Q20A 1E6OL 2R4RL 3MNWA 4P5TC 4TLSA 1TJHL 1ZHKB 3PWUA 5CILL 1KYAA 3RX5A 1AQHA 2J5LC 4NO5A 2HH0H 4E41A 2AJUL 1NOLA 4NNPH 4BFKA 3MO1B 1NCAL 2PR4L 2YMTA 5AAPA 5JA8B 1JTTA 4WCYL 2NX5E 1JCVA 3OKNA 3VNZA 4C57C 3HZKB 1R3KA 1T5WB 4KTEH 1ADQA 5DS8A 4PJGA 2P5EE 4ZNEA 5DFVC 1MZYA 3D39A 5F0PB 2OYMA 4LP8A 3GS7A 4DVRH 3PPEA 2XPGA 4GIPD 1FL5A 1I7ZB 3GI8L 2ARJQ 4DERA 1V8HA 1BZ9A 1PL3A 2NLJB 2MHAA 3TO4C 3MRIB 1B0RB 4ONOA 2EE0A 4OT1L 4ACPA 5C0NC 3MOQA 3ULAB 2V2TB 1I3GH 4GYBA 3QWRD 2XG4A 2CO7B 2Z8RA 4U0QB 2YBRA 1SLXA 4KUCF 4OGYL 4WO4B 1CK0H 1WVZA 2XHNA 5F6HI 3NOIA 4MGXA 3V6BR 4JPKH 5GGTA 3VB8A 2X6AA 2FEEL 4DFHA 1KJVB 3WS3B 5CZVL 2JNKA 1NC4B 1CDYA 2F7OA 3FOMB 4P8QA 3V4PL 5FECA 1MDAA 4I77H 4JFXA 2CK0H 2UUDK 2CM5A 1RPQA 2C9UA 2ADGA 3GI9L 4W4NA 1IM9B 1QMUA 5AVZB 5B7MA 5FV1L 2ZWKA 12E8H 1T7XA 1Z5LA 3LEYH 4IOSD 4MA8L 2CDEB 1MFDL 4WWNA 1OF0A 2LLLA 4QRPB 2YQBA 3OKMB 1SMOA 4OJAA 4X9FA 5CMAB 3R06A 1H9VA 4N8CH 1M6OB 1II4E 3U1QA 4YHZL 1JRHI 5J9PB 3RZCC 4B53A 2ESVB 2DV6A 4OZIB 1XV8A 2D7MA 4DK3A 1CDBA 1HAWA 1N10A 1A6WL 4ZTOH 3OQ3B 4IJ3B 4J39A 5F71A 3MOAH 2E9WA 1ETB1 1QWNA 4PY8I 1UB6B 3UC2A 3KLKA 1WAAF 3QUYA 3VQLA 5J6GB 4GKSB 1UVQB 2D3JA 2F19H 2Y7NA 5A2FA 2X9WA 3FU8A 1DP0A 2VDMH 2KZBA 4G5ZL 4ABVA 5BRPA 4R97C 4YHOH 4H5SA 3B2VH 3TX4A 4DO4A 5BXFB 4L5FL 1Q9KA 3MCKB 4K55A 2CLRA 4CSSA 2ZX7A 3NSJA 4X7FC 2I07A 3HRZB 3BVVA 4LL1A 3I02B 3STBA 2YUZA 3H6JA 3TJHD 1ILUA 3PGDA 4XNUL 3R7QA 4RFOL 3MRBA 4P3CH 3T2PA 3ARFC 4QHNB 1TO5A 1FIEA 3S3BB 3U4EA 4OCSL 1J88A 2XZQL 2MPAH 4TOYL 5AALA 1NOFA 3FDWA 4QTIH 5CIPA 3FJTA 3LKSB 5IF0B 3E38A 3TBYA 4OGZA 1VCBC 4BE6A 3BEVB 3P4MB 3TIDA 1ZD6A 1F4XL 3F7PC 2VLKD 3U46B 1TJXA 3BWUC 3C6LC 1R0AL 2VLLB 3VGFA 1SDAB 1J0HA 4A2LA 4DH2B 1GGBH 2CDGB 1JGVH 4XHJD 2BRRH 5EC1B 4F37K 3US1A 4LCWD 4DJMA 5D7SH 1L3WA 1YEEH 3B2MA 4RSYA 1BQRA 3WY4A 2ZXEB 3UERA 3ZYOA 1KLGA 4XOCA 5IIEB 5LQBH 4OM1H 5FDWB 2B59B 2VDOB 2JI3A 2EUWA 2ICEC 4DAGL 2R39A 5IROD 1T0OA 4N5EC 3HE7B 3UBXG 5IW3A 1WZKA 2R29L 5F70A 4ZQTA 4EIGB 2BHFA 2C9RA 4U1GB 5AD0A 3T0XA 1TITA 3AWFA 2K78A 1Q1PA 2C1OA 4PJ5E 4W68A 5IOKA 4AE1A 3NZ8B 1K4CA 4A7GF 3JV0A 4TPRH 3SB3A 4BQBA 1OAJA 3S4SA 4M5ZH 4D2NA 5JOPD 1TOXA 2FLBT 4M56A 2GJJA 1CD0A 3TA3D 3T0EB 4MJ4A 1ZMYA 3OAYH 5ANMA 3WFBH 4DZ8B 2VR7A 5EOTB 4FCHA 1KJ2H 1KUMA 3TZVC 4K5OA 3ORJA 1FQ9C 2VC2L 5IM7A 4NRXA 3RDTB 4X6DA 4OJEH 1NFDA 1IAOB 2BSED 4TLTA 3QIBB 5EC2A 4PRHA 1BFTA 4Z7VE 3SKUD 3ZUCA 3MJ7B 5GZNA 3D4GA 1P4LB 1IFRA 3BZ5A 1XF3A 2F15A 2AZAA 2PWGA 3O4LE 2R69A 2QLVB 1LEIB 1X4ZA 4M5TA 3WOVA 4RMBA 3IDGA 4J3OF 5IR1B 5IMMB 4GLRI 1DN0A 1NEZA 2PCPB 4R26H 1NCTA 3MU3A 4TQPA 2ADFH 1OW0C 3D18B 1X7QA 4PJFF 4LDCA 2JELH 5DHEA 1OGAD 25C8L 3MUJA 1PF3A 5IQOA 3TEWA 1MCQA 1TKWB 2AEPH 2XLLA 4HWBA 4UINH 1IBHA 1F6FB 4M9PA 4R7DB 2WO2B 4CKQA 2H4EA 1BFOB 4UNTA 1G1CA 4JNXA 1JMXA 3DUUB 4NHCH 5E1IA 1M4KA 1DDTA 2OFQA 4L4VD 3O45A 1YEDA 4N9OB 4QCIA 1EZVY 3M45A 4H8WH 2WAHA 5F44A 4BWWA 1WBZA 4UBDD 2XQYG 2EUZA 2JI1A 4ZD3H 2EDNA 1HOEA 1W72A 1HYSD 4BKTC 4Y4FC 2B20A 2FATH 2NXZB 5JDSA 2DJMA 1EHXA 2UZIH 1PVHA 4NI6A 1EJOH 2ZXGA 1MRDH 3VFUA 1B6DA 1FZMB 4Z7WA 4YHNB 4YMPA 5C0CD 4KMQA 1FFOB 1QTSA 2XFXA 5SV3A 4WUUE 3RIKA 1GTFA 1MI5E 1CR9H 4AQOA 3JVGA 3L6FA 3QYMA 5DGRA 1I8KB 3AREA 3OPZL 1BD2B 4DN3L 2Q7AA 3FQTB 1FYTA 4IBVA 2P5WB 2DQDH 4GRWF 4M00A 4K7FA 4ZFQA 1Z66A 1FG9C 1TEFA 4LARH 5FUOH 4RESB 4M6AA 3KWWB 4UIKL 3C87A 3S5LA 4A2EA 3SOTA 1JZFA 4NQDD 2FK9A 2FIRT 1PKQB 2QSQA 1E9PA 3QB7C 4E9VA 3ABGA 4X4ZA 2ZICA 1OHZA 3ZTJH 2B9AA 1X4XA 2AQTA 2TRHA 2F7QA 3D85D 1D7FA 3H55A 3IJ9A 3MACH 4KOCA 1EEYA 3RE0A 4Z77A 1SM3H 2Q76B 1OAZL 1ZXQA 3NCJH 4A7UA 2NX5A 1ZHKA 2WXFA 5CZXD 1BJ1H 3B7RL 3BIKB 2Y6SC 5CGYD 5C7XH 5ACMA 5DK3A 3DVNA 4N2HA 5FM5M 2BSRB 2VDKL 4UT6H 3D09A 1AHKA 3K91A 4KK5C 4QOKD 3ZHLA 3OZ9L 4LRIC 4TUJB 5HVGB 1EXUB 4UQEA 4XCFH 4KK9C 4W6YB 1OCWH 2CM6A 1MJ7L 3AB0C 4ZODA 1RUAL 1UWGL 5GSRB 2VUKA 3LKQB 1B0GB 4L48A 1B0RA 4L3FA 5IB2B 4DP6X 3O2DL 2CA4A 1JZIA 1JVOA 3MOBH 4G72B 1DHKA 3HBZA 5AYTA 5IVNA 4GINA 4RAVB 1JNNL 1WGVA 2JJTC 3AGWA 2F8VA 1KELH 2Q3ZA 4D0CA 2XXFA 3L16A 2MFNA 3Q6GL 4WU5A 5ECGA 1NC4A 3LEVH 1T0NA 3U4AA 5DRNA 4C58B 2ZCLH 5F7FA 3N1GC 5T1DH 2Y4SA 3VFTB 1BXXA 4U2ZA 3S5YA 1I9RH 1MH5B 4Y2LA 3DV4B 3U4KA 4M7LL 3TFKD 2YAHA 3F12A 1AMYA 2BIQA 2YXFA 3T08A 3LVTA 3QHZL 4YHKH 1WSST 4YQXH 1BPVA 3V0VB 1MUJA 2AHIA 1NCWH 3I50L 1EGJL 4QRPA 4QWWD 5CMAA 1GSKA 1EVUA 4CL7A 1M6OA 5C0BD 1FHNA 4Q8BA 4WW1B 2ZP9A 2H9GB 4OZIA 2DKMA 2ZOUA 5DEGA 4HPOL 2P42B 3ZRCC 3WLWC 3X14B 5D7JC 1UB6A 3D12B 1RZ8A 4AQAB 1I1YB 3EIFA 4Z23A 1TO4A 3CVCA 3SE4A 3J8F7 2O72A 2OMZA 1V54B 2Y1ZA 1EUUA 2MQCA 1PGRB 4G6KH 3S8FB 4CU7A 5D1XB 2VMJA 4BHUI 1T0PB 4PJ7B 5TGBB 1KYOK 3MCKA 3W1ZA 1A2YA 1YZZA 5SWSB 3HRZA 4IU3B 3AWGA 5LG1A 4NKMA 1MF2H 5HYEA 1XB8A 2KBGA 2NOYA 2VR6A 3VXQB 2ZKWA 3NH7H 2A6IB 2Y5QA 3QARA 4QHNA 5TDNB 3S88H 2G3NA 3R18A 4ODUA 4XN8A 1FZJB 3LKSA 5IF0A 2YPVH 4Y2OB 5IESL 4O4YH 1A0QL 3U9PL 2WGNB 3A4DA 3BEVA 3KEHA 4G7VH 4L3AA 2IPUG 1ONQB 3KBPA 1IGFH 3P4MA 4UWQB 3CE1A 3TNNA 3DXAB 3CUPA 3O2WL 5J0BA 3C5XA 1YNKL 2BP0B 3U46A 4P4KC 4UAOB 5G4OA 4JPWL 4NQEB 1OAUH 2CDGA 4DH2A 5EC1A 5KAQG 4PJBB 1KCKA 3CH8A 2VO5A 4OKVA 4Y1SA 3RKPA 2DM4A 2A9AA 2X1XR 5B38A 3K74B 4YGVB 2A9CA 4HS3B 2J1WA 5I0XA 5IREA 2AXFB 3FUKA 4F7EA 2B5IC 5EUOF 4UT7L 2B59A 1YAIA 2F68X 5HDRA 3DUSB 2JCWA 1NCDH 3LXCA 3CSGA 4LGSB 3O41B 2W8CA 4HDIB 4WFED 2H45A 1C8QA 3GZQA 4RX4A 3TT3H 1U95B 1BW8A 4AT6B 4KJPD 1FGVL 4X7TB 1WO2A 3UG3A 3G7TA 4L2LA 2NNCA 1RHHB 1WAAE 3IDXH 1ZANH 2WANA 2Q6WB 2DQIL 4EBQL 5CGMA 1EHAA 5J3HC 4QKTA 4DZ8A 2EXWD 5EOTA 1DVFD 1K72A 1S9XA 2VQUA 3QQ9D 4Z7VA 4ES8A 1G1KA 2VDQB 2VRKA 3T6ZA 2UX6A 1NANI 1UOVA 2I5YL 4KKCD 4LT7A 5GGRY 2XV2A 1A1OA 5TQ2L 3RDTA 3PL6A 1U92B 4UM8A 5B8CC 5E6IA 2X38A 4D9QE 3EH1A 3K5SA 3MJ7A 5AW7B 3H9HA 3PHAA 5DUML 5JW5B 4UTAL 1Q0XH 2F5AL 3AFLA 4TVSa 1B90A 4QLWA 1LEIA 4M02A 4L3EB 2BOLA 2VDLL 3ZVVA 1LMKA 2YFOA 5IMMA 4W9ZA 3DX2A 2OCJA 2B15A 4Q4IA 3D18A 3TBCA 4GW5B 3VFPB 3ZKQD 4DCQA 3MROA 5E2TH 5L2JA 1AYOA 1LP9F 2HB0A 2AVFA 2CKBB 3CZFB 3WN5C 1TKWA 4NBZB 3UZVA 5CJXA 2B77A 3GXTA 1Q0YH 2GSGB 3GB7A 1NIAA 3CBKB 5IG7A 1OCRB 2GUOB 2NNXA 3ECUA 1DQJB 1INQB 3L5XH 4MWFB 5E0FA 4EN2A 4R7DA 1BFOA 1AIFB 1CFVH 1J1PL 1RZGB 4AVHA 3V6OE 1GY1A 4ODVH 2Z31A 4O02H 1E4WH 4CMHC 2C4FU 2B8OT 4XWOC 1U2YA 4M7KH 2DH3A 3N06B 4JJ5B 4ZMAT 3B3IA 1H8LA 2ATKB 1K8DB 2EC9U 2QJDA 4AI7A 1KBGL 3BIBX 1DVUA 3BKYL 2R56L 1MI5A 3GSNH 1KLUB 4ZO7A 3WFEH 1GGUA 4DZBB 2DB8A 4I0CC 1SBBA 4PUBL 1RP8A 4D7BA 1TCMA 1KGCE 5F72S 4JDEB 1XSOA 4X83A 3D87B 4GW1B 4AW4A 1SOQA 2FO8A 5I17B 1Q4NX 2O4EA 1I8KA 1A7OH 3FQTA 3JV5A 4XMKL 4N8VB 2DMKA 3GRWH 3KWWA 1SVCP 4N3TA 2H1XA 1FFPA 1T2JA 3NEEA 1PKQA 5DI8A 1ZWIB 4GS7C 3T1FB 2J6EH 1GGTA 2DKUA 1AG6A 3A5VA 5IFAL 3IVKB 2DYSB 5B39B 1MW1A 4PJCF 3QPXH 3SDYH 5C6WH 1DJSA 3CVBA 3GHPA 3HPJB 4PJFB 1HXYA 1TU2B 2Q76A 5ITFB 1R46A 4KFZC 3FUIA 4NNYA 4BH7B 3PIQB 3ESNA 3U2SB 1SEBA 1R34A 2OL3B 4O58H 3E6HA 4U3SA 4MNQD 4PBDA 3ZR6A 5L4FA 1ZVHA 4XHJC 1P2CA 4A6YL 4XNBA 3D48R 2HJKB 2PP9A 4XI5C 2XDHA 5E1AA 4WFGD 3DNKA 2B1AH 4FG0A 2D9CA 4TUJA 1EXUA 3AADB 5CR8A 4FNSA 5I71C 3EJPA 3QUMB 2HVJB 1IVTA 1B0GA 3PDGA 1F6LL 5IROC 1JK9B 2Y7MA 5AW4B 4F91B 1CFBA 1EO5A 4H2CA 1P5UB 1BFVH 3OJDB 3CVHA 5ICXA 3KPTA 5D7LD 2YXWA 1BBJB 2RCSL 1TQBB 2D0GA 3SYCA 2XETA 2ITDA 2GY5A 1J05B 2X2HA 4LIQE 5IQMA 4NKDA 1J9CT 4HLEA 3I3EA 4H13C 4GRWB 4OQTL 4RWHA 4XPHH 3E3QE 5I1HL 4HBCH 4ZQKB 1N19A 2WXRA 1J0IA 1IGJB 3IF1B 4LAQL 3PPSA 4YXHH 1K5NA 2VDRL 4HJUA 4QLRA 1UD3A 5KSBE 3HR5B 5LGHH 3RWIB 2VN7A 4LDEB 4N2KA 2GY7B 5FXCH 5I23A 3WTSA 4V1DD 2J20A 1O75A 2FX7L 4JKNA 1G9MH 5D5MF 3LIZH 1AYRA 4WW1A 4NDMA 1XEDA 3QUGA 3GK8H 4DO6A 4IQHA 2NY5C 1IQDB 1OE2A 43C9B 3X3GH 1M2VA 2YEVB 1CB4A 3OZLA 3ATAA 5D7IE 4RMSA 4XPBH 3X14A 4L0PB 3VD3A 2CUIA 5D96C 1RZPA 3EBHA 4LCCC 1S5HB 4L8BB 2DBLH 3EYSH 1YJDL 4N2AA 1KTDA 1QOKA 1AFVL 4HT1H 3ZMNA 1HKFA 3NCCB 5EU7E 1A7PL 3QRGH 4J8QA 5AYUH 3QDAA 2EDJA 5HJGA 5T1MB 1I1AB 3ZDXB 4U3XA 2LGNA 3NRQA 4DOHB 4YE4H 1ADWA 4KVCL 4YDVB 3QEQE 4AVKA 3TH4T 5SWSA 4IU3A 2Q8BH 2Y07H 3U1SH 5I18L 3ROOA 1MAML 4LSQL 2DEXX 4XAKE 5TDNA 4ZXBD 5E5LA 1RERA 4ODSH 1HYSC 5B7EA 5GSVB 2LHAA 5IQ9B 4M8QA 1BG9A 4KO5A 5JR1H 3NIGF 4NHUA 2OKMA 5K39B 2BOBA 2BDNH 4JE0A 4PI2A 4UV4H 3CH1B 4NGHL 1TTGA 1AE6H 1X5XA 3NJLA 4Q14A 1JK8A 3DXAA 1I85C 5GS3A 5L8LB 4G9DA 5IEKB 2AC0A 4FABL 1T2QL 2BP0A 1KGIA 4IBQA 3HNTL 2A73B 5DRWB 1AXTH 3MBWB 5HVHC 2VXTL 4V11A 2NY0D 4KUZH 3ESOA 43CAB 3JV4B 2VL5A 1MHHA 3VYOA 1UZ6F 1EBAA 4RH4A 3CSYA 4LGPB 5FLUA 4EI5B 2C3WA 3EO1B 5HYSB 2AXFA 3WYRA 2EIZB 1R75A 1FNHA 4PG2A 1ZJAA 2ZD0A 3DUSA 1NUNB 4LEOA 1MFNA 3H9YA 1MFBH 1X5FA 2FWLB 4OZHB 1SJVA 3ZE0E 4F8TA 3NIFB 3O41A 4HDIA 1WAAA 4DQOH 3O3BA 3FTVA 1UD8A 3N44F 3ZKXB 2FDBP 4XPFH 1U95A 1YMME 4FLOA 2OLDA 3CX5K 5MI0B 3PQYD 3UCRA 5CZXC 3PFQA 1M05B 4X7TA 2H0JA 4WSGA 5L0QB 1I31A 3EOBB 1Y0LA 4EKJA 3KPRE 5AAMA 1RHHA 4AEEA 2MJWA 4U1LB 2E75C 1J5IA 2Q6WA 4OSUH 3VXSB 3X11B 3LHPH 4JB9H 2PTUA 4HKJA 3W9EA 1N67A 2EDHA 5DF0A 1OSEA 4ZZFA 4ZZKA 3ZL2A 2A6JB 2FB4L 2HLAA 1MCLA 3MV9D 4YHLL 2V7NA 4IKKA 1IGMH 4UNUA 1E8WA 3LNGA 3Q8FA 3HTLX 3PABB 4WJ5B 4Y7MA 2D8KA 1Z3RA 3C08H 4HULB 1SEQL 1J12A 4BDVB 1L6PA 1SXZA 2R2CA 3DMMB 4L9DA 1JPSH 4M1DL 3KWUA 1S7QB 4U7MA 3E6FA 5LGYA 3ALPA 1QSZA 4L3EA 3ARGD 3IE9A 1NMAH 2IOIA 2Z35B 5ENWA 1PYWA 4CJ0A 4F2ME 3N43B 1A4KA 4L29B 1EPFA 2CPCA 2OMBA 3KMDA 4N5UA 3A0OA 4NJAH 4OLWH 4X8JB 4ZUSB 4OIAA 4AV4A 3EH2A 2QADD 2IQAA 3FH5A 3FN9A 3E8UL 3EBGA 3PWPE 3RIFF 1LK3L 3CZFA 2OK0L 1EEZB 3V6OA 1ACCA 1CZ8H 5IVZB 3RGVB 5JW4R 2J5WA 2DW5A 2XG5A 4WTXA 1DQJA 4MWFA 1A8ZA 1DJXA 1UXSA 4H0HB 4E9RA 1XGPB 2MCMA 2D7NA 4NKIH 4R0LB 1NMBL 4WNJA 3UG5A 4I87A 2EZ0D 4Y16C 5SV4A 1XF4B 1XBDA 3MJ9H 4QWWC 3OLEA 3RWFB 2JIXA 5EUOE 5GGSB 4KHXH 4HF5L 4WWPA 1VEPA 3UGXA 1ZPUA 5BQ7A 3SDXF 2J5LB 1TMCB 4GSRA 1R24B 4W9IC 4A7GA 5H4ZA 5MENE 3DPBB 5F21B 1I9IL 5CJ8A 2EEFA 4GP4B 1IFHH 3TT1L 2CJSA 4XXWC 4DZBA 3IMBA 4FP8L 2AJVH 1O9ZA 3SE8L 2EINB 2X1PA 1W0VA 2ZWLT 3LS4H 5E4EC 5CGTA 3ULVD 4XBPB 5KBNC 3ASWA 3KYMA 1FAIH 4GKZA 4XNMB 3V0EA 5GS1B 4ENEC 5I17A 5CEYB 3WNOA 1AC0A 1Z9NA 4J2QA 5B1BB 3T65B 1H8NA 2FSEB 4F8LA 5I0VA 3BE1H 1BMZA 2OJEB 1USQA 3TO4B 1XCXA 3QIUD 4Y8DC 1WC7B 3KL5A 5JPMA 5DLMH 2FCBA 6TAAA 3S36X 1MRCH 4J3UA 1ZWIA 5EZPA 2AEIT 3T1FA 1OTUC 4N1HB 3IVKA 1UH3A 1LWJA 4HYTB 3NTCH 3E2HB 2IADB 1LQSR 3U2IA 3VWKA 4ICXA 1NL0H 3H3PL 3HPJA 1X5GA 4PJFA 2XWEA 1TU2A 5EU6D 2Z92B 4H25B 1CLOL 2C3HA 3M1CA 5I8KH 1S5IH 2YAPA 3G6JB 1RY7B 1HNGA 4U2YA 4JFQB 1FGNL 3MZGB 2DM7A 4X6EB 2WXJA 3P73A 3RTQA 4BH7A 5DQDL 3U2SA 4IMKA 3H8NA 3BWAB 1LP9E 2EXYD 2NMSA 1ZHLB 4JQXC 1BQHB 2Y36H 5HYFA 4LSVH 2AQQA 3KJ6H 2HJKA 4PB9L 5CD3B 1DVXA 3KDMB 2O6CA 2Q10A 4S1QH 5JHBA 3VTMA 2DTMH 4L5FE 4AL8C 1U3HB 4JRYB 2JFCA 1G4MA 3RZCB 3CSTA 4Y5YA 5ERWB 5KW9L 3QUMA 2HFEB 3H42H 2HVJA 4CN1A 5KVDH 1CIUA 4IRZA 3L3GB 5AVYB 5IUCA 3SBPA 1TMQA 3VFOB 2YQ2A 5L6YH 1CDGA 3V4VB 1P5UA 5F7HA 1LE5B 1BBJA 3HA0A 2X4TA 3PWJB 4PW4A 3BMWA 2A4CA 4R5XA 5SX4H 5BO0D 5DDHB 1MWAL 4LKXA 3OXRB 4W6XB 5FHAH 1F8TL 4Z0XB 4WRLA 2W0FA 4E42A 5D4JA 1UWFA 4IU2B 2WB7A 5J56B 1Z9OA 2E59A 4LSSH 2CO6B 1TQSA 3CZKA 4GEIA 1DVFC 1INEH 4ZQKA 2QPSA 5DO2C 3VXRD 1EIBA 3Q8AA 4B9YA 5TK4A 2NY1C 4AGOA 1WWAX 4I18B 3ARFB 3FTZA 2OS7A 3RWIA 4JKKA 4NT6A 1NEUA 2XN2A 2V17L 1KCUH 5IKCB 3EDDA 4APQC 4R3SB 5I1IL 1U93B 5ESVB 1Z7JA 1OT4A 1YLBB 3L4VA 3TBSB 1G7HA 1IQDA 43C9A 1JPFB 4PJCE 3FU3A 4M43H 5E6ZA 2HA1A 3UTSD 4JN1H 5HHOB 2XA3A 3C6LB 3Q2CA 4XP6H 5TF1H 8FABB 1M71A 3PWLB 4U6VH 4L8BA 1HE7A 5DMKB 3FQRA 4MJJA 4F7KA 1XCWA 3F58H 3FUMA 3ULUD 2WBJD 1XL6A 1GZQA 1I1AA 1K9TA 2VC2B 5HDQL 5DWUL 5T3ZH 4RDBA 4JFEB 1U3NA 4YDVA 4YSUA 2ICEB 4WEBL 3SPJA 4JFDB 1G7LB 2IBZX 3A3YB 1VEMA 4M7ZC 3JWDC 3QJQB 4RFEB 1K6QH 5FGSA 3OF6A 1QNIA 4IW4C 3HBGA 3UAJC 1CLZH 1A4JB 4Z77B 3EO0B 1BSIA 1TTFA 3LYRA 2XCMC 3GMRA 1T04B 1WGOA 3CH1A 3GSQB 1SDYA 3GTVA 5ECJE 5FUCC 2FR4A 2FHFA 4TUKL 4FQHA 4ORZC 3HKZA 4PRNB 3TZVB 4FNLH 1GYVA 2H32B 5DEJA 1RUPL 2A73A 5DRWA 5G4NA 2V5SA 1XR9B 4NZRL 3WTWA 2PWDA 1T20B 1QRND 4TQEL 43CAA 3RHWF 5KVGH 3EFFB 5JQIB 4NN7B 1P7QD 3AY4C 3MUGB 4MRBA 4M1GH 4N0UE 4EI5A 1OD7A 3SDCC 3EO1A 1GGYA 4RRPM 5K5YA 1CK0L 1MREH 2EIZA 2YQ3A 3Q2WA 4N20A 3QS2A 4MQTB 1ZXKA 1WJ3A 1JXJA 3MRLB 4OKDA 4QNPF 5FYKD 4BYHA 4F57H 2JJUA 3C60B 2CJ3A 5D5ME 5E2UH 2Y1VA 3BKCL 3WTTA 3KPRA 3N40F 1PIGA 3FUJA 1ZHBB 4K15A 3MLPA 3E3QC 1KNOA 3ZZQA 2E8ZA 3EJSA 3EOBA 4K94C 5B1AB 3LEYL 3HN3A 4OI8A 3FU7B 3LZNA 4U1LA 4HGMA 4I7ZC 1DBJH 3T0WA 5IOPB 4L1LA 3VXSA 1P4BL 3X11A 2EVIA 1I3VA 2FBJH 4NIKB 5DD6B 2A6JA 1NGQL 4BWUA 4ZUWB 4HLZG 2JWYA 1RZKL 4Y4FB 2B4CC 5D1QD 4XE0A 2B9BA 4BDVA 3FFDB 4HS8H 4EZJA 2P5PA 3DMMA 5HVFB 1S7QA 4ZAKD 2XN9E 3ZTNL 3DO4A 3D51A 4YHOL 3V0DA 3NIGE 3H9SB 3QDMD 4X4YB 3IFLH 3PDOB 4F33B 2JKXA 2VNCA 1NFIB 2RD0A 4QRRD 4X8JA 2VDKB 3P9MA 2VO8A 2DEYX 1YRKA 3DPDA 4OFVA 1DBAH 1E6JL 1E0OB 4GI8A 2WK2A 3RGVA 4JANB 3T3PF 1YECH 2VKWA 1FF5A 5EUOA 2R2BB 3BUYB 1XMEB 3MGTA 1SMDA 2XWDA 4R0LA 1GMIA 1UZ6E 3UTQA 4RA0C 5MENA 3MLRH 1XF4A 1TETH 2PYEB 4G3YL 4KI1A 3RWFA 4ABUA 3NA9H 3HC2A 4JREC 2Z65C 1ADQH 5I1AB 1EUTA 2B2XL 4NCDA 1TFPA 1WITA 5FOBB 1VFOA 3BW9B 4OBRA 2BRRL 3KJ4C 4P2OA 4PREB 3ZY7A 1U8NB 1BQUA 3HG5A 3V4PA 3OQRA 4HCIA 1ZT7B 1R5IB 3FCUB 4XP9L 3ZKND 2WWMC 5GPRA 5K9JL 1NCCH 4HK3N 4BIKA 4XBPA 1MCBA 4QJ3B 4XNMA 1KCVH 4GAJL 5EMYA 3JSSA 4JHWH 2BNRD 4GIOA 4WGVB 5GS1A 2YKKA 5IBLD 3AB0B 5KBKA 5GGTH 2DIAA 3ZRFC 2RALA 1P5VB 3PRZA 3RI5K 3I6GB 2IANE 1WC7A 1MLBB 1N59B 1E8YA 2F54D 3VH8G 1TF4A 3ARSA 4DNLA 3MCLH 4ZXBC 4XPAL 1UM5L 3OAUH 4M5ZL 1NLDL 3D30A 3KNBB 2E47A 4QI3A 2XSKA 5JO5B 3QEUB 2WD0A 4C54A 4Z7IA 5CLWA 4QY8A 1LP9A 2Z92A 1WUZA 4H25A 1ZIBA 4OIBA 4PJ9A 4TQHA 2OI9C 2VZOA 3GHEH 4XN5A 1YG9A 2ZJSH 1NAKH 5ANHA 4DVBB 3AY2A