4WKZA

Complex of autonomous scag cohesin cohg and x-doc domains
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
232
structure length
231
Chain Sequence
b'VTSAVKTQYVEIESVMGFYFNTEDKFDTAQIKKAVLHTVYNEGYTDDGVAVVLREYESEPVDITAELTFGDATPANTYKAVENKFDYEIPVYYNNATLKDAEGNDATVTVYIGLKGDTDLNNIVDGRDATATLTYYAATSTDGKDATTVALSPSTLVGGNPESVYDDFSAFLSDVKVDAGKELTRFAKKAERLIDGRDASSILTFYTKSSVDQYKDMAANEPNKLWDIVTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cellulose-binding protein
publication title Complex of autonomous ScaG cohesin CohG and X-doc domains
rcsb
source organism Ruminococcus flavefaciens
molecule tags Structural protein
total genus 66
structure length 231
sequence length 232
ec nomenclature
pdb deposition date 2014-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18244 CttA_N Cellulose-binding protein CttA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 4wkzA02
2.60.40.3810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4wkzA01
2CCLB 4IU3B 2OZNB 2VN5B 1DAQA 2VN6B 4WI0B 2B59B 4FL4C 4UYPB 2JNKA 5LXVB 1DAVA 4UYQB 3KCPA 4WKZA 4DH2B 5G5DB 5K39B 4FL4A 4U3SB 3UL4B 4IU2B 2Y3NB 1OHZB 2MTEA
chains in the Genus database with same CATH superfamily
1QUPA 5I1GL 1V10A 3CVDA 1O7SA 4M1GL 2NR6A 4QWWC 5AW8B 1PAMA 3BUQA 2ZYHA 3HR5B 1DQJA 4M43H 5IREA 3QBTB 1BQUA 1N7MH 4UQBA 3LN9A 5EC2A 5AZEH 4G43A 1Z6JT 2EEXA 4J6IA 1FFNB 5I2IB 4N2KA 3GJFB 1R3KB 4ODUA 5DF0A 1UEMA 2VO8A 4JHZA 3MODL 2N0KA 4LE8A 2Z7WA 1CGVA 4U33A 1JK9A 3O6MH 4LLUB 4O2FA 3RZWA 3UC0L 1F90H 3TX4A 5DMYA 4BZYA 4XXDB 2NY2B 3EBIA 4X0NA 4Y89A 4PJXE 3REVB 4KRNA 5C0BA 3PGCB 4IKJA 5F0JB 4HJ0C 3LB6D 3VI3A 5DJ6B 1MZYA 3HBGA 3MNWB 4KMTH 1R3IH 1JZ3A 4E42A 4ZOEA 1QVOB 3HPLA 5FYJU 4UYPB 4U6XA 4WJ5A 1OALA 3GSWA 4G6JH 3NK3A 3BQUA 5AB0A 3DA0A 3LQAL 4MD4B 3BP7B 3HI6H 1PU0A 4R9HA 1LO5A 1XSOA 2ITCA 4ZUUA 3BRFA 1N19A 1KEGL 3OKDB 5K9JH 4MA8H 1NEZG 3GLDA 3O45B 3HC4H 4AXWB 1XGTB 4HWUA 5JOPD 3KXFA 3A47A 4ZXBB 1MRFH 3GRWL 2JB5H 4QXUH 5DD3L 1PD0A 4HEME 2NNFA 5EPMB 4N3UA 3OKOB 1D5ZB 2ZUYA 2HG5B 5CUSH 1DE4A 4FFZA 2YPKB 5BS0A 1DLHB 2Z35A 4X6CB 3WEOA 4U1KB 2BSED 1TVBA 2ZYSA 4FQLH 3TZVC 1YC7A 5D7JA 1HZHL 4LRIA 1Z9SA 3D48R 3EFFB 2HZHA 3KH3A 2DTML 3MJ8A 2A74A 3UACA 1WDAA 5GGVY 4HLEA 1N0XH 1P7QA 3S34H 4CMHB 5BMFH 5D7IB 1P1ZA 3H42L 5DRXB 4AZUA 4TNEA 1CXKA 3FO2A 5F89B 1RJZB 4WNQA 1IC5H 2BP3A 1C1EL 3QI9B 1VIWA 4OIBA 2EE0A 1XGPA 4LRNH 5DD6A 5SX5H 8PAZA 3HI5L 3QFDA 2V3FA 4ISVA 3WGUB 4LCYB 4P5TA 3RFZA 3QUYD 3KE0A 3AQXA 4GKNB 4Z0XB 1A4KA 4JZOA 1MIEH 1W9XA 1D9KD 1RUKH 5F88A 4GJTB 2H6UA 4LSVH 1J8KA 1QD0A 1MQ8A 3E8UH 5DS1A 2KLRA 3LS5H 2IDSA 3RTLA 3WS6A 5KSBF 4Y4KD 3NACH 3FOMB 4G7QB 2WMPB 4OCWH 3PHSA 3ZRCC 3CH8A 5IOPA 3R4RA 4P9HL 1XH2A 4FZ8H 2FO4B 5DJ8B 4Y1SA 5T3XL 1F2QA 1IGTB 1A2YA 1J1OL 4TSAH 4YBQC 4B5ZA 4HKXB 2AQ1A 4I87A 4KZEH 3LVEA 3HNSL 2AF2A 4OSUH 4D0BA 3OJ2C 4LVEA 5ETUB 4AYDC 2MCG1 4LIQL 3QK0A 3AWEA 3N9GL 2J21A 3S3BB 4G8EB 1F1AA 2CGRH 5D1ZI 2HVBA 3GIZL 4NKMB 4CC4C 5IJVA 2HUEA 3LKRA 2BSRB 4FI7A 5B8CB 4TMPA 3IETB 2J43A 2NDFA 4IRSD 4PJBE 2WXPA 1MLCB 1OKEA 4E5XA 2VRQA 2X70A 3IPBA 4NZTL 5JIMA 1J1XL 3PIQB 3I50H 4BSVB 1EBPA 2BFGA 3GD1C 2YD8A 4O2CA 5E51A 1DQKA 2J8UB 1D5RA 1MHHB 2RD0A 1HSBB 2PTUA 4N9GB 4L23A 3A67L 4L8DB 2EH8L 1W2KT 3D85B 1FC1A 3S0PA 2Y06L 3PL6B 4M6ML 1OHZB 2W94A 5JZ7C 1N5YL 2YA0A 3WFBH 4F80A 1PCXA 2KZWA 4M4RB 3EYVA 5EBWB 2VRKA 1ZOXA 2EDLA 3VVWA 3MA9L 4IBVA 2LAGB 5CCKH 4KHXL 1EXGA 2Y7MA 3LN4A 5KG9B 3DO7B 5EN2A 1QFWM 1E8YA 2ZXCA 3UBFA 4KK9C 4NIYE 1AQKL 4U7MA 5BV7H 3ILPA 1FV1B 2AEIT 3ME0B 3PGFL 1LEKA 3HHRB 4OM0H 1PZSA 3EJZD 1A0QL 3RDTA 3ULUL 2ZAGA 2CIKA 4GQ9L 3AB0C 3SY6A 4Y4FA 1UYWL 3RY5A 3TEUA 4ZFGL 3K81A 3QS3A 3SO3B 1T0NA 3BSZL 1GZQB 1I3UA 4B50A 1HK6A 1FZOB 3BEWB 3IRCA 3D6GA 1SLXA 3VGAB 3ZQ9A 2ED6A 2VN6B 3C60D 4JHAL 2AMGA 4TSBH 5E2WH 1BXUA 4H2AA 4HALA 4S0TD 1JPTH 2B1AL 2E7HA 3HG3A 2CUMA 1L0XA 2ERJC 3W81A 1TZAA 4KTEH 2CMRH 4PVBA 2BO0A 4MJIA 4LCIH 3QZPA 1SY6H 1BQRA 2EH7H 2YN3A 4N5UA 5K1JA 4DGIH 3BC9A 2WUCL 5L2KE 1KBGH 2WIMA 1TJMA 3GQFA 3M6DA 4L5FH 3B7TA 2VJ0A 3NFPA 2GJRA 2QHRH 1BYPA 1T3FB 1NSNH 3WFCL 3PWUA 1Q9KA 4JO1L 3CUPB 5IG7B 1TU2A 4X6DE 3HBZA 2VXSL 4X7TA 1BZ7A 5LGKA 1DVYA 3OHMB 1G9ML 1I9JL 1T04A 2CZNA 2VR9A 5JW3H 3SY0A 3H7BA 1Z9PA 3D18B 3P4OA 3E38A 4HS3B 3FU8A 3KWXA 4FA6A 4AVKA 3ZE0F 4QAWA 4GKZB 3QEQA 4M1CC 1MRCL 3X1FA 1AD9B 2VW7A 1KJ2L 2VWEC 4HIEA 4OBRA 3IJ7A 5AVVB 3SD2A 4BA0A 1QFUL 2CLZB 5K39B 2DW5A 2LU7A 2VABA 3CCHA 3VSTA 4AVHA 3HS0A 1RLWA 1ECZA 2I60L 2DLGA 1NIEA 2EXYD 3KG5A 1BJMA 1EHNA 2EDMA 1A6UL 3SKMB 4YDLB 4M5ZH 4FTDA 3LPPA 4MAYA 5FDYA 3O9WC 5FYKD 1Q94A 2E9BA 3WFHA 1M05B 2WQRA 5HHMD 2X0VA 3HPJA 3JSSA 4LCCB 2ZUUA 1DFXA 2Z92A 4XZUB 1WTLA 2XFXA 3BVTA 1ZLEA 4XWGL 2HRLA 1NC2D 2WTRB 5IHUH 3HAEA 3T71A 4N1CA 4ZSOA 4DP2X 3UTSE 4GEIA 4NNYB 4ZPTB 3WEXB 1BXAA 2FIRT 5DUMH 3CXDL 3A4DA 3AT0A 1BVLA 1CE1L 3VWJB 3ALWA 4MMZC 3WSQL 4RDBA 2XWBA 4JRXB 1XF3B 3BUBA 2CQVA 3EO9H 5D7JD 3TF7C 1WT5A 2V9QA 3R0MA 4NEHB 5IKCB 3WIIH 3VFVB 4R84A 3C2AH 4TPRH 3T1WA 3QHFH 2R59A 4H88L 1MELA 4FX5A 4YX2L 1FSKB 4D9LH 5TE7H 9CGTA 5LDUA 3QUGA 5C8JA 3CFBA 5FYJL 5DJ2A 2AV7B 1QBMH 2E4FA 2VZSA 3FFDA 1Z9OA 3ZMEA 3FRPA 5C2BL 3TOPA 4PPTA 4P5TD 4YFDB 3QXAA 4ORGB 4Y1AB 3BO8A 3MV11 3W5NA 1CFNB 1CI5A 3L3GA 2Y2TA 2ZF9A 3NPSC 2PMZA 2YQBA 4XXDA 4BXVA 2Y2WA 4Q14A 4BFIB 1OSEA 1SYSA 2EDWA 3H2PA 4JFYA 4UV7L 2WHVA 4LSSL 1CICC 1J9TA 4TRPL 3ZO9A 5JPNB 4OCSH 3V4VL 4E5XG 4LSQH 5KYWA 4TTGA 4DNLA 2XWRA 1JXGA 2IC2A 3C5ZD 1S7TB 1MAML 3RUGA 7FABL 3L3HA 2A9ML 1JHLL 1RZ7L 3RGHA 1YUKB 2Z9TA 5DQJB 3DV4A 2O6PA 3DTUB 1CGSL 2X7LA 3PDGA 2NY5C 2VLJA 3GGWB 5JXEA 2Z91A 1FVEB 4LVHC 1YQVH 2YXVA 3NZ8B 4F7TA 3ARDC 1A5FL 1HH9A 5KSAC 3VD0A 1UATA 4EI5C 2P8PA 1SEQH 3FU7B 1JSYA 1R24A 1UENA 2KBGA 3JV6B 3W56A 1DBKL 5ISZE 1HDMB 1I7TA 4CU8A 1YEIH 4QMEA 2WYHA 4M8VA 1QFWH 4DGVH 4F7PA 1HNGA 3TFKD 1HNFA 3MRKB 1XIWB 2WOYA 3H0TB 4QNPE 1AGCA 1Y1DA 1NGPH 4LLYA 4YDKH 4ZMLA 1FNSL 1A6AA 1WS8A 3VXOB 5IB4B 1DVFD 2HVJB 3KNBA 4GW1B 3HNVL 1UD5A 3OF6D 3NGBB 5DO8A 2H9GA 5HDBB 4P0DA 3L81A 1F58H 3S2AA 5I5RA 2VLKE 1PX8A 1PPIA 3SBWC 3SPGA 3TCTA 1LVEA 5HYJD 5EEWA 2WXGA 4DPCX 4E9LA 2DLIA 1UT1A 5DS2A 4WO4C 5E9DA 4ZO6A 4P3CL 4PJIF 1MREH 2UY7A 5F6IC 2PCYA 5I1EL 4PGJA 3VGHA 4OQTL 4YSUA 1IM3A 2IADA 3RDTD 3FZUC 5GIRB 3V6FB 3ZT6A 1SYVA 3CFEB 1I53A 2D8KA 4WWNA 3QQ3B 4Y4FD 3BZEB 1E43A 4PCTA 2C9XA 3D39D 4IHOB 1DFBL 4XVUD 3TV3H 5D5MA 2IV8A 4B0MM 3BN9C 1I1RA 3MNVB 3NG5A 1VLXA 4M1DH 5F71A 3LJ3A 2A6DB 3KJ6H 4YSRA 2ICWA 3RB5A 4FQ1L 3VXPB 2CR6A 3WIHL 4AZ8B 2IIJA 4CILA 2EXWC 3Q0HA 1LHZA 3RY6A 4U3SB 4XN1A 4NZUH 5BUAA 1K4CB 5DMGD 4AEIL 1E5AA 3FFCE 3KYOA 2R2BB 4UV4H 5DZ9A 3JYBA 4WW2F 3KPQB 3V4VB 5FW8A 4D3CH 3ESUF 4J8QA 3QFJA 4OJFL 1S9VA 4QYOB 5ETUA 5DS8B 4HQQH 2OSXA 4NC1E 3NCFB 4OF6A 5JQ6L 3FFOA 3UIYA 1EEZA 1ZV2A 3BJLA 5CFHA 5JDJA 5AW0B 2XOTA 2BVTA 5KN5B 4XXCC 4L3EE 2UWEB 4G6AD 4KO9A 1FAIH 3BPCB 4IRJC 3HAEG 4YGAB 4CKQA 1ZJBA 1ZHLA 1OAXH 2LE9A 2H2SC 3I3DA 3VXUA 5IBUG 3LQMA 1TCRA 3T09A 3OHXA 4AL8L 3GRWA 1YYLL 3C5JB 2ITDB 4KITB 4JM4H 4OCMC 1CZ8L 4BZ1L 4C55A 4QRTA 2IGFH 4MCNA 5A16B 2EJ1A 1ITCA 5CLWA 4ACPA 5HVFB 4L8DA 2HLFD 3VXTA 3DURA 4E9WA 5T3ZE 4TSCL 5E7FA 3D4CA 3RWGB 2BFVL 5F7MC 1NBZB 4C4BA 1ADQL 2XVLA 3JZ7A 1MCPH 4D7PA 3LS4L 3FSVA 2XQYA 4JQIH 2YXFA 4PWFA 1TQCB 1J0JA 3IDIB 3PU7A 5ICYB 1O0VA 5HHNB 4GKLA 2WBXA 4K7PH 1JGDA 2E9IA 3H4FA 4MMXA 3L3JB 2NY6C 1RULL 4BUGA 4PRPD 3RWDA 3VM7A 3FRPG 1EJOH 4YQXL 1BLNB 3LPWA 4B9PA 2VXUH 4Z3IA 5FGBC 4JK0D 1BAWA 3TT1L 3PQYA 3WCYA 2Q3AA 2AANA 5I0ZA 5FR3A 2PR9A 3IJYA 4KI5D 3PF2A 3BI9X 2WGXA 4G8AC 3SKJH 3MV7D 3O8XC 4FJYA 1C16A 3NSJA 5FUCC 1PZ5A 2J4WL 3LDBB 2R69L 3NIGB 4GH7B 3AS3A 4KJPD 3LEXB 4YOKA 3ULVF 2QSCH 3PAVA 3IJHA 4L8CA 2KS0A 3BKCL 3V7AE 4F2ME 2BY3A 2WAQA 3PLYA 1QLRB 4GUCA 5IMKA 5A6LA 1SJMA 1HCYA 4FHKA 5D6CA 2GJ6A 3CFMA 4NQVA 4NCC1 2Z1KA 4R90H 1R47A 1T3FA 2YD4A 3TBTB 5EZOL 3OB8A 5FM8A 2H1XA 2MQCA 5EO0A 4GRWB 2H32H 2I5YH 3OB0H 1FE8L 1TQBC 2EDTA 5ESVB 5FKPA 3U9WA 1KF9B 1NBVL 2AXHA 4A2EA 4LLWA 4MXQC 1TZGL 3CNKA 3FH5A 1MIML 4HUCA 4LU5L 3QORB 1CL7L 1YMHA 3D7PA 3S5LB 2CLZA 1ZWIB 3CD4A 5DEFA 4Z7AA 4CBPA 2FD6H 5KSVB 3GMNB 2DQUL 4E0RB 1U8PB 4XVJH 2GJZA 3IK2A 4QRRB 3VTMA 1XGUB 4MJ6B 2BRRL 3IEAA 2YBGA 1FJ1A 3OKEA 2X4PB 3FUNA 2C7FA 2LFEA 4QOKB 3X12B 3OG4B 3QAQA 1EA9C 1YPZA 5HGBB 3GSQB 3PS6A 1KB5L 3VU2A 3ZDYB 4DP8X 1EJ8A 1BEYL 5F3HB 5DTFB 5EULV 4YBLB 1JZGA 1IB5A 5IUCA 1FIEA 1UXWA 2IH8A 4J4PA 1W0WB 1O7DE 1UJ3C 2X40A 2K6WA 5JOPE 3MBEB 5C6PB 1P6AB 4JG1H 3QXDA 4Y19B 3VXRB 3R7QA 4JKNA 1HH6A 5DEGA 2V6HA 2R8SL 5E0QA 1CGUA 1QFWI 4RZCA 4OZGF 1E0OB 5F7EH 3PWJB 4HG4K 3DBXA 4NXSA 2X1XR 4CW1A 2ZSVB 7CGTA 3WNNA 4PS4H 1RZJH 4YWGH 3D06A 5TDPA 4F7MB 1UXSA 1NDGB 3E9UA 3SQBB 1DVUA 3QEHB 1QEXA 3IKKA 1Z9LA 3C09C 5AL0A 1QBLL 1VGEH 1WZAA 1A21A 3FRUB 4ZS7H 5DA4A 5B4MC 2IJ0C 1K8DB 3FCSB 1ANUA 2F2HA 3EBAA 2F7RA 4D9QD 2FX9L 1WZ1L 2GVYA 3QDMD 3TJEH 1OAKL 2IDCA 1CG9B 1F3JA 3P77A 5CN1A 4F8QA 1L9NA 2PKDA 4LQFL 3EZ8A 4ZW7A 5LQBH 1LGVA 1B0GB 1M7DA 1UVQB 1LO2L 4ZX3A 3BUTA 3MBXH 1LNUB 2D0FA 3EJJX 5BPPA 1ERNA 2BZDA 4OAWB 4HV8B 1XMWA 1A64A 5LBSL 1NCAL 4ZX6A 4NYLB 1ORSB 5I17A 2M1KA 1NUGA 1A22B 1CR9L 1OGSA 4XWOC 3CN1A 2H6OA 4APXA 5J6HA 4QRPB 1F4WH 3WFDL 3AZUA 1KJ2A 1EIBA 4WAFA 3N91A 4HK3J 2JTDA 1FNLA 2WB7A 1TJHL 2XQYG 3BQVA 2CO6B 2EICA 2O1AA 1I1CA 2KLSA 1IBHA 2A6JA 3S3DB 5DO2D 5C0GA 5LXVA 3VCLB 1YSOA 3V5KB 4UB0H 5ALBH 4A39A 1G0DA 4UTAA 4CGTA 1JZ7A 3PNWA 4C58B 3P3RA 3MGOB 3TP4A 3TLRA 2CBQA 2FB4H 1S46A 4PJHE 4TF4A 3RX7A 2LW3A 4FEIA 4HT1L 1IT9H 2HFFA 5D1ZD 3DRQB 4UDUA 2DWSA 3L13A 2VQ1B 2W9EH 1Z1WA 3EJPA 1NCBL 3FO0H 4P5KA 4HKBB 4MZ2A 1B6DA 2VIRB 3AT8A 3T8XA 2Q8AH 1GOFA 2L0DA 4JKMA 2KUTA 4WY7H 3NTCH 5I1JL 3CFKA 3IFLL 4GKSA 5AYTA 4G8GB 3ORJA 1J8SA 3ZDXB 1PW3A 3IU4H 2OAAA 4BH8A 1RZ8A 2AQSA 3BVUA 2Y7OA 8CGTA 3PQYD 3EO1B 4GRMB 4KXZH 3FSOA 2NSMA 3HCVB 4G6ML 2H47C 3B7YA 3X11A 5ADPL 3BKML 3CH1A 1SHSA 1HXYA 3VACA 2YRBA 3LV3B 3PGDA 1XR8B 2WUBL 4GG6F 5A43C 4J1UB 2IPTH 1E90A 4QO1A 5DR5H 3S8FB 1OZUA 2UXGA 1WBZB 4XMKL 1K5NB 2AKRB 2XC8A 1SLVA 4QKTA 1EMTL 1I1YA 1I3VA 1Z7JA 3GT6A 3TNNA 4XN9A 3LH2L 3N41B 2ZX5A 4NQSA 1R3HB 4POYA 2QR0B 2UY6A 2YEVB 4UQIM 4OFIA 2E6QA 1KN2H 1TSRA 1VFAB 1AHWA 3L2NA 4OF8A 1I8MA 2BC4B 2P46B 4NSKB 1NGXA 2GJ6D 1T7VA 3N85H 2DBJA 4WTXA 3L95A 4FFZH 5JORA 3M45A 3BZDA 2XZQL 5FDWB 3QO1B 1J11A 1A9VA 1IE4A 2OL3A 3DO4A 5I75B 1KY6A 3TV8A 2RACA 1LQSR 3HLAB 1CDBA 3KPSA 4PJFF 2JI3A 3JVFC 3HA0A 4ZTOL 3X3FH 3DPBB 4GAJL 4PLJD 3VFOA 2FATL 1VHPA 4PBWD 4P23B 5I9QB 3CDZA 2Q86B 1CT8A 4HMDA 5HTSA 4XP5L 3SQOL 4PJAF 1Z66A 2MPVA 3S37H 1R3LB 3D25B 3L1FA 1T0MB 4FQCL 1JFQL 4H5SB 4V1DA 5D1XC 4PJDB 4Y7MA 4GP4B 2FHBA 2GCYA 4V33A 3CU7A 5TF1H 5E8PB 4NX0A 3DUHA 1IKNC 3HG0A 1RI8A 2PXYC 4KKCC 5I1KL 1B3IA 1JYXA 1JUFB 3EOAB 3N0AA 2Q8BH 4UIKH 4MX7B 1DQVA 4RGMC 3DROB 3L54A 3P2TA 1YMMD 4JM2F 3TYFB 2GI0A 2NXYB 1I3GH 3INUH 1WAPA 4HG4J 5KW9L 1T7ZA 5FYKE 3UL4A 5G4MA 1GKOA 3EDKA 2RAMA 4WW1B 5HHME 2PW1B 3T3ME 2V2XB 1Q1JL 1DBAH 1NL0H 4FFYA 2OR7A 2ERJB 1XCQB 1AAJA 1KDJA 2GUOB 4ZG1A 1NOFA 2IXQA 2VL4A 4PJEE 4OQTA 1KUMA 2EDJA 4K3JL 1KTCA 4R83A 2EEAA 3IFOA 3QEUB 3POCA 5AW2B 2DQCL 3DOSA 3VRJB 4GRLB 5C09A 5F21B 5EN3A 1QW9A 1NAML 4ZAKA 3NDZE 4KHTL 4XODA 2F1AA 3H9HB 4YR6A 3TCXA 5TQ2L 2DD8L 4POZD 5AWNH 4JFDD 1E3ZA 1MY7A 3MHZA 1ECYA 2HPTA 4JR9H 2NUTA 1KCRH 2DRUA 2KC0A 5SWSA 1KOAA 5EUOE 4YSSA 5CEZL 4ODHL 4OZHB 2IAAC 4K71C 1I4FA 4R4ND 1U92A 3PP4L 4YHIB 3WXWH 3REWB 5LNDA 1BIIA 4Z6AT 5K9QI 2W0PA 4L8SC 1F2XK 2XNAA 5IVXA 2AK4A 5JNYA 5TE6H 4YHOH 4Z7QB 1FORH 3B9AA 1D6VL 3EJTA 1MHCB 3QZMA 4ZD3H 5F6HI 3WOVA 1LL1A 1OE3A 1OCCB 3K3QA 1R6VA 3BWUF 5HD8C 4M48L 5FA3B 1J7VR 1MFNA 1Q90A 3APNA 3C8KB 4Z7OF 4ZNEE 2W07A 3RBSA 1F3DJ 5E03A 4BELD 2VDRL 3MRRB 1IEAA 3BPOC 2GYSA 4PGCB 2ORBH 4Y2DA 4KROC 3IBEA 3B2VL 2VDLH 3QRBA 4LF3B 3I6GA 1T0PB 3BLPX 5D2LB 4AC4A 4Y0GA 2A4ZA 2Y3NA 5HHPB 2Z31A 3N50A 5DLML 2CBMA 1BBJA 2R0KL 4I77H 3ZHKA 4W9HC 3CSYB 4TV3A 3VJ6B 3K2IA 4NWUH 3LZLA 4KUCD 3T6QC 3V9FA 4DPBX 1YNLH 2VR8A 2IFGA 4ZK8A 4N2IA 1WHPA 2TRHA 4OU3A 4J3TA 5C0AB 2WZPA 1X3DA 1SJEB 4N90D 2QV4A 5IV2A 5L88L 1U8NA 4MCZB 4FXKB 1THAA 3Q7JA 3FB5B 3TURA 3QJQB 1PG7L 4G42B 4DO4A 3NSYA 3HG4A 3SYQA 1TQWA 2R56H 5GISH 4UMSA 3SDAB 1EZLA 2IO5A 2KLTA 5IMOA 1KY7A 1SVBA 3GYRA 4ZYKB 1AQDB 5AAMC 4XCEA 4ZPVA 4ZFFA 4YHZH 1IAOB 4K94H 5L4IA 5HYJE 2VSMB 4OD3H 4ODBD 1NAMB 4ANKA 1BMGA 3O2WL 2FL5A 2R0WH 4UQ3B 3N6YA 5CU5A 3OJMB 2JJVA 2OMXA 3CVHL 3RVTD 5GRJL 1A3RL 4RA0C 3HZKA 2NSQA 2X9XA 2JCCF 1J0YA 1V55B 2GQHA 3AXLA 4KXZI 1WWAX 1UVQA 4S1QL 1WK0A 1JVKA 3LY6A 1SOXA 4JRYA 3RI5K 35C8H 3D39E 3ZN6A 1T1YB 4R3SA 4PB0H 4F37K 4KNUA 2BVPA 4WDIB 4MB5A 1OARH 4JO2H 1B4RA 5J13B 1KCSL 2ITEA 3AWGA 1TFHA 4A7GF 1JIBA 2IWGA 3KLQA 3UAAA 4ZMQA 1ORQB 1PD1A 2PWEA 4X7SL 2WXMA 3RHWF 1OLLA 4LSTL 2QVTA 1FFOA 3KPSD 5CGBA 3WDJA 1AR2A 4HIIA 1T2QH 1TENA 3AG2B 4F57H 3TZVA 4EZJA 3CWGA 4R96B 1UM6L 4PWKA 1QSEA 1NFDF 4UM9B 2FJUB 2HYMA 2JMRA 2F5BH 5MEOB 1RK1B 2YR3A 1JWUA 3GI8H 4IMLB 1RZKC 4UQ9A 4AM0Q 3IXTB 4XC1H 4H8QA 1ETA1 1KB5A 3EUDA 4WWPA 5C0DA 3QIBC 5AZ2L 5EO9B 1JYNA 5GJTH 4U1MA 4LZKA 3UTOA 4XHQA 4XMUA 3O6LH 3ZL4L 1YN6A 5IBLD 4NNPL 5ACZA 3Q9QA 5A1AA 5TQ0H 4EN2A 3DMMB 2NYYC 1DQIA 3EDJA 2VGLM 1P4BH 1BREA 3KDPB 5MERA 5AW4B 1A3LH 1U58B 3L7EB 1OAQL 1SHWA 1U8KA 3GSOA 4YHPA 2ZSWA 2CDGB 1ZEAL 1D5XB 3WHE0 2XG4A 4AE0A 4P2RB 5AKSA 1SLWA 2ROYA 5JYMA 3TVMB 2P8MA 5I6KA 2P5WB 4KXDA 3DDGA 4ODVL 3FUHA 1EWHA 5DI8B 1MXDA 5E00A 1MCBA 3VGGA 2R1WA 4PRPE 5KYUB 5EO1A 3QQNA 3KVDD 4GG6E 1RVFL 3W11C 1SOQA 4E9SA 3FTGB 1FP5A 1XCWA 3SBRA 4NFCA 3WU1A 3LKOB 5A2BA 2EDFA 1FYTB 1T7YA 4U6VH 1CLVA 1DQDH 3CVHB 4OR1A 4KPHH 1GCYA 5DEJA 2MOVA 3ZTDC 5AL8A 5L7XH 4X7DC 4KI5E 2PW2A 4OZ4B 2DWXA 4FTVB 1QUNB 3MUZ1 3L3DB 5MEND 1T5WB 3MV7E 4CC4A 4HIJA 2OZ4L 1IVLA 3VE0A 3FTUA 5L6YH 4NOFA 4OFQA 4WCYH 3GMQA 5I1AB 4HKJB 4S0HA 4IBQA 3JYCA 1NMAH 4NCDA 1I82A 4H8WC 3V10A 4RAVA 2MCPL 1DP0A 3ZDZB 5CGMA 1ET7A 3PXJA 4RMTA 5I8EA 2W0LA 2VDOB 3WBDA 1L7TL 1CFBA 3BPNC 4WJG3 2ZZUT 4PJFE 2OMVA 1EAOA 2BS8A 1MDAA 1UCBL 2GBAA 3VX0A 4JFOA 2B1HH 2YMXL 1CMOA 1NKRA 5DRNB 1BX2B 1G1YA 4PJ5B 1DQTA 2ESVD 2NXZC 3DLQR 4I0PC 4L1DA 1CJYA 1RAMA 3MRIA 3LKNA 2YIHA 3F3HA 2WB1A 4FULA 4PWEA 4QHMA 2G60H 3RNKA 4FS0A 1GIGL 2WNXA 3R18A 3S97C 3IAQA 4KGLA 4MHHG 3RTQB 2PWGA 4AE1A 1ZA6B 5I1GH 2PP7A 2J20A 4M1GH 5DJCA 1MFVA 2DQJL 1ED3B 3QA3A 5CBAA 2VW4A 1YEKL 3T2NL 4OLUL 2DY2A 1FZKA 1LO4H 1MZZA 4KRPC 4NM8L 3MODH 4F8TA 2GBTA 4Q97A 2OW6A 4G1EB 2OP4L 4N9OB 3SE3C 2BVYA 5C0ND 3IPEA 3GWJA 5C7XL 3ATFA 3BT2L 3HG1B 4QUOA 4W4NA 5LG6A 1BG1A 2FT6A 5BRPA 3F12B 1QR1A 1JGLL 1CURA 1T6VN 3X17A 5I1DB 3OAYK 3FH7A 2D3NA 3EYSL 3IJEB 4GMTL 4NKDA 4KMQA 4NQDD 4B9YA 2VN5B 4GW4A 5IT2L 1A1OB 1HHIA 1I8KB 2DV6A 4BK8A 4G8IB 4UIMA 4NQCA 4ZODA 1HEJC 4U05A 1SMAA 3LQAH 4OIFA 1ETZA 1PZ3A 2YA2A 2ZYRA 4HMCA 3RWFB 4JKLA 1KEGH 2QFPA 1DYZA 3IM1A 5ESAA 4Y9GA 3IT8D 1X7QA 5ENWB 3BGMB 4TKWA 1NIFA 4Z7NF 4JO8A 5C0CD 3H9YA 4PJGB 1RPKA 3AROA 3GRWH 2X0WA 4GSQA 4Y2OA 1U3ZA 5DD3H 2CCLB 3PDDA 3MMEB 4LLVA 4MZRA 5KUMA 1C12B 1JV2B 3K2UL 4DKDC 3PREA 2A83B 3PE9A 4QJ3B 3H3KA 2L7UA 3K6OA 5BRQA 4HETA 4JRYD 4GLRH 3CZFA 3O9WA 3QZBA 4JVWA 4K8RC 3U4BL 4AEEA 4D9QE 3JWNC 3QDME 3WNIA 3TU6A 1HZHH 1HHHB 2EAEA 5IM7A 1HQ4A 1MHCA 1X9RA 1GZPA 2DTMH 4PRDB 5FGCB 1MVYA 4JG5A 4WUUB 4NQQA 2IDFA 5BXFA 1HHJA 4Y5XB 2OTUB 3PXHA 4S1RL 4TQHA 3H42H 3S6CA 1JMZA 1MUJA 3GLEA 4ZFOA 5FB8B 4Y2LA 4AJ0A 1GJIA 3SCMC 4JGNA 3EO0A 3QDJB 4MMZA 1C1EH 1KIRA 4WTWA 3TZVD 2BNUA 2ZXQA 3QIWB 3HI5H 3D2UB 4QR7A 3BGAA 2FNWA 3LZRA 3E9TA 1L7IL 4K5PA 2WSDA 5GZNC 3QZWA 3W1ZA 4Y2NA 3BAWA 3GSXB 2C7UA 3FO1B 3ZKQD 1BFOA 1GGCL 4FNRA 4OIIL 1YEFL 3DJSA 1JPGB 2QADD 4X4KA 2OA9A 4QT5B 2ZF8A 3AS1A 1DQML 2GJPA 1OP9A 1WGOA 3MPCA 3DIFB 3HE7C 4UMGA 4R4FL 2AV1A 2XN0A 3V0VA 2W9LA 1JD9A 4P9HH 4RMRA 2RHEA 3QG6B 5T3XH 4HUWB 3VQLA 2Q7NA 2YWYA 4BH7B 1J1OH 4FLRA 4I2XE 3CDFA 3UG5A 5E24E 3HZYB 2BHYA 3I74A 4C56B 1P5VB 5C3IA 4XHJD 1U8LA 2NY7L 3HNSH 2YS4A 2MJWA 3S3PA 3NCWA 1S7VB 3ZBMA 2YXWA 4LIQH 3MLWL 4RGNB 3N9GH 1T21B 4TOYL 1CICA 4XBGB 5DWPA 5HYIA 3IMSA 3GIZH 3BOVA 2APTA 1TZOA 4N85A 3GMRB 5FECA 4IYKA 4YBQD 1AACA 1IBDA 1IRAY 2X4RA 4BFGA 1P69B 3DSNA 4HIQA 3P30L 4NZTH 4XNMA 2OK0H 4UYQB 1CDUA 4FQHB 2OR8A 3PQYE 3UJTL 4Z3GA 3CC5B 1GC1C 1RZFL 4JL2A 3VB8A 3QIUC 2X5PA 1AGBA 3A67H 3WYRA 2VSKB 3ARDA 2EH8H 4X9HA 5KSAA 4EI5A 3VXMA 5JHBA 1ZT7B 4TNGA 2LFGA 3WY3A 3W5MA 5JHDB 2Y06H 3CGTA 2B5IC 4M6MH 4QLWA 3OV6A 2BXZA 4JFXB 1N5YH 3MRHB 2B2XL 4L1TA 1SDAB 2CG9X 4GG8A 2NX5B 5EZIL 3MA9H 3FT4A 1LP9E 4KHXH 4CNIB 1OT2A 4PJ6A 1PJWA 3L1EA 3JWDH 2VZ3A 1OL0A 3AM8C 1FO0B 1AQKH 3KPLB 4X99A 3SKUD 3IF1A 4YDIL 3K6SB 4PWIA 1U41A 3PGFH 1ZAGA 3W9EB 2FX7L 1YDPA 2BSDA 2GJ6E 2N7BA 4RH4A 1A0QH 1T7XA 3S7GA 5ERWA 4E41A 2WIIB 2QPFA 3SDCB 3PABB 4FJ6A 4GQ9H 4GY4A 1UYWH 3OXRA 4GO9A 3K6FA 4ZFGH 2TSBA 3CE1A 2O4EA 3BSZH 1QO3B 5EU3A 5GGRB 4X5WB 2OMNA 3SBWA 1I31A 4M7LT 3ARGB 4Z77B 4AQEB 5DDHA 1ES0B 3CZGA 4WO4A 4P46B 2VM9A 4JHAH 5KVDL 3WUZA 3UGUA 2B1AH 1CDIA 5IQMA 2BOBB 5TPWL 4LL4A 5INCA 1HT6A 3MYJB 2Y5EA 2AFNA 4U6TA 1GCFA 1CD1B 3AMKA 4E9QA 2WUCH 5IHWA 1M57B 2Z4QA 3CZNA 4P8QA 2NNAB 3FSZA 1FWXA 4JQVC 2MMXA 2APXA 4NN6B 4NNXA 3HE6B 5KVFE 3IDJB 3WFCH 1HE8A 4JO1H 2Q9OA 5TDNB 2WXKA 1FNAA 5EDXA 2H26B 4OBSA 1G7HB 1UWXH 2EYSB 2VXSH 4NERA 1G9MH 1Z0MA 1I9JH 3NT0A 5DZPA 4M7ZC 3HMWL 4DKEL 4PRAB 3CZEA 2WBJD 4JZNA 1YMME 5CLXA 1R0AL 2NTFB 3O6FB 1HYSD 5E6IB 4K0OA 3RQ3A 3DRTA 2R83A 3UBXG 1MRCH 3TCLA 1KJ2H 2DQTL 3ZGIA 3T65A 1TJXA 3E8VA 4FXTA 3PAYA 2D4DA 5EA0H 2VDQL 1A6UH 4PHXA 5IK3B 4XXCA 1F5WA 1ZE3C 3THML 1BMWA 3LN5B 4IRJA 5DJXA 4UTAH 1UHVA 1YJDC 5IFJA 2X4NB 1AD0B 1EZSA 4FRWA 5F1IB 5ANME 2XTJD 2A38A 4LLMA 4N6QA 1XL4A 4R0LB 5I0XA 3FB7B 3LOWA 1GVIA 4LLAA 3FQXA 3U1SL 1J9SA 3VFUA 4IIQA 4PRNB 4XWGH 2J2ZB 5ECJE 4G8FA 1A1NA 3GSRA 1KPRB 3HHSB 4UOW1 5JHLL 1KFAL 3LZOA 4H25B 1TT6A 3QZWG 4CC1A 3CXDH 4JFDE 1CE1H 2GK0A 1ONQA 3WSQH 1WCQA 1PKQE 4XNBA 5SV4A 3ARPA 3EHBD 1FZMA 3ILDA 5HGAA 3TM6A 4G80A 1RH8A 4PRID 1OO2A 4PB9L 4YEEA 1ND0A 4WZ9A 3G6JA 4TVPL 2ZKMX 2CIIA 4XOAA 1F18A 1ZVSA 1UCTA 5HVGB 2AXGB 3NCYP 4GLRI 4A7UA 4H88H 4AYMC 4YX2H 5FGBA 4K23L 5I15L 4AENA 1A14L 1S5IL 5FYJH 1S7UB 4IIZA 4ELMB 5C2BH 4FOMA 3EJSA 1VEPA 4L4VD 4MA7L 2G75B 3GNML 1UWEL 2B39A 3TIEA 3F00A 3ZE0B 5C3LD 5DXWA 4GQQA 3O8XA 4YHKL 2MEJB 3CTTA 5AVYB 3HG1A 3P9MB 1UM5L 4FMVA 4DKFL 4H1LB 2EVGA 1HZLA 3S4SA 1RUML 1YEEL 2CK2A 2XIIA 4FFTA 4UV7H 4LSSH 5T5FL 5BZZA 1S6NA 3G08A 3KEDA 4TRPH 3V4VH 2FQEA 4OZIF 4YPGB 3B2XA 2K78A 3CFTA 3R06A 2XX0A 3IDXL 4A6YB 1I9RL 1XZ0B 7FABH 3KDMA 5KANI 3QO0A 1SJVA 2EDOA 3P9WB 2UUDK 2A9MH 1JHLH 1RZ7H 4FNQA 1IFRA 4MB4A 5LAPA 5A2LH 2IMNA 3K72B 1CGSH 2XY2A 2AVGA 1YAZA 1KLUB 1CPUA 1XGZA 2VISB 1CICD 4WFGD 5CKGA 1A5FH 4E9VA 4N90E 2QTEA 4LK4A 1OK8A 1IX2A 2QMKA 1FGNL 5F7UA 3PP3H 1TKWB 1DBKH 3V4PA 5J1AA 3MMEA 1WF5A 1F56A 4D8PB 1S9KC 4ZDHA 1WYJA 1GSKA 3FTXA 4LVNB 1CU4L 4MCYA 1W72A 2NZIA 2LTQB 5IMMB 2X1PA 1UTDA 1IQWL 3HFML 1FNSH 2ZKXA 3FQNB 2X6UA 4UDTB 2HT2C 2XZAL 1WITA 2JJUA 3HNVH 3TN0D 3ARDD 2H1LM 4XMPL 1NEUA 3CHOA 3UG3A 4EI5D 1F4XL 4ICWA 5KS9A 3QJXA 1ADWA 4L3AA 3MJ7A 2F8VA 2PCPA 4X50A 5EUKA 1RJYB 3SDDD 2Y1YA 2IMMA 3WMSA 4OB5L 4CN4A 1OTUC 1OSPL 3PV6A 1XB3A 5D7HA 3H9ZA 1UB5A 3BP5B 1UJ3A 5L4MA 5H35B 1EGJA 4P3CH 3SJVB 3A6BL 2EDHA 3JTSB 1GS7A 3KR3L 5E5MB 1T66C 5DSCA 4OQTH 2WLJA 4E41D 2PO6B 1I85C 1BP3B 3B7SA 4N0UE 2FJHA 5CGYC 5LB1A 1QFPA 3OPUA 4KKRA 4XAWL 4FABH 5FA4B 3U6RB 1DFBH 4BQ8A 2Z4TA 1YAIA 3GSUA 3GK8L 4HA1A 1ODUA 1VFBA 4RFEA 3EH1A 5JW4N 2EC9T 4A7TA 1I7RB 1AMXA 2WXJA 3RP1A 1A4AA 4ZQKA 2WTOA 4FC3E 1K8IA 4FG2A 1DSWA 4FQ1H 4XCFL 1IEHA 4JMNA 3LXUX 3FO9A 3WUWB 3WLWC 3FZUD 1S9YB 5FWRA 4V2BA 1KPVA 3AG1B 2V37A 3RDJA 3JT0A 3ZTNL 1L5GA 5D4IA 1UC6A 2F54B 3BN9D 5FO9A 4C4KT 4OJFH 3EYOB 5JQ6H 1P5UB 1UD8A 4BM7A 1L3NA 3HFFA 4PRBA 2V5TA 5LCVL 2FLMA 1G9HA 4LEEA 5J12C 1N0LB 4NO0B 3QJHB 4LOVA 4R26L 5HYSA 1KB3A 3QXWA 1RIUL 1MY5A 4H8WL 1TDQA 2G3ZA 4X4XA 2W0KA 2WO4A 4AL8H 3IDNB 3QYCA 4PY7B 3ROLB 1YYLH 1CD8A 4IOIA 3LH8A 2BWIA 2EXTA 1CZ8H 4KXBA 1U3HD 2YBRB 3MLSL 4BZ1H 4H7VA 2A6IA 3BRDA 4KZCA 1TITA 4HWBA 2DMHA 4AJWA 2VYRE 3B9KC 4PJIB 4TSCH 3VFWA 1IC0A 2PTTB 5DK0A 2BFVH 5DHYB 4X9GA 1JZ2A 1ADQH 3VVVA 4M8QB 1B2YA 4L29B 1WD8A 1UT2A 1RK0B 3B83A 1DJYA 3LS4H 1HILB 4YMPA 5EFIA 2QVMA 2CU9A 3NOIA 3G9AB 5DJ0A 1LWRA 4YDVA 1OHQA 2ZJSL 1RULH 2WZ6A 4HCRL 4KZDL 1FIGL 4FHJA 1C8PA 4YQXH 4OCYL 1S7QB 5KZCB 1MLBB 3TT1H 5MENE 1B90A 2XN2A 5DQ9B 4YPJA 1ZT4B 2X4SA 2P24A 3QDAA 4JJOA 4LLDA 1ZK5A 4PUBL 3S4SG 4X5XB 1YECL 1T80A 3C2SA 1ZS8A 1JZEA 4I89A 3EIFA 2CO7A 1G7LA 2J4WH 3Q2CA 4PJ9D 3UTZA 4BFNA 2B4CL 1CGXA 1JWSA 1N3NB 3BKCH 3V8CA 4S10A 3V0JA 4Z7UA 2EZ0D 4BCXA 2C3GA 2V5MA 5EU6B 1I1AB 2ESVE 3NN8B 1YNTA 4HIPA 1KTDB 5DYOA 3KCPB 1PGRB 3KYMA 3GHBH 3PWNA 5EZOH 3VDCA 2DN7A 4QRQB 1IL1A 2VQUA 3G6AB 4HWEL 1G84A 1ZA3B 3IB4A 3L3OB 1FE8H 4HCGA 2NY0C 3T0WA 5HHOA 3WMPA 1GYCA 3FT1A 1BSIA 1NBVH 3VD1A 1TZGH 2K4WA 1DEEB 1MIMH 4LU5H 2WSPA 1RHHA 4XRCA 4G71B 1NCDL 1YY8A 5AUMA 4FG4A 1CL7H 3MSPA 3QUKB 4FXGB 2Q3ZA 2NOYA 4ENZA 5HJ3A 2SEBA 4NFDA 4IOFC 4XN2A 2YQ2A 2DQUH 2E4TA 3E7JA 1OIOA 3LNFA 3PHQA 3KBEA 4K8RL 3L7FB 3OZKA 2F15A 1BECA 1SRDA 4AEFA 1NCNA 4GUPB 2BRRH 4NKOA 4NQDE 5I8OL 4DQOL 4PW9A 3IJSB 4ODXB 5I66A 2FSDA 4AIZA 1IFGA 4MXQD 1IE5A 1IGIL 5CD5C 3KPRB 1DBBL 3MRQB 1MWAL 1KB5H 2ZX8A 3MV8D 1GGTA 1BEYH 1EO8H 1FLRL 4I3RL 2XZCL 1T1ZA 3CLWA 4G83A 3EJYD 1GTNA 1XCXA 3W9DB 2G9HB 4J3BA 4N2DA 2XVBA 2OYMA 2WQWA 3DX7B 4RMBA 5D1XA 5C0CE 2W80C 3SOBL 3MFFA 3MOAL 4D0DA 1SJHA 1KCWA 3OBAA 3PJSA 3TT3L 5E7BA 2R8SH 1IKNA 2E6PA 5JLZB 1PDKA 1AQMA 2R4SL 2PXYA 3LQZA 3AG4B 3LKSA 4MD5A 5I5JA 4O2EA 1A8ZA 1XXFC 1WWBX 2EILB 1LO0L 3H3PH 3CHSA 4ICXA 5I6PA 5IVOA 3U46B 3DK0A 1ZLSL 4JRYE 4OZFB 2BRQA 4QY8A 1AGDA 1E9QB 1CGTA 2HAZA 3IN0A 4I1RA 4M5YL 4DEPB 1QBLH 4N6RB 1XFPA 2ZICA 1DEDA 4ZZKA 2JIXB 2XLLA 3D52A 4KO5A 3VI3F 1NPJA 1E4XL 5EU5A 3VWKB 4MNQB 2FX9H 5H94B 1WZ1H 2Y5TA 3FF7A 3N1QC 2W8CA 3I6KB 4P2OC 3RWCB 1OAKH 5DHXB 4AQ1C 2RGSA 1JZDC 2KZ1B 3IJ9A 4LQFH 3WHXB 4M8RA 2A6KB 4AT6B 1U36A 4CVWA 1AOZA 4GBXD 2CKBL 3E0GA 5D96C 1G7MB 4YVNA 3U0TA 5IIEA 2WXIA 4IW4C 2A1WL 2R15A 4WSGA 4PRHB 3S96B 3L4YA 2X2IA 5LBSH 4C83A 5AENA 1NCAH 2EKSA 5BO0D 2VE6A 1GC1L 1NCOA 2JTYA 1CR9H 3VXSB 3MCKB 4GUQA 1T03L 3K5SA 3WFDH 3L1GA 4MDIB 4LPWA 4WHYG 4LHUA 3Q8EA 1TJHH 3ZTJH 1J0IA 4L8SA 4XI5D 3F83A 3ESMA 2R27A 2DYPA 1JNHB 2P80A 4LP5A 3V6ZB 3LKQB 1OPGL 2EUWA 2FWOA 3GS0A 1FFTB 2C34A 3ARYA 3JWOC 4HC1L 4FG0A 5FHAL 5HJBA 5T1MB 3U6XA 3CFUA 4KJWC 3UAJC 2Z1PA 2N7AA 4HT1H 5K9OB 4FL4B 5CIPB 3GXPA 3M7FB 2VRAA 4HGMA 5JHLA 4GW5A 3AU1A 1PFCA 2B9AA 3U4AA 5CAYB 1NCBH 3ESNA 3OR7A 1UACL 5AB1A 2VC2B 4JY5H 3F7YA 3MLTB 3HKFA 4G59C 4LHJB 4JFEB 3TBWB 2H0EA 5I1JH 3IFLH 4GSXA 4G9FB 5JW5B 1E5BA 1QWHA 1B0WA 1T4KA 2GHWB 5AW3B 5AQ0A 2NW3B 4XX5A 1QWNA 2OMYA 4B60A 3NJHA 3KL3A 1FQ9C 4G6MH 1JGEB 5ADPH 3BKMH 3VXNB 2ZP8A 4POUB 5KEZA 2G3MA 3U6RA 1FLTX 2EDXA 2OM5A 3MV9A 1S9XA 4Z7VF 2DIEA 3U79A 2NLJB 3WAKA 4DKTA 2WUBH 3GXIA 4JANA 4NI3A 3NABL 1G7JA 4QF1B 4XMKH 3LNIA 2R2CA 1EMTH 5I6XC 4U1NA 5BQDA 3LH2H 3BD5A 2DH2A 4JFFA 2OXHB 4Z7WE 1J86A 4NAQA 1P2CA 5AAMA 3UTTA 4IS6A 5T5FA 3TO2A 1QASA 3H56A 5F97E 4Z76A 5CR1A 2CKBB 1AKPA 1JPSL 3T9WA 1MAJA 4XH2A 3WY2A 2XZQH 5TTRA 2VN3A 3B8YA 2W60B 2YPLB 1Y07A 4GFXA 2DM7A 1AGFA 1DUYB 1P7BA 3SSGA 3VFRB 4Z23A 2VITB 1MHEA 2I07B 3TWCL 4ZTOH 1QZNA 1NCWL 4GAJH 5GPRA 3DJTA 2KPNA 2DKSA 3ESPA 2FATH 3HN3A 1KCBA 5CBEA 3L16A 4XP5H 4FFVD 3SQOH 4W9EC 3FK3A 2BH0A 2MNJB 2P52A 3HS9A 5EF2A 1UZ6E 4GS7C 3BDBA 2BHZA 4FQCH 1JFQH 1ZSDB 4ZUSB 3VI4B 4A2LA 1B0IA 2GITA 4YC2B 2RQ8A 5MEPA 2CUAA 2LQRA 1Y1UA 1GXEA 1S3KL 1MFAL 4LAQL 1CL7I 1DL7L 1XGRB 1X5IA 4F3FB 4XE0A 5FO8B 3WENA 5I1KH 4RNRB 4PVLA 4LOUD 3FQRA 4UT7L 3HN5A 5JOFA 5HPMA 5B39A 2ZWYA 4RMWA 4HAGA 2GFBB 4HHAB 5KW9H 4Y8AA 3UFIA 3QIBA 3IDYC 4AKOA 2DH3A 4GXUN 1AO7A 2GIYA 3CVIL 3HG5A 3HUJB 2PYFB 2XTJE 5AW9B 1XSKA 1Q1JH 3GB7A 1BZ9A 4YDZA 4I48B 4YXLL 5K59F 1MQKL 1IAIL 4KKCD 2QQNL 4KNTA 3L5WB 4K3JH 1R4XA 1G7PB 2DQFA 2GSGB 2DQCH 2JXMB 2FVNA 3FB8A 2XIDA 5GS2D 3SB3A 1QMUA 1MG2C 3DKHA 4X6BB 3I02B 1PIGA 3T0VA 3M1BA 2FH6A 4Q9CA 3VFNA 2DIJA 1EEUA 1NAMH 4LCWA 4O51B 4GQRA 4KHTH 4PRIE 2Y36L 5TQ2H 2DD8H 3QUZB 2WCGA 3ZMRA 3EG9A 1QNIA 1U8CA 4LHUG 3BH9A 1FN4B 1D7CA 3PL6D 2C9PA 3F7RA 4ODHH 4PJAB 3B56A 5K9KA 1WEJL 4S1SL 3PP4H 1JZ4A 2EUXA 2DWTA 4MRCA 4XPGL 2DLHA 1V3LA 2XN9A 4LXFA 3KLHD 4LPCA 4L4VE 4N2EA 1XH3B 4YXKL 4L48A 3CQQA 3CFQA 4RESB 3W39B 4ODWB 4I18C 4NC1C 2HRGA 5AALA 3KYNB 4J6RL 5JIIA 1OE1A 5A2IH 1TZHB 3VQ1C 3BD4A 1D6VH 1KDIA 3DO3A 3D4ZA 2WXQA 4HK0B 1LILA 4JDEA 4JM2B 4QHLB 4WHTA 2ZUXA 3OAUL 1J8HA 4LGRB 4M48H 3L7FA 1Y7VA 4NUJA 3TPKA 3VMOA 4LHUD 4P2QA 2HJFB 4M5SA 3TJPA 2VDRH 2XV6B 4M6AA 3ASOB 4UQEA 1MJJB 3A6OA 4DWHA 4OGYL 3QNXB 2DYPD 1C08B 2P80D 3APDA 4BSJA 2A9NL 3DX6A 3B2VH 4RFNC 2MHAA 3VFSA 3MU3A 5FM5M 4AMKL 4I0PA 1JOIA 3U30C 2NCEA 4NENB 2WLYA 2BOCB 1HI6A 3ESOA 4F8PA 3BFWA 3FT3A 2VL5A 3UZQB 4HGWA 5ID0A 4MBOA 2BMKB 4OLYL 4WFGE 5DLMH 4AUUA 2XX1A 3N43F 2R0KH 3OJDB 4MD0B 2EQDA 3APMA 4F7KA 4Q7DA 1FL5A 1SXZA 5GGSY 3ZL2A 1INQB 3U2SB 4TS6A 3ARZA 1MCLA 2JKXA 4HIXH 4RRPG 1XTMA 5L88H 2R29A 3AVEA 2PWDA 1PG7H 1ODAA 3SE3A 4JPQA 1SHXA 3GZKA 4HUNB 3E6FA 3EH5B 1RIHL 2WZ0A 4JL1A 4AWJC 5T1LB 2AXJA 2UZXA 4DEWA 1G5AA 2ICEC 3STBA 1TVDA 1WBYB 1A6ZB 2X89A 4KTDL 1EEYA 4EBQL 1TQSA 4G11A 3MV9D 2P5EA 4APQC 3O2WH 1XF1A 1CD9B 4X7FC 2ALWA 1RD6A 1Y18A 2OJ1A 1BF8A 3IU3B 1AYOA 3CVHH 5GRJH 1A3RH 4IU2B 2W65B 4EN3C 5L0QB 3BWAA 3QGVA 3TWYA 4S1QH 3N1PC 5DFAA 1X5GA 5B21A 1TR7A 1T1WB 2VTFA 1JV5B 4XMZA 2BCKB 1D2PA 2G2PA 2WQAA 3RWEB 3ZZ1A 5E08L 3DJZA 4AYGA 3BDYL 3VWJD 2PR4L 3DVGB 3LXBA 1E50A 2VR7A 1U91A 1G9NC 2HX9A 5DVPA 4JRXD 3H9SA 1JNJA 1KCSH 3MREA 4HBCL 1M7IA 1M1XB 1HEZA 4X7SH 3QNFA 3MRCB 2GG1A 5GGSA 4A1RA 1NDMB 4PJCA 5LDSA 5E1IA 4LSTH 3ULUD 4OLWL 1CGWA 43CAA 4X6CF 5B39G 4U1SB 3AXIA 3WNMA 3U9UB 3LZPA 1UM6H 3LB6C 4PAZA 5I76A 3DXAA 4ANXA 1BZEA 2JH2A 1MI5A 2YUWA 1N4XL 2XQYK 1MWAA 5ICXB 3WNJA 5BZDA 3B1UA 5AZ2H 4Y1AD 4FGMA 3FB6A 3P11L 4P4RA 5AOZA 3WDIA 2CRYA 4TM9A 3SCMA 1KZYA 3TTYA 4B6ZA 2N01B 2G0LA 5D55A 3ZL4H 3ZMNA 4NNPH 1EDYA 2VAJA 3UH8A 3DX9B 2NY3C 5L2JA 1LO3L 5GZNA 1ZV9A 2JB6B 1OAQH 3C6LB 4YHYB 2VR3A 4NO2B 4HIHA 2ISDA 3TA3B 1MNNA 5E4EB 1VKXA 4UZSA 1G0YR 4H20L 3AAZB 3AREC 4LEOB 1PZ2A 2FX8L 5AVRB 1ZEAH 3U82B 1FL6B 2JCCB 3VFPB 2EC8A 1XF4B 3HE7A 3QWQB 5CSZA 5KYYB 1CBVL 3LCYA 5DK2A 4HPOL 4QRUA 4QYAA 4AM0A 4EDXA 2OX5B 1I3RA 3OTTA 4JGMA 3VXNA 5CF3A 4Q0XL 5DC4B 2GC7C 4ODVH 3SKNB 5C86A 2MTPA 4Z78B 1XAUA 4Z7VE 2WQ8A 1PG7W 1BQHB 1ET8A 3ILQD 1RVFH 1UJTA 4H0HB 4Q6IC 5HI3D 4GAAA 4KVCL 1E27A 5HYQB 2VUYA 1RZPA 1F86A 1FZJA 2XKUA 3VRIB 4YSPA 4L37B 1DCLA 3B6SA 4NZRL 1XIWD 3VD3A 2Y24A 1G6RB 4XPTL 4X8JA 5C70A 1VF5C 1MPAH 4UTBL 3DVNA 2P26A 3G6JE 2OZ4H 5FK9B 3AQZA 3OXSA 5DEZA 1NFDB 2CSPA 5AOIA 3FU0A 5KYNA 1QSFB 2FT7A 3GDCA 3U83A 1QKZL 1D9KC 3BEVB 2MCPH 1OSZB 3BPLB 3UP1A 5JTWA 2XN9D 3O3BB 1KJ3L 4YFLI 4X6FA 2WLNA 5DVNA 3QIUA 2AABL 1L7TH 4UI2A 5IROC 1UCBH 4Y4KC 5HI4D 4CN1A 1C9SA 3B9KB 4AGOA 3VFGH 2YMXH 1LK2A 4OQ1A 2YRPA 3QULA 3E1ZA 1RY7B 2WVVB 2BSBA 3LNHA 12E8L 1GIGH 1J8HD 1MVUA 4IQHA 1OP3H 3AM8A 1GYVA 1MSPA 2G3NA 3K4DA 3KS0H 3NK4A 2CXGA 2XG5A 4P2QD 5B22A 5CWSB 4RX4A 2VH5L 3RZCC 4DHLA 3C6EA 3VMPA 1H15B 2DQJH 4OCRL 1D7FA 3KPPA 4RIRA 2BSCA 2AGJL 4NO5B 5D4QA 5CS7A 1YEKH 3U0WL 1KG0B 1E3FA 3T2NH 4OLUH 4H26A 4I0PD 1NKGA 2Z8SA 3IDGB 4GT7A 4HUXB 4QHUA 1WGVA 2OP4H 3ARXA 4IRSC 4QJ4B 1PZUB 4Y5VC 1YRKA 5C7XH 2D3JA 1D6EA 4AYID 3VFTA 1JZHA 3BT2H 4XBPB 5TJWK 3QJUB 4PJ8B 1JGLH 3LRHA 3FUEA 3N0PB 2VERA 4NRZB 3OR6B 1GGBL 1S78C 1H3XA 4H8VA 3M1CA 5K59E 3EYSH 3MV8E 4GIPD 5EBGA 5D2NB 2G9KA 5DA0B 2ICWJ 1UZ8A 3HTLX 3FQTB 4QRSB 1ID5I 3BUYA 4WWKB 1PFOA 2XETA 1ASQA 2HP4A 4FQQB 4JQVA 4OFVA 4WHDA 4XNZC 3S48A 1AFVL 1UA3A 3T0EB 3BGFB 4MNGE 5AOKA 4PJ7E 5BRZB 5LBVA 4O51A 2N1KA 4PI2A 4OTXL 2IAMC 2VN4A 4PVNA 3U36A 3N1MC 3B9DA 5J6SA 3WN5B 1TJIH 2YD1A 4KVNL 1KXQA 5A2JH 4YIQA 1OGTB 1E8WA 2X89D 3EJZC 2YAMA 5JMRA 4JN2A 1S3RA 2PTVA 4WI2A 3T0AA 2NNRA 3WL9B 4A66A 1E9PA 3DX8B 5EF1A 5I1LB 1T89C 3JWNG 3K2UH 1OP5K 3CSBA 3V5HA 1BQLL 2HVKB 1MHPL 3QFGA 4WW2C 5C0FB 3C60C 4MRBA 3OX8A 3E80A 1JTPA 2QGDA 3U4BH 1VADB 4WI8A 1B4TA 1KPUA 2QGCA 4XT1C 1CUOA 1MXGA 1NM4A 4X6EA 1YPZF 5IW3A 3NP4A 3AMLA 2NMSA 4RAUA 1FNGA 3BWSA 5ID1A 5MEQB 5KAQF 4S1RH 2O61B 3VGDA 1KXTB 3SE6A 2BS9A 4QXWA 5DURB 3O2DL 1G7IA 1H0DA 4WQOA 3MRNA 4MZIA 2V7HA 3KWWA 1H9DA 1FF5A 3UZEC 4RQQB 4U1HA 3RYMA 1M42A 3FT9A 4Z0BL 4A2HA 1XR9A 1P4UA 4CU6A 3KHQA 3S3CB 2V7NB 4HF5L 4AV0A 5C9KA 4ELKA 4FQXB 4FQ2L 1GGCH 1Q8MA 1MI5D 3B2UC 5F96L 3O11B 4XP6L 2G3XA 3I3EA 4LL9A 3H53A 4OLVL 4FJZA 4JJ5B 1AP2A 1DQMH 4AYEC 5DMIL 2ZT9C 3LRKA 3D69B 3E3QE 3PUCA 1A4JB 1H9VA 3BT0A 3PUUA 5JW3L 4BFRA 1NCJA 5CHNA 2DI8A 2B7DT 3P73A 3AABA 4MMYA 1KV3A 5GZND 4Z7NB 4P4KB 3R0NA 3B9VA 2OXGB 2A77L 3HRZB 2YUZA 4FMKA 3QORD 5SWZA 1XF5A 4W4OC 1OGAB 4G72B 4XMVA 4ZW8A 5ABZA 1SVCP 3QCTL 2W59A 3ZPDA 2BIHA 4HMEA 5D8JL 3MLWH 4FAAB 5L2KB 4OLZL 2R0LL 3BDXA 3MR9A 5C0EA 1JRHH 4YH6A 4TOYH 1QAWA 1BVKA 4M5ZL 5JDSA 1OM3L 4XVTL 3ULVC 1TZIA 3MTRA 5EZPA 5EBLA 2J8HA 4U3HA 4TL4A 4PR5B 4XOBA 4QOKD 2E5EA 5GZOD 2IQAA 2W38A 4BDVA 4Z9KB 4C59B 3P30H 1GS8A 4PGDA 3UJTH 3ZQWA 3QC5X 4JB9L 2FR4A 1E4JA 1RZFH 1BVZA 2OPCA 3BMWA 2CR3A 2Q87A 4I3GA 3U4EB 3W0WB 1YZZA 1UOLA 2IALB 5FF6B 1U8HB 5ITFB 4QHNB 3AY2A 3MBED 5HP5A 4JPSA 2RCSL 3ULAB 1OCZB 4PGEA 2B2XH 1MW1A 3VXRD 1HQRB 1DSFL 2DLTA 1QA9B 2WLZA 1RZIB 2JQMA 2EVFA 5EZIH 4OUUA 4M93C 4JDZB 2BNRA 4Y5YC 4Z7UE 2OULB 4OFKA 1NUFA 1A6VH 1T6WA 4NQXA 3G04B 2EIKB 2E7LC 3II1A 2IFFL 3FONA 3QIUD 4FQJL 2Z6FA 4YDIH 5EB9A 3OWEA 2FX7H 4X6CE 3L45A 2VLRB 3H7LA 2IH3A 4AH2B 3KW8A 3UTSB 1KLGB 3NRPA 3QH3B 4KAQL 3C5ZC 4V2CB 3MDJA 4B9JA 1D5MB 4E2OA 3MV01 1B4JL 3RAJH 2ARJB 2GSIB 5C6WH 1WRFA 1N8OE 4M56A 5D7IE 3DI2B 1PQZB 2CGZA 1NUNB 2WY3B 1XO8A 3V55A 5KUKA 4YE0A 5KVDH 3WN6A 2CJUL 1SDDB 3U7WL 3N5AA 5TPWH 4ES8A 2DI7A 4Z95L 2QTVA 4JPIA 4K2UL 4NS0A 1VPOL 1OF0A 3D0VA 4MAUL 3DC0A 4NZJA 3Q9PA 2J72A 4R6UA 4M6NL 1QSVA 1TPXC 1KGJA 1AGEB 4KK8D 4O00A 4PGBA 1X5ZA 5KSUB 3WTSA 3ARVA 2XPYA 4XNQB 4ZUVA 3ISYA 1S9WA 1IJ9A 5F7DB 2IANB 3G5XB 3O41B 1JWMB 5FKAB 4BQCA 4F15C 1H6FA 2X1OA 1TJGL 4LP8A 1I7UB 1U8IA 4QRPD 4UT9A 2AQNA 5SWQA 3HMWH 8FABA 1DVFC 2WWMD 3VG9C 1IUZA 3BZFB 4DKEH 4DK5A 4X8GA 1ZTXE 1JXKA 3CFDB 3RGVB 2GTWB 1R0AH 2QSVA 2R2HA 3UEZA 1Y0LA 2HH0L 3MJWA 4PJXA 5T1KB 1J10A 3BX7C 4BD4A 15C8L 3K6IA 2DQTH 2CA3A 3QQXA 3STLB 4KJQD 2AS5M 1B88A 3F7VB 2ZWLT 2VDQH 5ELIA 3EYUH 5GRZA 2H4EA 3THMH 5C0IB 1R5WB 1NCCL 2P8LA 5D93C 3GMLA 4MSWA 2C1PA 2HFEB 3WY1A 2I69A 4CMMA 4UILL 1F58L 5EORL 4I5BB 3ECBA 1OCRB 4XVUC 5PCYA 2F18A 4MNHB 1BM3L 1MW3A 4HJIA 2V2WB 2WLLA 5HJDA 1CS6A 1KFAH 5JHLH 2AJ3B 2J8UE 1Z5LB 2GJJA 2O30A 4HEMA 5IB1A 3TBYB 4AGQA 3B9KA 3FOLB 2EEFA 5T3ZL 3OD3A 5ICZA 4DH2A 2WVVA 4PB9H 4LNRA 1XF2A 4IU3B 2ADGA 2GBVA 1A02N 2H8PB 2YPVL 4TVPH 3D09A 3B2PA 3ARFC 3ZKMD 3BSGA 4WU7B 2ADYA 2WWKT 3C75A 4K23H 5I15H 3H4HA 2EYTA 2CHWA 1REIA 1A14H 1S5IH 4G6AC 3SN6N 2IV9A 4MA7H 2YAPA 1ZGLB 3GNMH 1H5BC 1UWEH 2FJFB 4YHKH 5I26A 1CFVH 1SOSA 3QB7C 5D71L 1OOWA 4DKFH 1UM5H 2GAZB 1RUMH 1YEEH 1VGKA 3MBWB 4HCFA 5A40E 2L4OA 5T5FH 4KNSA 2OMZB 3CPLA 2HLFC 3NIDB 2GTZA 4B5EA 1FAIL 1D5BB 4WUKL 5FYKU 2X1WL 2PWFA 1XQ4A 5ECGA 3IDXH 1TYRA 1FFPA 1I9RH 3AUWB 4P5SA 1AR1B 3F5WA 5F9WB 5I5MA 1I8UA 2WWNA 3GBML 4FP8L 32C2B 5IQ9B 2F58L 5HHXL 4BHUA 5F3BA 1P84K 1LE9B 3CBKB 6CGTA 1ZCRA 2EE6A 1PNDA 2Z65C 2P5PA 4FCAA 3IAPA 2DWEA 3NCYS 2ZWZA 1R34A 2I9TB 4XOCA 1FGNH 5E23A 1O9VA 5IVXF 3RFRA 4WFHD 4EE2A 3HC2A 1W0VA 5E6SB 1AIFA 1CFTB 2R2EA 1IM9B 1RP8A 2HJKB 2DIBA 4KI5C 1CU4H 4HZ1A 1DZ0A 3V6OE 3L6FA 3RWJA 4R97C 1IQWH 3HFMH 3BXNB 1WA1X 2YD2A 3RWHA 5E99L 3EF4A 4L1BA 2YZ1A 4PJBA 2XZAH 3CVBA 4KMLB 3RE0A 3MV9E 4XP9L 2AJZA 1F4XH 1I7ZB 4CA4A 4KX9A 3W38A 2BSTA 2IF7A 1HHKA 2OMBA 4OB5H 2OFQA 2CLRA 1FNEB 1OSPH 1NBYB 3NJNA 4ABQA 5B38A 5IR1A 4ZUWB 1BF2A 2KQNA 2X09A 3A6BH 3I75A 4N0FB 4PREA 5I71C 2Z93B 3KR3H 1WAEA 2FYYA 1J88A 3NFSL 5IB2A 1CLOL 4IKLA 4GRLD 4S0SD 5BUPA 1UB6A 4JRXE 3PWVB 1IBFA 4BK5C 4OZIB 4XAWH 3BW9B 1E2ZA 1QEWB 3GBNH 4HD5A 4MQ7A 3VRLF 3GHEL 3GK8H 2E0PA 3ULUE 1PLCA 5L4FA 3TGXA 4U6YA 4L0PB 1XV8A 1NQBA 1BBDL 1DVXA 1DN0A 3QNYA 4GFTB 2X4UB 4XCFH 4MQXC 4M7JL 4ATTA 1DZBA 4GIOA 1BD2B 3WDHA 3SYOA 4DZ8A 2AITA 1E9OA 4UAHA 2YAEA 3L17A 5KYXB 1K6QH 1Z5YD 4EIBA 1FPTL 4U1IB 1F02I 1EH9A 5CD3B 2FYVA 2QLVB 5LGYA 4Y1AE 3ZTNH 3PFQA 1Q9LB 4Z5RA 4P2OA 3K6DA 4TL5A 1N70A 1EDHA 2CNYA 5TE4L 4AQ1A 3D3VB 3P3SA 5LCVH 2B59B 3T4YA 5GSRB 3VMNA 4XVJL 3ECWA 2AQQA 3PRZA 4RFOH 3WLWD 3GEWB 3KL5A 4R26H 5CILL 5E8NA 5LGHL 4PS7A 3MLPA 1LEGB 4TN9A 5DVOA 4X6DA 1RIUH 3JTTB 2ADIB 4UCFA 3ZGHA 4H8WH 4JZJC 1Q9WA 1TTRA 3D0LB 3BZ4B 4JLRA 2XPGB 1RUQL 3CN0A 2B77A 4R7NB 3MLSH 5LGJA 1KWKA 2YJLA 3KPOB 2X2JA 4Y16C 1XGQB 2PWHA 5CP7B 1DUZA 1ZHNB 2C5DC 5K5YA 2ZXWB 2XV0A 4A7VA 1MFMA 3MN8A 2EUVA 2EC9U 4UZUA 3WIAA 3GSNL 3LZQA 4DP5X 4GSDH 2WNGA 4YJZL 2OW7A 2ZJSH 5C0AD 3GUTA 2DM4A 1BFSA 3LRSB 3NCCB 4HCRH 4HLZG 4MQTB 1FIGH 3V95A 3ULSA 1GY1A 5DU7A 2JE8A 4NUMA 2FJGA 1WS7A 4OCYH 5ANHA 3UAJA 5GS0C 5M95B 3SDAD 1EX0A 2M8XA 4ZBJA 5HY9B 2NQDA 1LMIA 4LSDA 1IBZA 1SEBB 2R29H 3O4OC 5HDBE 4J3VA 3EYFA 25C8L 4PUBH 2BIQA 4ZS7L 3RY6C 4OZFH 1D5MA 1S7XB 1YECH 5H4ZA 5IEHB 3GXUB 2FGWL 1JGUL 1FRGL 2XN9E 2MKWA 4JHBA 5FOBA 4R8WL 4A67A 1I8IB 2W0FB 2B4CH 3PHOA 5J4MA 2HN7A 2UYLA 4NUQA 7PAZA 2IWFA 5EMYA 3V5DB 5IBTL 1T5XB 5CEZD 1TG8A 2RFXB 1CXEA 5DO2C 4X8CA 1ZT1A 3HRPA 3S9DB 1J8HE 4BQ9A 3KBFA 5KSUA 2X88A 1EFXA 4P2QE 1NEZB 2IH1A 2X4QB 3K4ZA 4C8XA 4HWEH 1A6WL 4DW2L 2FUQA 2DM3A 1I7UA 2MNUA 1UKTA 1P84J 3N41F 2V0AA 3DUSB 4LKCB 3EFDL 4FYSA 4MASA 5D1ZC 1WIPA 4L9LC 3MRJA 3MLRL 3S3SA 1NCDH 3MRMB 3Q5OA 2ENQA 2F53A 3GXNA 3PDOB 4H44C 4OFYA 2Y0SA 3M7OA 2F19L 3KLAB 1OD9A 1YEHL 2CDFB 2ENYA 2CLVB 4UM9D 1L9PA 5TF0A 3STLA 3QUYB 4WKZB 3GMMA 1F6AB 3VQ2C 3NPZB 3ZYJA 4K8RH 2ZONA 5TGBA 3BLBA 5I8OH 4DQOH 2H6PB 2UWEE 3P69A 3DV6A 2OJEB 2VQ4A 4UT6A 2YN5A 1JI2A 1IGIH 3K0WA 5C08B 1DBBH 1RZGB 5IJKC 1RURL 4MZ3A 1MWAH 2R7EA 2HT3D 3C9NB 3D30A 3DMMD 3FO0L 2C3HA 3NUKA 5I0VA 4I0KA 3JV4A 1FLRH 5CIPH 2Y7QA 4I3RH 4IOFD 1DO5A 1WFIA 2XZCH 4NAJA 3I84A 5F8RC 5GS1C 5ISZA 3STZA 1UFUA 1MFUA 2A2QT 4OUOA 5B3JF 2OQJB 3SOBH 4QIRA 3MOAH 4HX1A 3DI3B 4U1GB 4PJDF 4X0KB 3GMPA 3L4UA 2CBTA 1IIKA 2JWYA 3TT3H 2YAHA 4WFFD 1NFAA 5CD5D 3FPYA 4MDJB 2R4SH 2MSPA 3TVMD 1S8DB 1OV8A 4PJHB 5C97A 2P5WD 3TPUA 1YN7A 4FKHA 2EIZB 3AADB 1LO0H 1YVLA 4UZGA 2E7BA 1ZLSH 4PMEA 4DJMA 2WGNB 3L5HA 2DWDB 2HKHL 2PNDA 2JI1A 5ACMA 3COOA 2VLKA 4XBEL 4YO0B 2I24N 3R4DA 1NMBL 4LCUB 5FYKL 3WXVL 4CADB 4ETYA 4M5YH 3CDGA 3IKCA 4PN6A 5FC9A 1FYTD 4KKAD 1CIDA 5KVGE 4WWID 3QUXB 1XEUA 2VZOA 1KTKE 2R4RL 3K71A 1NZRA 3SODB 1E4XH 2ARJQ 2CRMA 3B3BA 4N2OA 4OLXL 4OD2A 1IAIM 4U3XA 4FTVD 5DZNA 3P4MA 3WFEL 1KIUB 1A7OL 3L4XA 3L4VA 4JCWA 4PV9A 5TH2A 3T0XA 3NIGE 3HNTL 3JWNE 3WLBB 1AJ7L 2VQTA 3AQDA 2CKBH 5DHDA 2C4XA 2Y6SD 3SDXB 2HFTA 3SPJA 3ZE2F 1IVTA 1XX9C 1YUHB 3NIFF 1BHGA 5KSBA 4YFEA 2BSSB 1MI5E 2A1WH 4QTHA 4HP5A 1G43A 1RZQA 3Q6FB 2VDNL 5HGGS 4F33A 4KV5F 2OMUB 4DP4X 5CM1A 3VDBA 1J05B 1GC1H 2YGOA 4OW6A 2QELA 2IPKB 2R23B 2JNZA 4P5MB 3GM8A 2YFNA 3UAEA 1BWWA 1KTLA 2O6FA 1N2RB 4YNYA 2F74A 3FFCA 1A7NL 1T03H 3EFOA 1ASPA 4GRWE 3H55A 1N64L 4BUQA 1U8JA 1X9QA 3WO4B 2ITFA 4JFQB 4UQ2A 3RTQD 5B7FA 4I18A 2ENPA 5JIQA 1OPGH 5H2BA 4L3EA 1DQJB 2DDQL 4JE4B 5EC2B 1INDL 4UAOC 4HC1H 4G43B 3HOGA 3HIZA 4QXTA 5GHWL 5FHAH 4ODUB 4EI0A 3MFGB 4MJ4A 5I73C 3HEIB 4QRRE 1JK9B 4O2FB 1CK0L 4AK1A 5B3NA 2NT0A 1DDHA 3GLZA 4XN7A 4QOKE 4XP4L 3NZHH 5C0BB 4PG9A 3GI9L 4POZC 4DUXA 3LIZA 2A4EA 2G4GA 3BHBA 1UACH 1HX0A 1BZDA 3VI3B 1VJSA 3FT0A 3ZDYE 3TIDA 5C7ZA 5D2LF 5EZLA 4LSUL 3PAZA 4E42B 3HPLB 4U6XB 4WJ5B 5AD0A 3GSWB 4RLDA 3BQUB 5MHSD 1CF8L 4R4NC 1T20A 3WNOA 2JK5A 4W70A 1LO5B 2ITCB 5H37A 4ZUUB 3ZO0A 3VXRE 3OKMA 4HWNA 5A3IC 3FC8A 3QDHA 5GGVL 5I1IL 2YSSA 1R3JA 1W6LA 3U6XS 1VCBC 1QRNA 1L6XA 1X4YA 3NABH 4A7QA 1KACB 1XHHA 2QQLL 1YEGL 1DE4B 4GAFB 2WBKA 2ADFL 2EVIA 5JHMA 2JKWA 2ICEA 2Z35B 3Q48A 1U0QA 1TVBB 1F3DH 4APQA 1AE6L 1JVOA 5FFGA 3T3PB 4F2MA 5GXBB 3GMOA 4F9PC 1JPSH 1R33A 5D7JB 1Z9SB 3QQ4A 4EO5A 4N68A 3MJ8B 5FFOA 2A74B 5JYLA 4EN3A 5D1QC 2YD9A 2VDNB 1JZ6A 1YJDH 3BIAX 1P7QB 1V27A 4WV1C 2FWLB 2WINA 1P1ZB 5FHBL 3FQ2A 3TWCH 5IEKA 1LEGA 4XE5B 2ATKA 3FO2B 3FNKA 4G2AA 1NCWH 1CXFA 2MCMA 2DZEA 3CFCL 4WNQB 2B16A 4FERA 2ZNWA 4UOW0 3TH4T 2WP3O 2NYZA 3QDJD 1NFIB 2R9HD 2F53D 4OFYD 4Y4HC 1XGPB 5DD6B 4BRVA 1M4KA 2OMWA 3QFDB 4MAZA 4ISVB 3D2UD 4TYUA 4P5TB 4NQEA 3RFZB 2AEWA 4U0RB 1A4KB 4JZOB 4QRPE 4BINA 5F88B 2WOBA 5ESQA 4QHPA 3FTSA 4DK3A 5B1JA 3QCUL 1Q9OA 4LPTA 4XCYA 4ILDA 1RLBA 1MFAH 4LAQH 1WCBA 5KBMA 1DL7H 1JK8A 2J1XA 3X3GL 1ETJA 3QR2A 1DR9A 5IOPB 4PTTA 5J7CC 3ZKND 2AJSL 4UT7H 1FNFA 3DX2A 1PF3A 1A2YB 4J23A 5BZWA 1X6LA 3VA2C 4NJAL 4XGZA 4C56D 1CCZA 3NCBB 4U49A 5HYEA 3OQRA 2QDVA 3CVIH 5CXPA 4NIKB 2O5YL 1WAAE 4AQAA 4D0BB 2VDKL 1SEBA 3KH4A 3QS2A 1BEXA 1B3JA 4RGND 4YXLH 1MQKH 1ZXQA 2D3LA 3ZR6A 2QQNH 1ZV5A 4P57B 5JO5A 1A66A 1M71A 4M3KB 3LKRB 5IUSA 5FX3A 3AREA 5BV7C 3ZL1A 4G8GE 4EXKA 2H41A 4E5XB 1GMEA 2X70B 3ZDXE 4X9IA 5DZVA 3APFA 3WKPA 1MNUH 5JR1L 2DLEA 4O2CB 5CCGE 4YK4C 2Y36H 1A1MA 3KM1A 3UYPA 5MI0B 3VH8A 2BSEA 2XCMC 1AG6A 1DAVA 4HUUA 5JHDD 4Q6IA 4HOXA 3E6HA 4YSTA 4E68A 3EYVB 1WEJH 4S1SH 2FO1A 4J3OH 5DHVA 2NX5D 4XNUL 4XPGH 3LN4B 4MA1B 4KQ0A 2VXQL 1F11A 5EN2B 1PIFA 1HSAA 3S2CA 4HS6A 4KX7A 4DOHB 4DZBA 4YXKH 5IHZA 2VERN 1T1XA 3MUHL 3ILPB 1E4XI 4J6RH 1LEKB 5IBLC 3WJJC 1R75A 1T2QL 1RMFL 1QLFA 2LU3A 2EDDA 3K8LA 1N59A 3SGEH 3RDTB 3TFBA 5D6DC 1KZQA 2CIKB 3SDCD 4Y4FB 2V9TA 2AJXH 3D39B 3KPTA 3OAUH 1D9KA 1T0NB 3QUMA 5IVZA 3WKNA 4CSSA 3ZDZF 4FHBD 2VDLB 2KZBA 1HVXA 2NNXA 1WBXA 1ZLVH 1PNCA 2E27L 2CE6A 3ARGD 1H3TA 1FH5L 5IROA 3NEXA 5LO7A 2P7TA 4Y4KA 4XO5A 4I3SL 4P46D 4N5ED 4OGYH 4PQXA 1CDCA 2EUZA 2A9NH 2WVUA 4FMFA 4KKLC 2YGVA 3D33A 4TLSA 1GR7A 4AMKH 4MJIB 5H37G 3ET9F 3UAFA 1F1DA 3IRPX 2F68X 4S1DC 5TDOA 4B9GA 4OLYH 3GSNA 2JNKA 3NFPB 4NM4L 1EAJA 3CLFL 2FEEL 3GRGA 3QC6X 2OS7A 5C0JA 3PWUB 3RZCA 1Q9KB 3CQFA 4PJDE 4WFHE 5J89A 1L0QA 1TU2B 2FWUA 4ZUTA 4X7TB 3HMXL 1UD6A 1BXVA 1BZ7B 1ACYL 1PMYA 2AERT 1T04B 2J5LB 4G1MA 4PJHA 3SY0B 3H7BB 3MRFA 3F62A 3L1OL 4I9WD 3P4OB 5FCUL 2VDKB 2JF1A 2O5XL 5FCSH 3L8QA 4IJ3C 3SE9L 4WTZA 3O6FD 4IRSA 3FQUA 6PAZA 3QEQB 1EAPA 4Y5VA 5E6ID 4HIEB 3CCHB 1RIHH 2VABB 3QQDA 3HS0B 1H8NA 2WV3A 3ZUNC 5AAPA 5K69A 4P07A 2VOTA 4AQ8C 1QOKA 3WO3B 4KTDH 4MAYB 4EBQH 1Q94B 4UUJA 3K1KC 3WFHB 2OLDA 3E2HB 2GPZA 3HPJB 1QATA 4X4YA 1QRND 3OPZL 3V0DA 4XZ4A 2Z92B 2XFXB 4O02A 4L4TA 4JDTL 3MRDA 5BQ7A 2ZOUA 5CEXA 1A4BA 3HAEB 4JAMA 4ZSOB 2EINB 3VX1A 4HH8A 2IAMA 4MFHA 4W6XB 2CK0L 5IBUB 3C8HA 2J6WA 1USZA 5E08H 4NRXA 1BVLB 2QKSA 2A5UA 2DKMA 2B1HL 3BDYH 4OGXL 2YSTA 3UTQA 4C4UA 4F7CA 2PR4H 4IRZA 1CFSA 3CDCA 3NCMA 4YZFF 2XWBB 4R7DA 3SGDH 3VO0A 3PAUA 2EP6A 4HUKB 1OAZL 4OZHE 4HBCH 2J8OA 4H1LG 1T89A 5DMJB 4DP7X 2G60L 3UPCA 4WW2A 3N43B 5DJAA 5C0NC 5EEVA 3C60A 3GJFK 3IS1X 4OLWH 4TUKL 3B4NA 5E94A 2NW2A 2NYKA 4U6HA 4KY1L 3HI1A 1OB1A 4AV4A 2LVEA 2G30A 5DRWA 4Z7QE 5C8JB 3CFBB 2XTLA 2JQZA 3OAZK 5DJ2B 2LV4A 3FFDB 1BJ8A 3UTPD 3FRPB 3KVPA 5TK4A 1LO4L 5EEYA 1N4XH 4NHUA 4NQED 5HGHA 2VDML 1T83C 3QXAB 2FNBA 5E8OA 3BO8B 3FU5A 2E9WA 3P11H 3L3GB 5A7EA 3UPRA 1THCA 2K7QA 5GSVA 4HOMA 3IMBA 3ETTA 5IJDC 2G5RA 3R19A 1SYSB 2XJLA 4JFYB 4B96A 5KJ4A 2ATPA 4HAKA 4MA3A 3UZEA 1R5VA 5J9PA 4FF9A 2WYTA 1LO3H 3OLGA 5KYWB 3I6SA 2QZQA 2XY1A 4DVBA 4H20H 3RUGB 2FX8H 3VH8G 5G4OA 4MYWB 5J57B 1JTOA 3L3HB 4RAHA 4W9ZA 3I9AA 2LT9A 1CBVH 4BCYA 3DV4B 4QXVA 3DGDA 4HPOH 3F58L 2X7LB 2H1PL 3LZNA 3M46A 2VLJB 5FWQA 4Q0XH 3RIAF 2Z91B 2NY3D 1LEIA 3HG2A 4F7TB 3MQIA 2W9DL 1IGJA 1HH9B 5C0AE 2P8PB 1R24B 2YGPA 1K2DA 2CNZA 4KVCH 1MCOL 1I7TB 3ARED 1NC2A 4W4OA 4F7PB 4PJEA 3DIVA 1YYCA 4NZRH 1AGCB 4LLYB 4TNVK 3NQKA 1A6AB 4XPTH 1IAII 2CUIA 3WIFA 4UTBH 3KNBB 2YMTA 3BCDA 1K9TA 3QWNA 2H9GB 3Q6GL 3SD5A 5CN2A 5AYUH 1BVNP 4OV5A 1WFNA 1EQWA 4L4JA 1S5HA 2X9WA 1QKZH 1ML0A 2BLFA 4OGZA 3NEEA 5DZOA 1LD9A 2QADC 2WVSA 4OCNC 1KJ3H 1FVDA 2I27N 3CHXA 4IMKC 3WUWG 1Z3RA 5EUOA 5HDOA 2AABH 5CEZE 1HL4A 4WGWB 5E9DB 1FFRA 2UY7B 1BOGA 5DMKA 3SJVD 2Q0ZX 1NFIA 1T5KA 5CMAA 2H0FA 1IM3B 2IADB 5EG6C 1SYVB 12E8H 3T4AC 4ODTH 4XHJC 4Y5YA 2TRYA 4K9JA 1IO4C 5D5MB 3D0AA 2E7LA 4DT2A 1TNMA 2YAOA 2VH5H 2XWJA 3HC3L 3TO4A 5IROD 3EJRA 5FS5A 2QVKA 4WTZG 2ICWB 1P4LA 3EH3B 4OCRH 5DJZA 3II2A 3TBSA 3ZKXB 4J12A 3SGEI 4ZNEA 2AGJH 1T22A 3MXVL 3U0WH 4EDWL 3O4OB 2ZQKA 4X8XA 3C5ZA 3KS0J 4NBXB 3A4EA 3CK0L 3KYOB 2ARWA 1D5IL 3Q5TA 1IC4L 2DQDL 4WFED 1G7QA 3LKPA 1AKJA 5DHEA 3ZSTA 1UUSA 2F54D 3QFJB 1S9VB 3MYZA 1CYGA 3RZCD 3SZKC 4G7YL 1BQKA 1GGBH 1EEZB 5IW6A 1E40A 3I3BA 1ZGLM 2BP8A 4MYPA 4HJGA 2X6BA 4KDTC 4P57A 1ZHKA 5IB3A 1YNTF 3KPMA 1AZNA 1ZHLB 2V2TA 3VXUB 2ODHA 2Y72A 2C26A 5EZJB 1AFVH 1HCFX 1UA6L 1TCRB 3R8QA 3OHXB 4OZGA 5T8IA 2OK0L 3QR0A 1N68A 4RISL 3W2DL 4PHZA 1YEDA 4WFFE 4OTXH 2XXFA 4QRTB 4IBWA 1DVFA 1S78D 1EBAA 2P5WE 4KVNH 2AXFA 4ENED 2XYCA 3VXTB 3DURB 1P0SE 3DJ9A 1CE6A 2ENJA 3OF6A 3UDWC 2PYED 4LQ1A 5J11B 1NANH 5J6GA 1IGYA 5HVWA 1N8ZA 3IVKA 1S7RA 5HYJA 4L4TD 1BQLH 4NGHL 4MMXB 1JGDB 1U3YA 3RL2A 1FYTE 1MHPH 3JWDL 1LYQA 3RWDB 4NBZB 2IAMD 3PG2A 2VM3A 5KZCD 3UZVA 2I85A 3QJZA 4FTVE 1H3PL 1JZIA 3PQYB 3SKOA 3ETSA 4YSQA 1IEBA 1N67A 1N6QL 3D39A 6PCYA 3IJYB 4HKZA 4BJLA 1OAJA 3NA9L 2J25A 4DERA 1C16B 3H6JA