2OZNB

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
b'DKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINLAKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDEYEISFINHRILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords O-GlcNAcase nagJ
publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Toxin
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00404 Dockerin_1 Dockerin type I domain
B PF07554 FIVAR FIVAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 2oznB02
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oznB01
4AZBA 4WI0B 2YL5A 4UYPB 4AZGA 2YLLA 4DH2B 1OHZB 5LXVB 2VN6B 2YL9A 2OO2A 4FZPA 2PMRA 4U3SB 2JNKA 4AZCB 5G5DB 4WKZA 2YLAA 2B59B 1DAVA 2VN5B 4IU3B 4AZ7A 4AZCA 2YL6A 2YL8A 2CCLB 4AZIA 2MTEA 3KCPA 4FZOA 1DAQA 4AZ6A 4AZ5A 4AZHA 2Y3NB 3UL4B 4FL4A 4UYQB 3RPMA 2OZNB 4IU2B 5K39B 4FL4C
chains in the Genus database with same CATH superfamily
3VEBA 3CKDA 3L3PA 2EFKA 3LVTA 4M0MA 3ER9B 4JNEA 5C5BB 4D8JA 4HYBA 1DKYA 2RAIA 1W9MA 1TQWA 4R5JA 1OA1A 4FZOA 2LM0A 4EZTA 3VKHA 4EZQA 3QNJA 3OHXM 2PY6A 4B9QA 1TQUA 1GNTA 4KIKA 4EZYA 3D4ZA 4ATMA 4UDXX 2YIVX 4JWDA 1DAVA 3DYTA 3QNIA 3EJRA 4F01A 1OA0A 3BUQA 2OBMA 4R5IA 4PO2A 2F1BA 4HR1A 3I01A 3O3MB 5E84A 3DX2A 3BVUA 2QXLA 1SU6A 1GNLA 2F7QA 2OBLA 2O0I1 4IU3B 3A98A 4JLCA 1PS3A 2NCZA 1MJGA 4UDYX 2EFLA 1HWWA 3T47A 1DKZA 3BUBA 2OZNB 1SU7A 1R33A 3M3WA 4EZVA 2V0OA 4KIKB 3SOGA 4H6IA 2ND0A 4FZPA 2X5CA 3EJPA 4EZNA 2FYVA 4AZ7A 3FD9A 2Q13A 3EJSA 4HR1B 3BVVA 4IM2A 4I1QA 1O7DC 3D2FA 3HAHA 4IWPA 3VEAA 3T4AG 2PMRA 1E9VA 4R5GA 4FM3A 1R34A 3OWGA 2CCLB 4NQIA 3ZEDA 1R5EA 2YLLA 1SU8A 3DPOA 3DX0A 3D51A 1HTYA 1SUFA 2YI8A 3C7NA 5FLEX 3EJUA 1I4DA 4EZOA 3UL4B 4FL4A 4UYQB 1X04A 4IU2B 3T46A 1X03A 4FZSA 1HXKA 2OW7A 3RV0A 4R5KA 2VN6B 2JNKA 2F7RA 3DPPA 4JL9A 2GAFD 1O7DB 2VN5B 3GI7A 1E1DA 1Y2OA 3DPQA 3I39X 3CVRA 3UITA 2C08A 2Z0NA 2F7OA 3BUDA 2EX3B 5LXVB 4IW0A 2F7PA 2OO2A 1E2UA 3O3OB 3Q84A 4U3SB 2Z8YA 3QE6A 3B53X 1I4TA 4EZSA 3BUPA 3I04A 3CV5A 3B52X 3PLTA 2JNSA 3HAJA 4JWCA 3LLLA 2ND1A 2MI7A 4EZUA 2D1LA 2QKWA 5G5DB 3LMFA 3ACOA 2D4CA 4H6HA 4AZHA 2Y3NB 3RPMA 2RAKA 3B51X 3L3OM 2YIAA 2ELBA 2YKTA 3CZNA 4BNEA 2EWFA 4IWOA 5FIGA 3DX3A 3D50A 4F00A 3EJTA 1URUA 3QA8A 4G6QA 2YL6A 2YL8A 3ABHA 3QWEA 5KBPA 1ZWWA 5TKYA 1TQVA 2Z0VA 5K39B 2F18A 4WI0B 4JWIA 4UYPB 1TQSA 4AVMA 3DX4A 2WINM 2RAJA 2YL9A 1GN9A 1WDZA 1QX1A 3D2EA 3DDGA 3RV1A 3KCPA 3Q0KA 4AZ5A 3BVXA 3F7WA 2YL5A 4EZWA 1I4LA 1JQKA 2RT6A 4EZRA 4EZXA 1ZYLA 3DX1A 3BVTA 4AZ6A 2X3XA 3CZSA 2GF4A 4AZBA 2OW6A 3DDFA 3ERCC 2LXYA 4JNFA 1OHZB 1UPXA 2X3VA 2KHOA 4NPHA 1QWNA 1U00A 4H8SA 4E81A 4DCNC 3O3NB 1DAQA 2Z0OA 3T48A 3D4YA 1YWMA 1LQ7A 2ZXQA 4DH2B 4E3CA 4NSWA 2FICA 3ER8C 3SYVA 2YLAA 2X3WA 4IM0A 4AZCA 4JWEA 4EZZA 2F1AA 2WYHA 2GA9D 1I49A 3BVWA 2QFFA 4WPCA 2N3KA 2ALWA 4IM3A 4HY9A 2YIBA 3G9GA 3BUIA 5C5BA 3EJQA 2B59B 3KAVA 3CAZA 3T49A 3D52A 2Q12A 1DKXA 4WPEA 3KAWA 3HAIA 3I2WA 1QWUA 3OK8A 4EZPA 4AZGA 4IWQA 4JN4A 1OAOA 4R5LA 3KDRA 4AZCB 3BLBA 1TQTA 4WKZA 4AZIA 2MTEA 4AKVA 2WYIA 2YI9A 4DYLA 4FL4C
chains in the Genus database with same CATH topology
4AZBA 4WI0B 2YL5A 4UYPB 4AZGA 2YLLA 4DH2B 1OHZB 5LXVB 2VN6B 2YL9A 2OO2A 4FZPA 2PMRA 4U3SB 2JNKA 4AZCB 5G5DB 4WKZA 2YLAA 2B59B 1DAVA 2VN5B 4IU3B 4AZ7A 4AZCA 2YL6A 2YL8A 2CCLB 4AZIA 2MTEA 3KCPA 4FZOA 1DAQA 4AZ6A 4AZ5A 4AZHA 2Y3NB 3UL4B 4FL4A 4UYQB 3RPMA 2OZNB 4IU2B 5K39B 4FL4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZB A;  4WI0 B;  2YL5 A;  4UYP B;  4AZG A;  2YLL A;  4DH2 B;  1OHZ B;  5LXV B;  2VN6 B;  2YL9 A;  2OO2 A;  4FZP A;  2PMR A;  4U3S B;  2JNK A;  4AZC B;  5G5D B;  4WKZ A;  2YLA A;  2B59 B;  1DAV A;  2VN5 B;  4IU3 B;  4AZ7 A;  4AZC A;  2YL6 A;  2YL8 A;  2CCL B;  4AZI A;  2MTE A;  3KCP A;  4FZO A;  1DAQ A;  4AZ6 A;  4AZ5 A;  4AZH A;  2Y3N B;  3UL4 B;  4FL4 A;  4UYQ B;  3RPM A;  2OZN B;  4IU2 B;  5K39 B;  4FL4 C; 
#chains in the Genus database with same CATH topology
 3VEB A;  3CKD A;  3L3P A;  2EFK A;  3LVT A;  4M0M A;  3ER9 B;  4JNE A;  5C5B B;  4D8J A;  4HYB A;  1DKY A;  2RAI A;  1W9M A;  1TQW A;  4R5J A;  1OA1 A;  4FZO A;  2LM0 A;  4EZT A;  3VKH A;  4EZQ A;  3QNJ A;  3OHX M;  2PY6 A;  4B9Q A;  1TQU A;  1GNT A;  4KIK A;  4EZY A;  3D4Z A;  4ATM A;  4UDX X;  2YIV X;  4JWD A;  1DAV A;  3DYT A;  3QNI A;  3EJR A;  4F01 A;  1OA0 A;  3BUQ A;  2OBM A;  4R5I A;  4PO2 A;  2F1B A;  4HR1 A;  3I01 A;  3O3M B;  5E84 A;  3DX2 A;  3BVU A;  2QXL A;  1SU6 A;  1GNL A;  2F7Q A;  2OBL A;  2O0I 1;  4IU3 B;  3A98 A;  4JLC A;  1PS3 A;  2NCZ A;  1MJG A;  4UDY X;  2EFL A;  1HWW A;  3T47 A;  1DKZ A;  3BUB A;  2OZN B;  1SU7 A;  1R33 A;  3M3W A;  4EZV A;  2V0O A;  4KIK B;  3SOG A;  4H6I A;  2ND0 A;  4FZP A;  2X5C A;  3EJP A;  4EZN A;  2FYV A;  4AZ7 A;  3FD9 A;  2Q13 A;  3EJS A;  4HR1 B;  3BVV A;  4IM2 A;  4I1Q A;  1O7D C;  3D2F A;  3HAH A;  4IWP A;  3VEA A;  3T4A G;  2PMR A;  1E9V A;  4R5G A;  4FM3 A;  1R34 A;  3OWG A;  2CCL B;  4NQI A;  3ZED A;  1R5E A;  2YLL A;  1SU8 A;  3DPO A;  3DX0 A;  3D51 A;  1HTY A;  1SUF A;  2YI8 A;  3C7N A;  5FLE X;  3EJU A;  1I4D A;  4EZO A;  3UL4 B;  4FL4 A;  4UYQ B;  1X04 A;  4IU2 B;  3T46 A;  1X03 A;  4FZS A;  1HXK A;  2OW7 A;  3RV0 A;  4R5K A;  2VN6 B;  2JNK A;  2F7R A;  3DPP A;  4JL9 A;  2GAF D;  1O7D B;  2VN5 B;  3GI7 A;  1E1D A;  1Y2O A;  3DPQ A;  3I39 X;  3CVR A;  3UIT A;  2C08 A;  2Z0N A;  2F7O A;  3BUD A;  2EX3 B;  5LXV B;  4IW0 A;  2F7P A;  2OO2 A;  1E2U A;  3O3O B;  3Q84 A;  4U3S B;  2Z8Y A;  3QE6 A;  3B53 X;  1I4T A;  4EZS A;  3BUP A;  3I04 A;  3CV5 A;  3B52 X;  3PLT A;  2JNS A;  3HAJ A;  4JWC A;  3LLL A;  2ND1 A;  2MI7 A;  4EZU A;  2D1L A;  2QKW A;  5G5D B;  3LMF A;  3ACO A;  2D4C A;  4H6H A;  4AZH A;  2Y3N B;  3RPM A;  2RAK A;  3B51 X;  3L3O M;  2YIA A;  2ELB A;  2YKT A;  3CZN A;  4BNE A;  2EWF A;  4IWO A;  5FIG A;  3DX3 A;  3D50 A;  4F00 A;  3EJT A;  1URU A;  3QA8 A;  4G6Q A;  2YL6 A;  2YL8 A;  3ABH A;  3QWE A;  5KBP A;  1ZWW A;  5TKY A;  1TQV A;  2Z0V A;  5K39 B;  2F18 A;  4WI0 B;  4JWI A;  4UYP B;  1TQS A;  4AVM A;  3DX4 A;  2WIN M;  2RAJ A;  2YL9 A;  1GN9 A;  1WDZ A;  1QX1 A;  3D2E A;  3DDG A;  3RV1 A;  3KCP A;  3Q0K A;  4AZ5 A;  3BVX A;  3F7W A;  2YL5 A;  4EZW A;  1I4L A;  1JQK A;  2RT6 A;  4EZR A;  4EZX A;  1ZYL A;  3DX1 A;  3BVT A;  4AZ6 A;  2X3X A;  3CZS A;  2GF4 A;  4AZB A;  2OW6 A;  3DDF A;  3ERC C;  2LXY A;  4JNF A;  1OHZ B;  1UPX A;  2X3V A;  2KHO A;  4NPH A;  1QWN A;  1U00 A;  4H8S A;  4E81 A;  4DCN C;  3O3N B;  1DAQ A;  2Z0O A;  3T48 A;  3D4Y A;  1YWM A;  1LQ7 A;  2ZXQ A;  4DH2 B;  4E3C A;  4NSW A;  2FIC A;  3ER8 C;  3SYV A;  2YLA A;  2X3W A;  4IM0 A;  4AZC A;  4JWE A;  4EZZ A;  2F1A A;  2WYH A;  2GA9 D;  1I49 A;  3BVW A;  2QFF A;  4WPC A;  2N3K A;  2ALW A;  4IM3 A;  4HY9 A;  2YIB A;  3G9G A;  3BUI A;  5C5B A;  3EJQ A;  2B59 B;  3KAV A;  3CAZ A;  3T49 A;  3D52 A;  2Q12 A;  1DKX A;  4WPE A;  3KAW A;  3HAI A;  3I2W A;  1QWU A;  3OK8 A;  4EZP A;  4AZG A;  4IWQ A;  4JN4 A;  1OAO A;  4R5L A;  3KDR A;  4AZC B;  3BLB A;  1TQT A;  4WKZ A;  4AZI A;  2MTE A;  4AKV A;  2WYI A;  2YI9 A;  4DYL A;  4FL4 C; 
#chains in the Genus database with same CATH homology
 4AZB A;  4WI0 B;  2YL5 A;  4UYP B;  4AZG A;  2YLL A;  4DH2 B;  1OHZ B;  5LXV B;  2VN6 B;  2YL9 A;  2OO2 A;  4FZP A;  2PMR A;  4U3S B;  2JNK A;  4AZC B;  5G5D B;  4WKZ A;  2YLA A;  2B59 B;  1DAV A;  2VN5 B;  4IU3 B;  4AZ7 A;  4AZC A;  2YL6 A;  2YL8 A;  2CCL B;  4AZI A;  2MTE A;  3KCP A;  4FZO A;  1DAQ A;  4AZ6 A;  4AZ5 A;  4AZH A;  2Y3N B;  3UL4 B;  4FL4 A;  4UYQ B;  3RPM A;  2OZN B;  4IU2 B;  5K39 B;  4FL4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...