2OZNB

The cohesin-dockerin complex of nagj and nagh from clostridium perfringens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
131
structure length
131
Chain Sequence
DKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEEEINLAKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDEYEISFINHRILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords O-GlcNAcase nagJ
publication title Structural basis of Clostridium perfringens toxin complex formation.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 51
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00404 Dockerin_1 Dockerin type I domain
B PF07554 FIVAR FIVAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1330.10 Mainly Alpha Orthogonal Bundle Type 1 dockerin domain Dockerin domain 2oznB02
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oznB01
5G5DB 4AZ6A 4AZHA 4U3SB 2MTEA 2CCLB 4WKZA 5K39B 4AZGA 4UYQB 4FL4C 1DAQA 2YL9A 2YLLA 2JNKA 4AZIA 2YLAA 4FZOA 2VN6B 2YL6A 4FZPA 2VN5B 4AZCB 2Y3NB 2YL5A 4AZCA 4DH2B 4AZBA 1OHZB 4AZ5A 4IU3B 3RPMA 5LXVB 2OO2A 4AZ7A 3KCPA 3UL4B 4UYPB 4FL4A 2OZNB 2PMRA 1DAVA 2B59B 2YL8A 4IU2B 4WI0B
chains in the Genus database with same CATH superfamily
1I4LA 2JNSA 4JL9A 2YLLA 3ER8C 3T4AG 3DX0A 3DDFA 4DCNC 4M0MA 1Y2OA 3VEBA 4EZZA 4DH2B 2F18A 3BVXA 1SU6A 3QA8A 4HR1B 2EX3B 1TQTA 3B53X 3DPPA 2GA9D 1E1DA 1U00A 4IW0A 3BUIA 2VN6B 2LXYA 3OWGA 4H6HA 4AZBA 3BVVA 4AZ7A 2LM0A 3QNJA 1SUFA 4WI0B 4NSWA 2MI7A 3DX2A 3DX4A 5KBPA 4R5GA 1DAQA 3EJSA 3D52A 3KAVA 4JNEA 3HAIA 3QNIA 2Q12A 3RPMA 4FL4A 2OZNB 2ND0A 5E84A 3I2WA 4IM0A 1JQKA 2FYVA 3OHXM 4U3SB 2NCZA 1HWWA 4IWOA 1GNTA 1W9MA 3T49A 2VN5B 4EZRA 3VEAA 3PLTA 4EZQA 4UDYX 4HR1A 1SU7A 2D1LA 3T48A 3BUBA 2KHOA 2PY6A 3RV0A 1HTYA 4G6QA 4IWQA 2F7QA 3KAWA 4AZCB 1WDZA 1R34A 2ND1A 2Z0VA 4EZOA 2F1BA 2YL8A 4JWEA 3GI7A 4R5JA 2WYIA 1TQWA 4BNEA 4EZXA 4AZIA 1DKXA 3B51X 2YI9A 2YIVX 1I49A 1OHZB 1DKYA 4EZWA 3DX3A 4AKVA 2F7PA 4HYBA 1QX1A 3BLBA 3CKDA 2Q13A 4D8JA 1OA1A 3I39X 3Q84A 2ALWA 5FLEX 4IM3A 4JN4A 2RT6A 4KIKB 2EFKA 1X04A 1GNLA 4E3CA 4E81A 3ERCC 4EZSA 1ZYLA 3BUPA 1LQ7A 2QXLA 4EZPA 1E9VA 2RAKA 1OA0A 4AZ5A 4JWCA 1TQSA 3QE6A 1HXKA 3BUDA 1DAVA 2B59B 3G9GA 3ZEDA 5C5BA 2MTEA 4WKZA 1R33A 4EZTA 2X3XA 4AZGA 3FD9A 2YIBA 3BUQA 2YLAA 2F7RA 3C7NA 1YWMA 3RV1A 2ELBA 3QWEA 3D4ZA 2O0I1 1O7DC 3Q0KA 3O3NB 4F00A 3DDGA 4HY9A 1I4TA 4H8SA 4I1QA 5FIGA 3B52X 3D51A 2V0OA 3EJRA 3DPQA 3VKHA 3L3OM 3ACOA 3LVTA 3I04A 2X5CA 2WYHA 4KIKA 3HAHA 3OK8A 2Z0OA 1UPXA 3A98A 1TQVA 1URUA 2X3WA 3CVRA 4FZOA 4FZSA 2YL6A 4B9QA 2GF4A 2Y3NB 3F7WA 4R5IA 2OBMA 2OW7A 1R5EA 2QKWA 2QFFA 1E2UA 4F01A 2YIAA 4R5KA 5K39B 4NQIA 2FICA 3D2FA 2YL9A 2JNKA 3DX1A 4FZPA 3I01A 3HAJA 4IU3B 4R5LA 2OO2A 3UL4B 2PMRA 4FM3A 4NPHA 4IWPA 1TQUA 4AZ6A 3CZNA 2X3VA 2YKTA 4FL4C 3EJUA 4EZYA 2YI8A 1ZWWA 4ATMA 1O7DB 3DYTA 1MJGA 1I4DA 2RAIA 2Z8YA 4AZCA 4JNFA 4EZVA 3KCPA 4DYLA 2Z0NA 3D2EA 4WPEA 3O3OB 4IU2B 4AZHA 4JWDA 3BVUA 4WPCA 4AVMA 2RAJA 3ABHA 2F7OA 1PS3A 3SOGA 4IM2A 4EZNA 2YL5A 3KDRA 1X03A 3BVTA 3EJTA 2D4CA 3DPOA 3CV5A 3D4YA 2F1AA 4UYPB 1DKZA 1SU8A 2C08A 4H6IA 1GN9A 3O3MB 3SYVA 2ZXQA 2EWFA 4UDXX 5TKYA 2WINM 3EJQA 1OAOA 1QWNA 2OBLA 3T46A 3UITA 3BVWA 5G5DB 2N3KA 3T47A 2CCLB 4UYQB 3LMFA 4JLCA 4PO2A 3CAZA 2GAFD 3M3WA 3L3PA 3ER9B 4EZUA 2EFLA 3LLLA 3EJPA 4JWIA 2OW6A 5LXVB 3CZSA 1QWUA 3D50A 5C5BB
chains in the Genus database with same CATH topology
5G5DB 4AZ6A 4AZHA 4U3SB 2MTEA 2CCLB 4WKZA 5K39B 4AZGA 4UYQB 4FL4C 1DAQA 2YL9A 2YLLA 2JNKA 4AZIA 2YLAA 4FZOA 2VN6B 2YL6A 4FZPA 2VN5B 4AZCB 2Y3NB 2YL5A 4AZCA 4DH2B 4AZBA 1OHZB 4AZ5A 4IU3B 3RPMA 5LXVB 2OO2A 4AZ7A 3KCPA 3UL4B 4UYPB 4FL4A 2OZNB 2PMRA 1DAVA 2B59B 2YL8A 4IU2B 4WI0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5D B;  4AZ6 A;  4AZH A;  4U3S B;  2MTE A;  2CCL B;  4WKZ A;  5K39 B;  4AZG A;  4UYQ B;  4FL4 C;  1DAQ A;  2YL9 A;  2YLL A;  2JNK A;  4AZI A;  2YLA A;  4FZO A;  2VN6 B;  2YL6 A;  4FZP A;  2VN5 B;  4AZC B;  2Y3N B;  2YL5 A;  4AZC A;  4DH2 B;  4AZB A;  1OHZ B;  4AZ5 A;  4IU3 B;  3RPM A;  5LXV B;  2OO2 A;  4AZ7 A;  3KCP A;  3UL4 B;  4UYP B;  4FL4 A;  2OZN B;  2PMR A;  1DAV A;  2B59 B;  2YL8 A;  4IU2 B;  4WI0 B; 
#chains in the Genus database with same CATH topology
 1I4L A;  2JNS A;  4JL9 A;  2YLL A;  3ER8 C;  3T4A G;  3DX0 A;  3DDF A;  4DCN C;  4M0M A;  1Y2O A;  3VEB A;  4EZZ A;  4DH2 B;  2F18 A;  3BVX A;  1SU6 A;  3QA8 A;  4HR1 B;  2EX3 B;  1TQT A;  3B53 X;  3DPP A;  2GA9 D;  1E1D A;  1U00 A;  4IW0 A;  3BUI A;  2VN6 B;  2LXY A;  3OWG A;  4H6H A;  4AZB A;  3BVV A;  4AZ7 A;  2LM0 A;  3QNJ A;  1SUF A;  4WI0 B;  4NSW A;  2MI7 A;  3DX2 A;  3DX4 A;  5KBP A;  4R5G A;  1DAQ A;  3EJS A;  3D52 A;  3KAV A;  4JNE A;  3HAI A;  3QNI A;  2Q12 A;  3RPM A;  4FL4 A;  2OZN B;  2ND0 A;  5E84 A;  3I2W A;  4IM0 A;  1JQK A;  2FYV A;  3OHX M;  4U3S B;  2NCZ A;  1HWW A;  4IWO A;  1GNT A;  1W9M A;  3T49 A;  2VN5 B;  4EZR A;  3VEA A;  3PLT A;  4EZQ A;  4UDY X;  4HR1 A;  1SU7 A;  2D1L A;  3T48 A;  3BUB A;  2KHO A;  2PY6 A;  3RV0 A;  1HTY A;  4G6Q A;  4IWQ A;  2F7Q A;  3KAW A;  4AZC B;  1WDZ A;  1R34 A;  2ND1 A;  2Z0V A;  4EZO A;  2F1B A;  2YL8 A;  4JWE A;  3GI7 A;  4R5J A;  2WYI A;  1TQW A;  4BNE A;  4EZX A;  4AZI A;  1DKX A;  3B51 X;  2YI9 A;  2YIV X;  1I49 A;  1OHZ B;  1DKY A;  4EZW A;  3DX3 A;  4AKV A;  2F7P A;  4HYB A;  1QX1 A;  3BLB A;  3CKD A;  2Q13 A;  4D8J A;  1OA1 A;  3I39 X;  3Q84 A;  2ALW A;  5FLE X;  4IM3 A;  4JN4 A;  2RT6 A;  4KIK B;  2EFK A;  1X04 A;  1GNL A;  4E3C A;  4E81 A;  3ERC C;  4EZS A;  1ZYL A;  3BUP A;  1LQ7 A;  2QXL A;  4EZP A;  1E9V A;  2RAK A;  1OA0 A;  4AZ5 A;  4JWC A;  1TQS A;  3QE6 A;  1HXK A;  3BUD A;  1DAV A;  2B59 B;  3G9G A;  3ZED A;  5C5B A;  2MTE A;  4WKZ A;  1R33 A;  4EZT A;  2X3X A;  4AZG A;  3FD9 A;  2YIB A;  3BUQ A;  2YLA A;  2F7R A;  3C7N A;  1YWM A;  3RV1 A;  2ELB A;  3QWE A;  3D4Z A;  2O0I 1;  1O7D C;  3Q0K A;  3O3N B;  4F00 A;  3DDG A;  4HY9 A;  1I4T A;  4H8S A;  4I1Q A;  5FIG A;  3B52 X;  3D51 A;  2V0O A;  3EJR A;  3DPQ A;  3VKH A;  3L3O M;  3ACO A;  3LVT A;  3I04 A;  2X5C A;  2WYH A;  4KIK A;  3HAH A;  3OK8 A;  2Z0O A;  1UPX A;  3A98 A;  1TQV A;  1URU A;  2X3W A;  3CVR A;  4FZO A;  4FZS A;  2YL6 A;  4B9Q A;  2GF4 A;  2Y3N B;  3F7W A;  4R5I A;  2OBM A;  2OW7 A;  1R5E A;  2QKW A;  2QFF A;  1E2U A;  4F01 A;  2YIA A;  4R5K A;  5K39 B;  4NQI A;  2FIC A;  3D2F A;  2YL9 A;  2JNK A;  3DX1 A;  4FZP A;  3I01 A;  3HAJ A;  4IU3 B;  4R5L A;  2OO2 A;  3UL4 B;  2PMR A;  4FM3 A;  4NPH A;  4IWP A;  1TQU A;  4AZ6 A;  3CZN A;  2X3V A;  2YKT A;  4FL4 C;  3EJU A;  4EZY A;  2YI8 A;  1ZWW A;  4ATM A;  1O7D B;  3DYT A;  1MJG A;  1I4D A;  2RAI A;  2Z8Y A;  4AZC A;  4JNF A;  4EZV A;  3KCP A;  4DYL A;  2Z0N A;  3D2E A;  4WPE A;  3O3O B;  4IU2 B;  4AZH A;  4JWD A;  3BVU A;  4WPC A;  4AVM A;  2RAJ A;  3ABH A;  2F7O A;  1PS3 A;  3SOG A;  4IM2 A;  4EZN A;  2YL5 A;  3KDR A;  1X03 A;  3BVT A;  3EJT A;  2D4C A;  3DPO A;  3CV5 A;  3D4Y A;  2F1A A;  4UYP B;  1DKZ A;  1SU8 A;  2C08 A;  4H6I A;  1GN9 A;  3O3M B;  3SYV A;  2ZXQ A;  2EWF A;  4UDX X;  5TKY A;  2WIN M;  3EJQ A;  1OAO A;  1QWN A;  2OBL A;  3T46 A;  3UIT A;  3BVW A;  5G5D B;  2N3K A;  3T47 A;  2CCL B;  4UYQ B;  3LMF A;  4JLC A;  4PO2 A;  3CAZ A;  2GAF D;  3M3W A;  3L3P A;  3ER9 B;  4EZU A;  2EFL A;  3LLL A;  3EJP A;  4JWI A;  2OW6 A;  5LXV B;  3CZS A;  1QWU A;  3D50 A;  5C5B B; 
#chains in the Genus database with same CATH homology
 5G5D B;  4AZ6 A;  4AZH A;  4U3S B;  2MTE A;  2CCL B;  4WKZ A;  5K39 B;  4AZG A;  4UYQ B;  4FL4 C;  1DAQ A;  2YL9 A;  2YLL A;  2JNK A;  4AZI A;  2YLA A;  4FZO A;  2VN6 B;  2YL6 A;  4FZP A;  2VN5 B;  4AZC B;  2Y3N B;  2YL5 A;  4AZC A;  4DH2 B;  4AZB A;  1OHZ B;  4AZ5 A;  4IU3 B;  3RPM A;  5LXV B;  2OO2 A;  4AZ7 A;  3KCP A;  3UL4 B;  4UYP B;  4FL4 A;  2OZN B;  2PMR A;  1DAV A;  2B59 B;  2YL8 A;  4IU2 B;  4WI0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...