1H4IA

Methylobacterium extorquens methanol dehydrogenase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
595
structure length
595
Chain Sequence
NDKLVELSKSDDNWVMPGKNYDSNNFSDLKQINKGNVKQLRPAWTFSTGLLNGHEGAPLVVDGKMYIHTSFPNNTFALGLDDPGTILWQDKPKQNPAARAVACCDLVNRGLAYWPGDGKTPALILKTQLDGNVAALNAETGETVWKVENSDIKVGSTLTIAPYVVKDKVIIGSSGAELGVRGYLTAYDVKTGEQVWRAYATGPDKDLLLASDFNIKNPHYGQKGLGTGTWEGDAWKIGGGTNWGWYAYDPGTNLIYFGTGNPAPWNETMRPGDNKWTMTIFGRDADTGEAKFGYQKTPHDEWDYAGVNVMMLSEQKDKDGKARKLLTHPDRNGIVYTLDRTDGALVSANKLDDTVNVFKSVDLKTGQPVRDPEYGTRMDHLAKDICPSAMGYHNQGHDSYDPKRELFFMGINHICMDWEPFMLPYRAGQFFVGATLNMYPGPKGDRQNYEGLGQIKAYNAITGDYKWEKMERFAVWGGTMATAGDLVFYGTLDGYLKARDSDTGDLLWKFKIPSGAIGYPMTYTHKGTQYVAIYYGVGGWPGVGLVFDLADPTAGLGAVGAFKKLANYTQMGGGVVVFSLDGKGPYDDPNVGEWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Refined Structure of the Quinoprotein Methanol Dehydrogenase from Methylobacterium Extorquens at 1.94 A.
pubmed doi rcsb
molecule tags Dehydrogenase
molecule keywords METHANOL DEHYDROGENASE SUBUNIT 1
total genus 183
structure length 595
sequence length 595
chains with identical sequence C
ec nomenclature ec 1.1.2.7: Methanol dehydrogenase (cytochrome c).
pdb deposition date 2001-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01011 PQQ PQQ enzyme repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.140.10.10 Mainly Beta 8 Propeller Methanol Dehydrogenase; Chain A Quinoprotein alcohol dehydrogenase-like superfamily 1h4iA00
1W6SA 4MAEA 4CVCA 4TQOA 2AD7A 4AAHA 2D0VA 1H4JA 1KV9A 1LRWA 1YIQA 2AD6A 1H4IA 4CVBA 1FLGA 1KB0A 1G72A 2AD8A 4MH1A
chains in the Genus database with same CATH superfamily
3VJMA 4FFWA 3C45A 1N50A 4N8DA 5J3JA 3SWWA 2OGZA 1NNOA 1LRWA 2ECFA 1H4IA 2GBFA 3D4LA 3G0GA 3EIOA 3HACA 1BL9A 2QOEA 4AAHA 2D0VA 5LLSA 1X70A 1R9MA 4MH1A 2QT9A 1AOQA 1H9YA 4N8EA 3KWJA 3QBJA 4DSAA 3OPMA 1NU8A 1GJQA 3CCCA 1H4JA 2I3ZA 3VJLA 1NU6A 4J3JA 2AJLI 1YIQA 3O95A 5T4BA 2OPHA 1U8EA 1W6SA 2RIPA 3NOXA 1TKRA 3H0CA 2GBCA 5T4FA 2OQIA 1HJ4A 4FFVA 3VJKA 1J2EA 2FJPA 2P8SA 1HCMA 3BJMA 1ORVA 3SX4A 2AD7A 2HHAA 4KR0A 2OAGA 3KWFA 4TQOA 1N1MA 5T4EA 3WQHA 4WJLA 1HZVA 2RGUA 1NIRA 4MAEA 3O9VA 1DY7A 2G63A 1HJ5A 2G5PA 2Z3WA 2IIVA 4DTCA 1HJ3A 4DSZA 4QZVA 3Q8WA 3G0BA 3OC0A 1FLGA 1R9NA 2AJCA 2I03A 1HZUA 2OQVA 2BGRA 1N90A 1AOMA 2QKYA 2D5LA 1TK3A 2JIDA 4A5SA 3W2TA 2ONCA 3F8SA 2GBIA 2EEPA 2OLEA 1KB0A 2QJRA 4JH0A 3CCBA 3Q0TA 2I78A 3G0DA 1E2RA 1Z68A 1G72A 2QTBA 2IITA 4LKOA 2AJ8A 1ORWA 1H9XA 4L72A 1GQ1A 2AD6A 1XFDA 2DCMA 2BGNA 1W1IA 1WCYA 4G1FA 1QKSA 4CVBA 2OAEA 4PV7A 3G0CA 5T4HA 2GBGA 4PNZA 3C43A 1N15A 1AOFA 2BUBA 1KV9A 3HABA 5ISMA 5I7UA 2AJDA 4Q1VA 5KBYA 2BUCA 2BUAA 2AJBA 2Z3ZA 2G5TA 1RWQA 2AD8A 1PFQA 4CVCA
chains in the Genus database with same CATH topology
1W6SA 4MAEA 4CVCA 4TQOA 2AD7A 4AAHA 2D0VA 1H4JA 1KV9A 1LRWA 1YIQA 2AD6A 1H4IA 4CVBA 1FLGA 1KB0A 1G72A 2AD8A 4MH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6S A;  4MAE A;  4CVC A;  4TQO A;  2AD7 A;  4AAH A;  2D0V A;  1H4J A;  1KV9 A;  1LRW A;  1YIQ A;  2AD6 A;  1H4I A;  4CVB A;  1FLG A;  1KB0 A;  1G72 A;  2AD8 A;  4MH1 A; 
#chains in the Genus database with same CATH topology
 3VJM A;  4FFW A;  3C45 A;  1N50 A;  4N8D A;  5J3J A;  3SWW A;  2OGZ A;  1NNO A;  1LRW A;  2ECF A;  1H4I A;  2GBF A;  3D4L A;  3G0G A;  3EIO A;  3HAC A;  1BL9 A;  2QOE A;  4AAH A;  2D0V A;  5LLS A;  1X70 A;  1R9M A;  4MH1 A;  2QT9 A;  1AOQ A;  1H9Y A;  4N8E A;  3KWJ A;  3QBJ A;  4DSA A;  3OPM A;  1NU8 A;  1GJQ A;  3CCC A;  1H4J A;  2I3Z A;  3VJL A;  1NU6 A;  4J3J A;  2AJL I;  1YIQ A;  3O95 A;  5T4B A;  2OPH A;  1U8E A;  1W6S A;  2RIP A;  3NOX A;  1TKR A;  3H0C A;  2GBC A;  5T4F A;  2OQI A;  1HJ4 A;  4FFV A;  3VJK A;  1J2E A;  2FJP A;  2P8S A;  1HCM A;  3BJM A;  1ORV A;  3SX4 A;  2AD7 A;  2HHA A;  4KR0 A;  2OAG A;  3KWF A;  4TQO A;  1N1M A;  5T4E A;  3WQH A;  4WJL A;  1HZV A;  2RGU A;  1NIR A;  4MAE A;  3O9V A;  1DY7 A;  2G63 A;  1HJ5 A;  2G5P A;  2Z3W A;  2IIV A;  4DTC A;  1HJ3 A;  4DSZ A;  4QZV A;  3Q8W A;  3G0B A;  3OC0 A;  1FLG A;  1R9N A;  2AJC A;  2I03 A;  1HZU A;  2OQV A;  2BGR A;  1N90 A;  1AOM A;  2QKY A;  2D5L A;  1TK3 A;  2JID A;  4A5S A;  3W2T A;  2ONC A;  3F8S A;  2GBI A;  2EEP A;  2OLE A;  1KB0 A;  2QJR A;  4JH0 A;  3CCB A;  3Q0T A;  2I78 A;  3G0D A;  1E2R A;  1Z68 A;  1G72 A;  2QTB A;  2IIT A;  4LKO A;  2AJ8 A;  1ORW A;  1H9X A;  4L72 A;  1GQ1 A;  2AD6 A;  1XFD A;  2DCM A;  2BGN A;  1W1I A;  1WCY A;  4G1F A;  1QKS A;  4CVB A;  2OAE A;  4PV7 A;  3G0C A;  5T4H A;  2GBG A;  4PNZ A;  3C43 A;  1N15 A;  1AOF A;  2BUB A;  1KV9 A;  3HAB A;  5ISM A;  5I7U A;  2AJD A;  4Q1V A;  5KBY A;  2BUC A;  2BUA A;  2AJB A;  2Z3Z A;  2G5T A;  1RWQ A;  2AD8 A;  1PFQ A;  4CVC A; 
#chains in the Genus database with same CATH homology
 1W6S A;  4MAE A;  4CVC A;  4TQO A;  2AD7 A;  4AAH A;  2D0V A;  1H4J A;  1KV9 A;  1LRW A;  1YIQ A;  2AD6 A;  1H4I A;  4CVB A;  1FLG A;  1KB0 A;  1G72 A;  2AD8 A;  4MH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...