The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
188
|
structure length |
188
|
Chain Sequence |
MNNKEVELYGGAITTVVPPGFIDASTLREVPDTQAVYVNSRRDEEEFEDGLATNESIIVDLLETVDKSDLKEAWQFHVEDLTELNGTTKWEALQEDTVQQGTKFTGLVMEVANKWGKPDLAQTVVIGVALIRLTQFDTDVVISINVPLTKEEASQASNKELPARCHAVYQLLQEMVRKFHVVDTSLFA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Interaction between Ran and Mog1 is required for efficient nuclear protein import
pubmed doi rcsb |
| molecule tags |
Gene regulation
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
MOG1 PROTEIN
|
| total genus |
53
|
| structure length |
188
|
| sequence length |
188
|
| ec nomenclature | |
| pdb deposition date | 2001-06-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04603 | Mog1 | Ran-interacting Mog1 protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Mog1/PsbP, alpha/beta/alpha sandwich |
#chains in the Genus database with same CATH superfamily 1TU1 A; 3HLZ A; 1V2B A; 4UI2 D; 2LNJ A; 4BQ8 C; 3JCU P; 4RTH A; 2VU4 A; 2XB3 A; 1JHS A; 4BQ6 D; 3V7B A; 3LYD A; 1EQ6 A; 4RTI A; #chains in the Genus database with same CATH topology 3HLZ A; 3WA5 B; 4UI2 D; 4RTH A; 3NR5 A; 4ESQ A; 4L9C A; 2VT8 A; 2LNJ A; 4OUH A; 3JCU P; 2VU4 A; 2XB3 A; 4LUQ C; 4N88 B; 4RTI A; 4BQ6 D; 1TU1 A; 4N7S B; 1V2B A; 1VR8 A; 4BQ8 C; 3BCY A; 1JHS A; 4N80 B; 3LYD A; 1EQ6 A; 4M5F B; 3V7B A; 4L9H A; #chains in the Genus database with same CATH homology 1TU1 A; 3HLZ A; 1V2B A; 4UI2 D; 2LNJ A; 4BQ8 C; 3JCU P; 4RTH A; 2VU4 A; 2XB3 A; 1JHS A; 4BQ6 D; 3V7B A; 3LYD A; 1EQ6 A; 4RTI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
