The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
37
|
sequence length |
158
|
structure length |
158
|
Chain Sequence |
MPSIRYPSTEFPALTGFTVPIPETWQPDPTMGTQFAARPHTPPQGFTPNIIGTVRRAATGALHNQRTELDQRATQLPDYAERGRTETTVDGFPAYHIEYAYRHHGTITIAQMITLVEVSHPHAVDIIQLTATCAGDQTADYWDTFRLMHADLTVQPHG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Uncharacterized protein
|
publication title |
Crystal structure of Putative uncharacterized protein from Jonesia denitrificans
rcsb |
source organism |
Jonesia denitrificans
|
total genus |
37
|
structure length |
158
|
sequence length |
158
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10738 | Lpp-LpqN | Probable lipoprotein LpqN |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Mog1/PsbP, alpha/beta/alpha sandwich |
#chains in the Genus database with same CATH superfamily 2XB3 A; 3V7B A; 1V2B A; 1EQ6 A; 3LYD A; 1JHS A; 2VU4 A; 4BQ8 C; 4BQ6 D; 1TU1 A; 4RTI A; 4UI2 D; 3HLZ A; 4RTH A; 2LNJ A; 3JCU P; #chains in the Genus database with same CATH topology 4OUH A; 2VT8 A; 1VR8 A; 4BQ8 C; 2VU4 A; 4ESQ A; 1TU1 A; 4LUQ C; 2LNJ A; 3JCU P; 4N88 B; 4L9C A; 3V7B A; 3LYD A; 1JHS A; 4N80 B; 4RTI A; 4UI2 D; 3WA5 B; 1V2B A; 1EQ6 A; 3BCY A; 4L9H A; 4N7S B; 3NR5 A; 2XB3 A; 4BQ6 D; 4M5F B; 3HLZ A; 4RTH A; #chains in the Genus database with same CATH homology 2XB3 A; 3V7B A; 1V2B A; 1EQ6 A; 3LYD A; 1JHS A; 2VU4 A; 4BQ8 C; 4BQ6 D; 1TU1 A; 4RTI A; 4UI2 D; 3HLZ A; 4RTH A; 2LNJ A; 3JCU P;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...