The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
141
|
structure length |
141
|
Chain Sequence |
FQGHMLLGTFNITLDAKNRISLPAKLRAFFEGSIVINRGFENCLEVRKPQDFQKYFEQFNSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWDKKLYEDYLANSESLETVAERM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of a protein associated with cell division from Mycoplasma pneumoniae (GI: 13508053): a novel fold with a conserved sequence motif.
pubmed doi rcsb |
molecule tags |
Biosynthetic protein
|
source organism |
Mycoplasma pneumoniae
|
molecule keywords |
Protein mraZ
|
total genus |
28
|
structure length |
141
|
sequence length |
141
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2002-10-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02381 | MraZ | MraZ protein, putative antitoxin-like |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | At1g16640 B3 domain | At1g16640 B3 domain |
#chains in the Genus database with same CATH superfamily 1N0F A; 1N0G A; 1N0E A; #chains in the Genus database with same CATH topology 1YEL A; 2C1L A; 4LDV A; 1N0G A; 1NA6 A; 4LDY A; 4I1K A; 3HQF A; 1WID A; 3ZI5 A; 4LDU A; 1N0F A; 4LDW A; 4LDX A; 1N0E A; #chains in the Genus database with same CATH homology 1N0G A; 3ZI5 A; 1N0E A; 1N0F A; 2C1L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...