4LDXA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1 (arf1) in complex with protomor-like sequence er7
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
341
structure length
332
Chain Sequence
b'SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin response factor 1
molecule tags Transcription/dna
source organism Arabidopsis thaliana
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
total genus 75
structure length 332
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldxA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldxA02
3HQFA 1WIDA 1NA6A 4LDVA 1YELA 4LDYA 4LDWA 4I1KA 4LDUA 4LDXA
chains in the Genus database with same CATH superfamily
4X1VA 4XU2A 3MEVA 2VYTA 5GMKl 2XMFA 1VQLT 1QVFA 1M1KU 2WACA 2LNHB 2GGRA 3L2RA 1G3TA 2Y4XA 1ZA2B 1RL2A 5CAIA 3VKIA 2JM8A 4Y91A 1B34A 5GMKh 4Z89A 3OYFA 3PMIA 2MWOA 2ZPHB 3M59A 5GAMd 1K4US 3SHWA 3H0IA 3HRUA 1K0XA 3CCVQ 4LDYA 1Z9ZA 4M7AB 1D3BB 1G3WA 4RUGA 1QP2A 4WCIA 3G1JA 2RJDA 2O9VA 3EFOA 2PVGB 3OW2S 2QEXT 1LVKA 2LQKA 1XOVA 1ZHIA 4OP0A 4N4GA 4DBFA 1T3LA 1VQOQ 3DKMA 3M55A 2I2LA 3SWNC 1FX7A 2C0IA 4J6WA 1WYXA 2RMOA 4QVDA 1GXIE 1LNXA 3DLMA 4AFUC 2LCCA 3LLRA 1OULA 4L59A 2CUDA 5A0GA 4ZGEB 2E12A 1U5SA 4C8QD 2DD4A 3JB9I 3E9FA 4DQ2A 3UA7A 4HXJA 3TREA 1T3SA 3BDLA 2SEMA 1R0CB 4ZTFA 1M3BA 1X6GA 4ATOA 3OYHA 4JS4A 5CIUA 5GAMj 3M0RA 2XICA 3HFOA 2YLBA 2CSIA 3CCVA 2VGMA 5GANg 1E7OA 2HQHA 3UF4A 2JTMA 4C0ZA 3ZL7C 1UGPB 2XDPA 3E1SA 2QASA 4J9CA 5FW9A 2DERA 4J5YA 4QKUA 5AYFA 1MUZA 5GJVB 3FJ5A 4E7KA 4PLLA 1YJ9A 4JRIA 2RN8A 1VQ6Q 2X4WA 1C0MA 1ZSZA 4IUPA 3GLXA 1G3YA 1UEBA 1ZSGA 2FB7A 3JCMc 1QW1A 1IREB 1LOJA 1UGQB 4M78E 4M7DC 4FL6A 4ZN3A 5I2MA 5IH2A 2XKOC 2SRCA 4IURA 1UJ0A 1UFFA 1BI1A 2KGTA 2OAWA 4X34A 5CQXA 2LQ8A 1W70A 1H3ZA 3SFMA 1OX9A 3ULRB 3HPWA 1Q82R 3OMCA 3CCJQ 3ZFJA 2L89A 3QBYA 1WHMA 1M2OA 5GANh 4LDWA 3JB9F 2EBPA 4OMMA 4MDXA 1OYXA 5KH6A 1YHQA 3T9NA 2P84A 2EQKA 4MDWA 5J3BA 4ZN1A 1PSEA 4JJBA 1VA7A 5FRMA 3X26B 4M78F 2B86A 2LZ6B 4WF2A 3CC2T 4EMHA 4A4GA 2KRSA 2R57A 2NUPA 4RTTA 2CT3A 2XDBA 4BI8B 3NTKA 3P8DA 3M4YA 2KEAA 2OTLA 4J8OA 4M75D 3OB9A 4OMPA 2RQUA 2WSFE 3JCMe 5FLXE 5FU7B 3MP1A 4RTYA 4C5GA 1JBMA 2L3QA 2RB6A 4BI3A 1W2BP 1YJWQ 4NL3A 2VV5A 5LJ5h 1QCFA 3QJ6A 3BDUA 2XU8A 3JB9G 1VQNA 3GBQA 4M77A 2HKNA 1I8FA 1TG0A 5DLOA 4LDUA 4IUQA 1M8MA 4FW1A 1NJIU 3MPUB 2YHTA 4A54A 2VVKA 1Q81C 2JNGA 2JMCA 1OQKA 3CC4Q 3S3NA 2KT8A 1VQMA 1YIJT 2DEQA 2NUZA 4C0FA 3TU4K 4J6XA 2PQWA 1K8AU 3G6EQ 2M0YA 3I56Q 1QMCA 3M0QA 2LC4A 3CCEQ 2EQUA 3NHNA 3I55T 1Y0MA 1M8VA 5IHNA 1BIBA 2JTEA 2V1QA 3GPLA 2LCSA 1UTIA 3EFSA 3UATA 1N0GA 4IUVA 4J83A 1Q86R 2EKHA 2O4XA 1SSFA 2AT1B 3FDRA 4PJMA 5IHKA 1PD1A 4FYVB 1Q86U 3M4GA 3PMTA 1S72Q 1KC8U 1Y96B 2HKQB 3X24B 3A98A 1B07A 1X75C 1VQPT 3CMAA 3OYMA 2CKKA 1VQMQ 4E7ZA 4DA4A 3JCMQ 2RK1A 1K9AA 3PGGA 1XQHA 2YUQA 2YXYA 4NL2A 1M1KR 1JJ2S 1XTDA 3FB9A 3JCMd 1SKUB 3CCJT 2KYBA 4M77G 1AVZC 5KE2A 3V8JA 1X6BA 2LNVA 3OY9A 1Y7XA 4M78B 1PRLC 3OW2P 3JB9H 3J81E 4LXCA 8ATCB 2QG9B 3RMSA 4KULA 2KQWA 1KJWA 5J26A 2QA4T 2MIOA 4HA8A 3REBB 9ATCB 5GAOp 3S3MA 2DVEA 2PVOB 5C0MA 1GCQA 3OYEA 3GP8A 1RABB 3V7RA 1K9MC 2NYSA 3L2ZA 5CO7A 1C1AA 3CPWS 2E10A 1JEGA 5M9OA 3SDZA 4QW2A 5GAN6 2OX7A 1HK9A 4FYWB 2MWPA 2RQWA 1G8XA 4HCCA 5GMKj 4X9CA 2QEXA 1D0XA 1BIAA 1NG2A 4OMFB 1QCNA 1TS9A 3A8MB 2KAFA 1Z9QA 2HSPA 4C0GA 2E4HA 2EYQA 4HKEA 4M7AA 1ZA1B 4BY6C 2ESWA 4JRQA 2X9HA 3SWNB 5HKCA 3TCJA 3QUIA 1H92A 4C0DC 2J6FA 4PFPA 1VQ8A 1D0YA 1JRIA 2AKKA 1KD1R 3X25B 5I22A 1IHVA 5LJ3h 2J6KA 4MMLA 3C94A 2NUTB 1WHKA 4M7AE 1S72T 2HL5C 1CKBA 4J7IA 1BKBA 2CSQA 2FHDA 1E6HA 2LQWA 3WXMB 2X51A 4PFZA 4CC7A 2CP6A 3I55Q 1B34B 2PZ1A 1AT1B 5GAMe 2DFUA 2HAXA 1Y57A 1MMDA 1GBRA 5FROA 1QVFP 2E5QA 1Q7YR 1O9SA 2CUBA 3HHTB 4LDVA 3EG2A 2L3PA 1CSKA 1NEGA 3G71A 1I5LA 1MNDA 2RJFA 1M2VA 2LT4A 3CC4A 3JCMb 3OMGA 2NUPB 2LCLA 2RJEA 4M7AG 1YJNT 1Q86C 3VS7A 4FM4B 1AWJA 3M54A 4QQGA 3OQ5A 1NYFA 4XTZA 2K6DA 1TUDA 2BZXA 1P92A 3R6NA 1H641 1BCOA 1PHTA 3M0PA 3HTRA 1UJYA 2J6OA 3JCMf 3QG1A 3OYIA 1MMGA 4F7UB 1SF9A 3VU3C 1OOTA 2I0NA 3ME9A 2KRNA 1X6OA 1IHWA 2RNAA 2QA4A 1NLOC 3URGA 1NBEB 1EIFA 4ZGDB 1AZGB 4D6WA 1X01A 1V29B 2HSEB 2Y4YA 1AEYA 4JPBW 4QVZA 4OVAA 3HFNA 3ZEHA 4ZNXA 2L8DA 1ZQ1A 2FYKA 1RI9A 1YJNA 1Q7YC 1W1FA 1QCOA 1R77A 1VQ7A 3OYKA 2X3XD 2A08A 1GL5A 2HQXA 2YRDA 3CMEA 2Z0WA 1UG1A 3I5RA 1YJ9Q 5CR2A 2DTOA 3GF5A 3H0FA 1Y96A 4C8QG 3CCUQ 4ZGJB 1U8RA 4KH0B 1YWOA 1O75A 3G4ST 4E7HA 7AT1B 3M9QA 3OBYA 3CCQQ 5KE3A 1RI0A 3QJYA 4RTVA 3CCSQ 2G3RA 2ZPGB 3N5BB 1SSHA 3QSUA 2JTFA 1KQ2A 2O9SA 2F5KA 4M75G 3OYGA 3CCLQ 2A3LA 2V1RA 2EKOA 3QHSA 1BI0A 2YSQA 3RDVA 3OS2A 1RLQC 4QQ6A 1W2BS 4E47A 3CBMA 3VYGA 3VS2A 3VS1A 3UT1A 1SHFA 4F16A 2F2WA 2ZPEB 3QZ9B 1YP5A 4M7AF 2YWWA 1KC8C 2VKNA 1M30A 2RJCA 1IGUA 3GNGA 4J9BA 1KQ1A 2CP0A 5GAN7 4A4HA 1YWPA 1OZ2A 1D1CA 2M16A 2HD0A 2L0AA 2GFUA 2RQRA 1IB8A 3EH2A 2C0TA 4M75B 4JDSA 2H3EB 1NJIR 2JN0A 2HEQA 1FXXA 1JQQA 2AZSA 5IXFA 3KBGA 3CXCS 2AKLA 4R0KA 4C8QA 2KT1A 2LJ0A 4C92B 4ELZC 3THKA 3EGXA 1D0ZA 1VQPA 3EHRA 1K8AR 1FWZA 2QTXA 3A5ZB 2KMTA 5IAYA 4LE9A 5LJ3d 1N5ZA 2JXBA 3QXEB 4O5VA 5GAN3 2A7YA 2ATCB 2NLUA 4OB3B 2CP5A 2FL7A 5EG2A 1GFCA 1ZBXA 3I56T 2DAQA 2RF0A 4PFOA 4HCBA 4KT0E 4Q5WA 1YIJQ 2JW4A 2K3XA 2R5AA 5L8RE 1PWTA 4FYYB 5GAOq 2E6ZA 1W6XA 4RTUA 4M77D 1VIEA 4KUDK 1N6AA 4MZPA 1SRLA 3CCET 3CPFA 1GRIA 2D6FA 6AT1B 4F7UF 3CCST 2AK5A 2DYIA 1UGSB 1D09B 2RM4A 1ZSZB 3HL8A 4BD3A 4FT4A 2KXDA 3LWIA 3MO8A 3QO3A 3CCLT 1Q7YU 1WJSA 3FJPA 2LVMA 4ZTJA 1VQ5Q 2LDMA 2DO3A 4BE1A 4C92E 1BYMA 2GBQA 2RI5A 4F17A 3V8LA 1WHJA 3JRZA 1X2KA 1PC0A 2VWFA 4CRIA 2HZYA 2DPPB 3JV3A 1NYGA 2FZCB 1K8AC 2QYZA 3H8ZA 3CC2Q 2WSEE 3QWXX 4KGVB 4AFZC 1QVGP 3E2UA 5GAN4 1YIJA 2QAZA 2M0OA 1VQ7T 2DXBA 4BE2A 3CCRA 2RK2A 2M9UA 3H9NA 4C0DB 4J9GA 4C8QC 5IHIA 2QXFA 4QQDA 2CH4A 5KYXB 2COYA 2MMPA 2F2XA 2LRQA 5CCAA 1M90U 1TOVA 4OMLA 2E5KA 4J9HA 2M51A 1NEBA 1EX4A 3PVLA 2MOXA 1WX6A 1VQNT 2JVVA 2CZ6B 2C0OA 3CPWP 3PT9A 2OTJA 2D8HA 1YNZA 2DXTA 1VQLA 2DETA 1M90C 1PM3A 1R0BG 1YN8A 1UE9A 4ELYC 1PNJA 5HCKA 3A8LB 3BY7A 5A0DA 2KRMA 2V26A 2W0ZA 1OPLA 1M5Q1 1QLYA 5LJ5e 2R5MA 2C1LA 3BW1A 2GNCA 2JM9A 2AHJB 2KROA 4HCZA 1LCKA 2QDLA 3OYLA 5CK9A 1YI2A 1KHIA 3TSWA 2QGGA 4XU1A 2BKDN 3I56A 5A0LA 2HNIA 3OYYA 4GY5A 4PK4A 4A63B 4MZTA 2ZAEA 4AMCA 3M58A 1WGSA 5D7UA 4J9FA 4BDYA 1M27C 3LX7A 4M4ZA 2EGCA 1VYVA 2E3HA 3PVQA 2XD0A 1M1FA 4E2FB 4XTXA 4C5HA 5GAOn 5EC7A 1OI1A 4C5EA 1UUEA 4M75F 2XG8D 4V2SA 4M77C 3X20B 3VS5A 2ZPBB 1VQPQ 1EZZB 3NPFA 5LL6S 2K57A 5LJ3j 4ORZA 2KR3A 1N8RU 3CCQA 3RKXA 1DJ7B 2YT6A 3BE3A 3A8HB 4A53A 4K11A 1OZ3A 4OB2B 2NWMA 4JLIA 2J06A 2O88A 1IZ6A 2GTJA 2E65A 3D7SB 2YLCA 2LT1A 1MNEA 4IIOA 3I5SA 2ENMA 1S1NA 3CXCP 2P4RA 4E7JA 3MEWA 1KD1C 3M53A 4M7AC 1KIKA 2JT4A 2DRKA 3ER0A 4N0AC 1X69A 3EH1A 2KDSA 5GANe 2GQVA 1VOMA 3M56A 1SPKA 1N9SA 2QTVA 1TSFA 2QQ9A 1VYUA 1ZBJA 1VQ9A 3JCMV 4OF1A 2P4TA 2AIRB 3OBWA 4F04B 4GLMA 5GANf 3QIIA 4M78D 1V1CA 1NLPC 4LNPA 1WIEA 2EGEA 3CCSA 4MMKA 2YDLA 2EQIA 1WQ7A 3G71T 3QYGB 1VQNQ 2CS7A 4A4KA 2XHCA 4BY6B 1N27A 3EG0A 2K4YA 2K79A 4KGXB 1QVGS 4PJLA 2CYZB 2R58A 2K9GA 4J6YA 1WA7A 4IIMA 3QDFA 3RIRA 4M7DA 5L23A 3EGXB 4Y28E 3CD6Q 3JCMg 4KRTA 1K9MR 4DEXA 3HQFA 2GF7A 4N4HA 1VIFA 2BIVA 3IQLA 2F69A 1YBYA 4PJNA 2E64A 1WIDA 2CH4W 2CZ7B 1VQMT 4HVWA 3OYDA 2DZCA 1N0EA 3CCEA 1K73C 1MV0B 3LWHA 2HBWA 3CBPA 3OYBA 2RHIA 2DIQA 3NTHA 5CQYA 2IVWA 2DXCA 4Z88A 5FU7C 3OYNA 4EIKA 1UECA 1YCSB 3CMAT 1U1SA 2RI3A 2P0PA 1VQ5T 2LJ1A 1JJ2A 1OU8A 3RESA 3V7SA 2QGFB 2PNIA 1B7TA 3PE0A 3J80E 4M77B 3WVEB 3CCMT 4M75A 1YFNA 1PKSA 4C8QE 1ACMB 5C6SA 1GBQA 5FU6C 1U1TA 1B3QA 2PUOB 1NM7A 4BI4A 3TSZA 2VUBA 2RA2A 3VUZA 4PJOE 4LN2A 5LJ3e 2K3YA 4JZ4A 1CKAA 3G7ZA 3DLLA 5CKEA 1ZSZC 1TWBA 4O6JA 2B8AA 1VQOT 2K2VA 1I5OB 5GMKm 2HDAA 2K3BA 1RAFB 2HCKA 1ARKA 4XAXB 2X4JA 2KI7A 4J7FA 2EJGA 2CREA 4C92G 3C12A 2DRMA 2VASA 1BCMA 3S3OA 5HK3A 2IIMA 1MMNA 2EAYA 2H8HA 3NFCA 3H41A 3G71Q 2X4XA 1JXOA 1XJWB 3LGLA 4XQ3A 5I2SA 1WHHA 4ANJA 1AD5A 1BB9A 1D3BA 1KD1U 1JU5C 1WFWA 3FLGA 4J9DA 4EMKB 4JJNK 4QT7A 4DOVA 3I55A 1BI2A 3VV0A 1I07A 1VQKQ 4EDUA 4P5NA 4JJDA 5D6WA 2EJ9A 1YITQ 1WHLA 5HK0A 5FWBA 2ZGWA 4IUTA 2MPXC 1HXDA 5GAOr 4N4IA 1ZLMA 5CKHA 1ZX6A 5GAMf 3SD4A 4KBMB 2KY9A 2O01E 3KFVA 1GFDA 2ZZDA 4RTWA 4L5GA 1M1GA 1UHCA 3U23A 3NMZC 4DBHA 3GOXA 3G4SQ 3CCUA 4R55A 2EWNA 2DXUA 5I11A 4GBQA 2A37A 2P0KA 5KYWB 4M78G 1QVFS 1VQ4A 2A36A 3E19A 2DZ9A 4J9EA 1FMKA 4LDXA 2XK0A 5LJ5j 3RKYA 2GTOA 5IN1A 2RQTA 4ME7A 1AOJA 2QDYB 2DNUA 3KUFA 3CMAQ 5KYXA 3PIPA 3EGUA 3QDRB 4M7DD 1IO6A 3HP9A 4RG2A 4NS5A 4C8QF 2DL3A 1VQ8Q 4BB7A 3CMET 3MEAA 3I35A 2FRWA 3INZA 1KHCA 2ZPIB 4AG2C 3UA6A 3VS6A 2D1XA 4N0AA 5J39A 3OS5A 1YHQT 3EGDB 1D1AA 2L5QA 1M90R 3CQTA 4CC3A 5KYYB 1UGRB 2D8JA 3JCMX 4FSXA 1IGQA 2CP7A 2MI6A 3RNJA 2ED1A 3GIBA 3CCJA 4LD6A 2PVDB 2E70A 2MK5A 1RADB 2EGAA 1QKXA 2KSSA 3H0HA 1YELA 4KGZB 1X43A 3JB9D 2FEIA 4RCCA 3EG9A 3CC4T 4NOYA 1RAEB 1NPPA 4M75C 3UWNA 2MAMA 1M1KC 4M7DF 5KYNA 4BDZA 1E6GA 3MP8A 4E6RA 4F7UA 1RACB 1YITT 4AT1B 4PJOA 1SG5A 4XU3A 1RUWA 3A8OB 2MYSA 1S72A 1C6VX 1IXDA 1NZ9A 1G2BA 2DL8A 2YRVA 1U3OA 3JCMh 1W2BA 2FPFA 4R56A 5D6YA 2Y90A 2OI3A 1TUCA 4RMOA 3RERA 2D0NA 3CEYA 3EG3A 1MV3A 4RCBA 3BFMA 2BZ8A 4JUVA 1K1ZA 3CCQT 4Y92A 3EHQA 2OTJT 1ABQA 4M77E 2QI2A 2DM1A 1N8RR 1H3HA 1WXBA 4XU0A 2LX9A 2QQSA 3CCMQ 1N0FA 4OMQA 2D0QB 5DM7R 1A0NB 3META 4OB0B 1FMWA 1G83A 4ESRA 4TVRA 1BU1A 1SRMA 1Q82U 2DYBA 2F1LA 2DIGA 1YJNQ 3HRSA 3L42A 4XTVA 3OYCA 1V76A 1UHFA 1QP3A 5GJWB 1PD0A 3CC7A 2E3IA 2YUOA 5LJ5f 3CCRQ 3EGDA 3QYHB 2BUDA 2BZYA 2YRCA 3M5AA 4RKUE 2AZVA 3QWYA 3M57A 4YTLA 4E7IA 2FRYA 1BBZA 3QZ5B 2QQRA 2E41A 2LQNA 3EFOB 4BE0A 3CC2A 1QVGA 2KNBB 2EPDA 3PIOA 1YHQQ 4PL6A 3VS3A 1OU9A 4F14A 2BE7D 2H3JA 4HCKA 3RBBB 3O5ZA 1WDXA 2FZGB 2QQBA 2E1HA 4RG8A 2YUPA 3OSVA 1IRXA 4D8DA 4OB1B 4BACA 1VQOA 4OMNA 3OW2A 2GFAA 2DL7A 2F5TX 3LW5E 5CKBA 4JJCA 4PJOB 2P0QA 1VQ4Q 2A28A 2EIFA 1VQKT 1UDLA 4EMKC 3JAME 4C8QB 4DBRA 2DVJA 3MP6A 3JSCA 4PKCC 2KYMA 4KUIA 4PJOD 2FO0A 1ZUYA 1I81A 3MJXA 1AWWA 3QKJA 1KQSS 4DOWA 3CD6T 5CVIA 2DX1A 1VYTA 3E9GA 1WPYA 3F70A 3PFSA 5GMKe 4C92C 4M7DG 5D6XA 2EYWA 2V8KA 3L2UA 3OYJA 1KSWA 2DD5A 4JRPA 4XTUA 5GAN8 2RI2A 1KC8R 4IUUA 2RD1A 2M02A 2FPDA 3AT1B 1QVPA 2MCNA 4AFSC 4EPCA 1JJ2P 3LH5A 2NUTA 2GQIA 1WXUA 1VQKA 4C92F 3V8KA 3CCVT 4AFQC 1TU0B 3SB2A 2CT4A 2ROTA 3L1AA 4E7SA 5CKDA 4CC2A 2C06A 3CCRT 2COWA 3MHXA 1LJOA 2JMAA 1YI2T 5KYUA 3CMEQ 3OYAA 5DY9A 2JUFA 4FSSA 2PU9B 4F7UE 2KE9A 2OAUA 4MZMA 2QEXQ 4FT2A 1OEBA 5GAN5 4OGEA 2LTOA 5FWCA 2L3RA 2QA4Q 2DTHA 1NA6A 1TXQA 2O2OA 5LJ3f 1Y07A 2L3SA 4EMKA 3R6OA 3EG9B 4EMGA 1AWXA 1YJWT 2JOYA 3C0CA 4LUDA 4C5IA 1K73U 4BUGA 2KXCA 1K73R 1K0SA 3L2QA 3EFRA 1Q82C 4PLIA 5HY6A 2LMJA 4JZ3A 4A4FA 4DBQA 5KCHA 4C92A 3MKDA 4OGCA 4FU6A 3X28B 4IKFA 2K7AA 3M0SA 3NGPA 3M0TA 3RR6A 4UC4A 2ZCFB 2RO0A 1YJWA 2PTKA 3A8GB 2K2MA 3V7CA 1TUGB 3CC7Q 2RHXA 4CI0C 5GMKi 3I9QA 3RKWA 4DEYA 1SEMA 2EVRA 3EG1A 3FIFA 1I4K1 5KYWA 3OS0A 1MGQA 3S6WA 2HL3A 1UGVA 1N8RC 2XDDA 2O4XB 5KCOA 2DILA 3C95A 5GANj 4D8KA 1SHGA 2CZ0B 3M0UA 3RUXA 4A4EA 3CD6A 4B9XA 2EYYA 2JZ2A 3C4SA 2COZA 4HVVA 3H6ZA 4PJJA 1KG1A 1PKTA 2VC8A 2EFIA 4B9WA 2MF2A 1KQSP 3SEMA 1Y71A 2IPOB 4RTXA 2EQJA 3REAB 2BE9B 4M7AD 1Q81R 3A1PA 2ROLA 1GCPA 2RQVA 1Q81U 2RHYA 2M1HA 3VYHB 5LJ5g 3OA6A 1VQLQ 5FRNA 4M78C 5KYYA 2JJ9A 1RAGB 1I1JA 4M78A 1XNIA 2FZKB 3OSSC 3PNWC 4XTWA 1FYNA 4JLGA 1I0CA 1M4ZA 1VQ6A 2K5FA 1WI7A 4PJOF 1NPRA 2EJFA 4GLKA 4I1KA 4FYXB 3VRYA 3P8HA 3HRTA 4M77F 1G5VA 4II1A 3JCMJ 1MHNA 3VUBA 2DK3A 3OS1A 1G3SA 4X9DA 2ECZA 1M3AA 1VQ9T 2ED0A 3DB3A 4L6V5 1KK7A 2A0FB 2OTLQ 3TEEA 4JS5A 1J3TA 1N9RA 1TH7A 1PCXA 2DF6A 3CCMA 3L2VA 2X35A 1PG5B 2QQAA 1QWFA 4PNOA 4J9IA 3ZI5A 2KBTA 2GCXA 4Z02A 1VQ5A 1PRMC 2XIDA 3J7AF 4XK8E 1WJQA 2PUKB 1PSFA 3ASKA 1EFNA 1QWEA 2CZ1B 2CP3A 2VB6A 4M7DE 4XTYA 2DKGA 1KQSA 4HT8A 2J7IA 3MEUA 1MMAA 1OPKA 2DLPA 3QPHA 8AT1B 4OMOA 3CC7T 1X27A 3CCLA 4F7UG 4WTOB 1JXMA 5I21A 1AZEA 2DMOA 1K9MU 2HMAA 4PJOG 1R8OB 1KFZA 5IT9E 3VJPA 2K5LA 3CBOA 2YUNA 3LYIA 1U06A 4CC4B 1YJ9T 2FPEA 2V8IA 2X3WD 1QQJA 5GAOm 2DBKA 3FRNA 1W4SA 5CKFA 2RHUA 1ZUUA 1VUBA 2DL4A 2X4YA 4QVCA 2W10A 2CP2A 2LJ3A 1JO8A 1FMVA 5ECAA 5GAN2 3ZBDA 1M3CA 4AG1C 1HSQA 1T0HA 2DA9A 2RH2A 2DL5A 1Q95G 3L2WA 1QKWA 2QK0A 3G4SA 1JB0E 1AWOA 2RPNA 2XI9A 3TVTA 3JB9J 4VUBA 1YITA 1NJIC 3LH0A 1M2VB 1HJDA 2J05A 3KXTA 3GNFB 5KYUB 3AHUA 2WSCE 1VQ8T 3FC3A 1YI2Q 1WXTA 4RTZA 1AHJB 2K5IA 1WHGA 3TQ7P 5GANd 4Z8AA 3G6EA 1VQ9Q 2DBMA 2DE0X 1VQ7Q 1WLPB 3HSBA 1UB4A 1X2QA 1WQWA 3FEOA 2JS2A 4B6MA 4FCYA 3NTIA 2EW3A 3WVDB 4PJOC 3O8VA 2HQEA 3EAEA 1H8KA 3VRZA 1RAHB 3LGFA 2O31A 4M75E 3UDCA 3CXCA 1LPLA 2EYZA 5GAMg 4C92D 2OTLT 2DJQA 1F1BB 1RAIB 1OX8A 2VGNA 1T0JA 4M7DB 2L2PA 3JCMP 1GCQC 1WJRA 3P8BB 3DB4A 2F2VA 5LJ5d 1HD3A 1NE8A 5GAOl 1RLPC 2LX7A 1TTHB 2VXEA 1YCYA 2HBPA 3RMQA 2JS0A 4KH1B 2E6NA 2D9TA 3G6ET 5DLQE 1BK2A 2DJZA 1VQ4T 4LD9K 2DTIA 1WZOA 2CDTA 3UPUA 2VXFA 3PTAA 1M9SA 1D1BA 1BI3A 2CGHA 3Q1JA 1VQ6T 2FG0A 3VS0A 3CCUT 1RAAB 2KVQG 2LP5A 2RHZA 3VS4A 4E7LA 2OJ2A 4FW2A 4JRKA 2G6FX 2KK4A 3SWNA 2EQMA 5FU6B 5LJ3g 1OV3A 2BTTA 4LUEA 2ABLA 2ZPFB 1WNLA 4FIBA 5IXBA 2V8JA 3CPWA 5AT1B 1HYOA 1ABOA 2DEUA 4HT9A 2IG0A 5A2QE 2FVUA 1K76A 3JCMW 2OTJQ 5GAMh 4HVUA 3MCAB 1ZUKA 3HKSA 2EYXA
chains in the Genus database with same CATH topology
1I81A 4XU2A 3MEVA 1P92A 3QKJA 2VYTA 1H641 4DOWA 5GMKl 1KQSS 1VQLT 1M1KU 2WACA 1QVFA 3CD6T 5CVIA 3CCSA 4MMKA 3L2RA 1G3TA 1WQ7A 3G71T 2Y4XA 3E9GA 1WPYA 3F70A 3PFSA 3QYGB 1RL2A 5GMKe 4C92C 5CAIA 4M7DG 3JCMf 2CS7A 3QG1A 4A4KA 3OYIA 2XHCA 5D6XA 3VKIA 2V8KA 4F7UB 4Y91A 1B34A 3VU3C 4BY6B 5GMKh 3L2UA 1N27A 3OYJA 3OYFA 3PMIA 2DD5A 2K4YA 2MWOA 3ME9A 4JRPA 2ZPHB 3M59A 4XTUA 5GAMd 5GAN8 2RI2A 1X6OA 1QVGS 2QA4A 3URGA 4IUUA 2RD1A 3HRUA 2CYZB 2R58A 4J6YA 1EIFA 4ZGDB 1QVPA 4LDYA 4EPCA 3RIRA 4M7DA 4D6WA 1X01A 4M7AB 1V29B 1D3BB 1G3WA 4Y28E 2Y4YA 3JCMg 4QVZA 4OVAA 1QP2A 3HFNA 3ZEHA 3HQFA 2GF7A 1VQKA 4C92F 2L8DA 3V8KA 1ZQ1A 3CCVT 2FYKA 4N4HA 1VIFA 2BIVA 2RJDA 2F69A 3SB2A 1YJNA 1YBYA 1Q7YC 2E64A 3L1AA 1WIDA 5CKDA 1VQ7A 1VQMT 2CZ7B 2PVGB 3OYKA 3CCRT 2QEXT 3MHXA 3OYDA 3OW2S 2C06A 1LJOA 2DZCA 1YI2T 3CCEA 1K73C 2LQKA 1XOVA 1ZHIA 4OP0A 3LWHA 3CBPA 2HQXA 4N4GA 3OYBA 2RHIA 2DIQA 3OYAA 5DY9A 3NTHA 3CMEA 3DKMA 2JUFA 3M55A 2I2LA 3SWNC 5CQYA 2IVWA 2DXCA 2PU9B 1FX7A 5FU7C 2OAUA 4MZMA 4F7UE 3OYNA 4FT2A 4J6WA 5GAN5 3CMAT 4OGEA 1U1SA 2LTOA 2L3RA 2RI3A 1LNXA 2P0PA 2DTHA 3DLMA 4QVDA 2LCCA 3LLRA 5CR2A 1VQ5T 4L59A 2DTOA 1JJ2A 3GF5A 5A0GA 3RESA 4ZGEB 2E12A 1Y96A 1NA6A 3V7SA 4C8QD 5LJ3f 4C8QG 1Y07A 4ZGJB 1U8RA 2DD4A 3JB9I 3J80E 4M77B 1O75A 3WVEB 4EMKA 3CCMT 3R6OA 3G4ST 4E7HA 3E9FA 4DQ2A 4M75A 4EMGA 3TREA 3BDLA 4C8QE 3M9QA 2JOYA 5C6SA 4ZTFA 1YJWT 5FU6C 4C5IA 1K73U 4ATOA 1U1TA 4BUGA 3OYHA 2PUOB 3OBYA 5KE3A 1RI0A 4JS4A 5CIUA 4BI4A 3L2QA 5GAMj 2XICA 2VUBA 3HFOA 3EFRA 3QJYA 2G3RA 2YLBA 2ZPGB 3CCVA 2VGMA 2RA2A 3VUZA 3N5BB 4PLIA 5GANg 1Q82C 5HY6A 5LJ3e 4PJOE 2K3YA 4A4FA 2JTMA 4C0ZA 4C92A 5KCHA 3QSUA 2JTFA 1KQ2A 1UGPB 2F5KA 2XDPA 3G7ZA 4M75G 4OGCA 3E1SA 3OYGA 5CKEA 3DLLA 2A3LA 4FU6A 2EKOA 4J5YA 3QHSA 3X28B 4IKFA 5AYFA 1BI0A 4O6JA 2B8AA 1VQOT 2K2VA 4E7KA 4UC4A 2ZCFB 4PLLA 1YJ9A 4JRIA 5GMKm 3OS2A 4QQ6A 1W2BS 2RO0A 1YJWA 2X4WA 4E47A 3CBMA 4IUPA 3GLXA 1G3YA 1UEBA 2FB7A 3A8GB 4XAXB 3VYGA 2X4JA 3V7CA 4J7FA 3JCMc 1QW1A 2EJGA 1IREB 1LOJA 2RHXA 1UGQB 3UT1A 4C92G 4M78E 4CI0C 5GMKi 3RKWA 4M7DC 4FL6A 4ZN3A 5I2MA 3C12A 2XKOC 2ZPEB 3FIFA 4IURA 3QZ9B 3S3OA 1BI1A 1I4K1 4X34A 4M7AF 5CQXA 5HK3A 1KC8C 3OS0A 2EAYA 2LQ8A 1MGQA 3NFCA 3S6WA 2X4XA 2RJCA 1H3ZA 3SFMA 1N8RC 2XDDA 2O4XB 5KCOA 3HPWA 3GNGA 3OMCA 3LGLA 3C95A 1KQ1A 4XQ3A 3ZFJA 2L89A 5GANj 5I2SA 5GAN7 3QBYA 4A4HA 2CZ0B 3RUXA 1OZ2A 2M16A 1D3BA 2HD0A 4A4EA 5GANh 1KD1U 3CD6A 3FLGA 4LDWA 2GFUA 4B9XA 4EMKB 4JJNK 2JZ2A 3C4SA 3JB9F 4DOVA 4MDXA 4M75B 3H6ZA 4JDSA 1OYXA 5KH6A 3I55A 1BI2A 1YHQA 3T9NA 3VV0A 1KG1A 2VC8A 2EFIA 2EQKA 4B9WA 2MF2A 4MDWA 5J3BA 4P5NA 1PSEA 2JN0A 4EDUA 4ZN1A 5D6WA 5FRMA 1FXXA 1Y71A 3X26B 2EJ9A 4M78F 2EQJA 4WF2A 3KBGA 4EMHA 5HK0A 3CC2T 2ZGWA 4IUTA 4A4GA 3CXCS 2R57A 4M7AD 2XDBA 4C8QA 4BI8B 1HXDA 4C92B 1Q81U 2RHYA 2M1HA 3VYHB 3NTKA 4ELZC 5LJ5g 3OA6A 5GAOr 5FRNA 4M78C 4N4IA 5CKHA 3P8DA 1VQPA 3M4YA 5GAMf 3SD4A 2OTLA 4J8OA 4KBMB 4M75D 3OB9A 2KY9A 1FWZA 2WSFE 2O01E 3JCMe 5FLXE 2QTXA 3A5ZB 5FU7B 2KMTA 4M78A 3MP1A 1XNIA 4C5GA 1JBMA 3OSSC 2ZZDA 2RB6A 3PNWC 4XTWA 5LJ3d 4BI3A 4JLGA 4L5GA 1M1GA 1M4ZA 3QXEB 4O5VA 1VQ6A 5GAN3 2K5FA 2A7YA 4NL3A 2VV5A 5LJ5h 2NLUA 4PJOF 4OB3B 2D6FA 1NPRA 3QJ6A 3BDUA 3GOXA 3CCUA 2XU8A 2EJFA 3JB9G 1VQNA 4GLKA 2FL7A 4M77A 5EG2A 1ZBXA 4R55A 4I1KA 2EWNA 1I8FA 5DLOA 2DXUA 4LDUA 3I56T 2DAQA 3P8HA 4IUQA 3HRTA 2P0KA 4HCBA 4M77F 1NJIU 4KT0E 1G5VA 2YHTA 4M78G 4A54A 4II1A 3JCMJ 1QVFS 1MHNA 3VUBA 1VQ4A 4Q5WA 2K3XA 2DZ9A 2R5AA 3E19A 1Q81C 2DK3A 5L8RE 3OS1A 2JNGA 4LDXA 2XK0A 5LJ5j 3RKYA 1G3SA 2E6ZA 4X9DA 5GAOq 5IN1A 4M77D 4ME7A 1VQ9T 1VIEA 2QDYB 3KUFA 3DB3A 4L6V5 3S3NA 1VQMA 1YIJT 3PIPA 2DEQA 3QDRB 4M7DD 4KUDK 1N6AA 4MZPA 3HP9A 3CCET 4RG2A 4NS5A 4C8QF 3CPFA 3TEEA 4C0FA 4JS5A 3TU4K 4J6XA 2PQWA 1N9RA 4BB7A 1TH7A 4F7UF 1UGSB 2RM4A 3CCST 1K8AU 3CMET 3CCMA 3MEAA 3HL8A 3L2VA 4BD3A 2X35A 4FT4A 3INZA 2QQAA 1KHCA 2ZPIB 2LC4A 3LWIA 3MO8A 3QO3A 4PNOA 2EQUA 4N0AA 3CCLT 5J39A 1Q7YU 1WJSA 3OS5A 3I55T 1YHQT 2GCXA 3FJPA 4Z02A 2LVMA 1VQ5A 1M8VA 2XIDA 3J7AF 4ZTJA 4XK8E 1BIBA 1WJQA 2L5QA 2LDMA 2PUKB 3GPLA 1UGRB 2DO3A 3EFSA 4BE1A 1PSFA 4C92E 4IUVA 3JCMX 3ASKA 4J83A 4FSXA 2O4XA 1SSFA 1BYMA 3FDRA 2MI6A 1Q86U 3GIBA 3CCJA 3M4GA 2RI5A 2CZ1B 2PVDB 3PMTA 2E70A 4LD6A 3JRZA 3V8LA 1KC8U 4M7DE 1Y96B 2DKGA 4XTYA 4CRIA 1KQSA 2DPPB 4HT8A 3MEUA 3X24B 1VQPT 1X75C 2KSSA 3QPHA 1K8AC 3CMAA 5IAYA 3H8ZA 2CKKA 2WSEE 3OYMA 3JB9D 1YELA 4RCCA 3CC7T 3CCLA 4DA4A 4F7UG 5I21A 3JCMQ 2RK1A 3CC4T 4NOYA 1K9MU 1NPPA 4M75C 5GAN4 3UWNA 2MAMA 1R8OB 1XQHA 3PGGA 4PJOG 1YIJA 4NL2A 1JJ2S 5IT9E 1XTDA 1M1KC 3VJPA 2M0OA 4M7DF 3FB9A 2DXBA 3JCMd 2K5LA 3CBOA 3CCRA 3LYIA 4BDZA 4BE2A 2RK2A 2M9UA 4C0DB 4C8QC 4M77G 3CCJT 5KE2A 2QXFA 1YJ9T 4QQDA 3V8JA 2MMPA 2V8IA 2LNVA 3MP8A 2LRQA 4F7UA 5GAOm 3FRNA 1W4SA 3OY9A 5CCAA 1Y7XA 5CKFA 2RHUA 1M90U 1VUBA 2X4YA 4M78B 1YITT 4QVCA 4PJOA 3JB9H 3J81E 4XU3A 5GAN2 3ZBDA 3A8OB 1S72A 2RH2A 1VQNT 2JVVA 3RMSA 2CZ6B 3L2WA 1NZ9A 3PT9A 2OTJA 4KULA 2KQWA 3G4SA 1JB0E 2YRVA 2DXTA 1VQLA 5J26A 2QA4T 1M90C 4HA8A 3JCMh 5GAOp 1W2BA 3S3MA 2DVEA 2PVOB 4ELYC 5A0DA 3A8LB 3BY7A 5C0MA 3OYEA 4R56A 5D6YA 2XI9A 3GP8A 3V7RA 2Y90A 1M5Q1 1K9MC 3JB9J 4VUBA 3L2ZA 4RMOA 5CO7A 3CPWS 5LJ5e 3CEYA 1YITA 1NJIC 3RERA 2R5MA 2E10A 3BW1A 4RCBA 5M9OA 3SDZA 3LH0A 2AHJB 3BFMA 4QW2A 5GAN6 3KXTA 1HK9A 3GNFB 4JUVA 2MWPA 3AHUA 4HCZA 3OYLA 2WSCE 3CCQT 1VQ8T 5CK9A 3FC3A 4HCCA 5GMKj 2OTJT 4X9CA 4M77E 2QEXA 2QI2A 1YI2A 1KHIA 1BIAA 4XU0A 1AHJB 4OMFB 2K5IA 4XU1A 2BKDN 2LX9A 2QQSA 3A8MB 2KAFA 5GANd 3I56A 3G6EA 4C0GA 2D0QB 3HSBA 1UB4A 5A0LA 1WQWA 5DM7R 2EYQA 2HNIA 3OYYA 4HKEA 4GY5A 3FEOA 4M7AA 4BY6C 4MZTA 4JRQA 3META 3M58A 3NTIA 3SWNB 4OB0B 3WVDB 5HKCA 3TCJA 4PJOC 3O8VA 3QUIA 1WGSA 2HQEA 3EAEA 4C0DC 4TVRA 1GXIE 4BDYA 1Q82U 1VQ8A 3LX7A 2DIGA 3LGFA 3HRSA 3L42A 4M75E 4XTVA 1JRIA 1M1FA 3UDCA 3OYCA 3CXCA 2XD0A 4XTXA 4C5HA 1QP3A 5GAMg 4C92D 5GAOn 3X25B 2OTLT 1OI1A 4C5EA 3CC7A 4M75F 2XG8D 5LJ5f 4M77C 2VGNA 4V2SA 3X20B 4M7DB 2ZPBB 3JCMP 5LJ3h 1WJRA 3QYHB 2BUDA 3P8BB 4MMLA 3C94A 3DB4A 3M5AA 5LL6S 2K57A 5LJ3j 4M7AE 5LJ5d 1S72T 4RKUE 1NE8A 5GAOl 1N8RU 3M57A 4YTLA 4E7IA 3CCQA 4J7IA 1DJ7B 3RKXA 3QZ5B 2VXEA 3A8HB 1BKBA 1YCYA 4A53A 2FHDA 2QQRA 2E41A 2HBPA 1OZ3A 4OB2B 3WXMB 4JLIA 4BE0A 3CC2A 3RMQA 1QVGA 1IZ6A 2E6NA 2D9TA 3G6ET 5DLQE 2DJZA 3PIOA 2E65A 1VQ4T 2DTIA 4PL6A 1B34B 4LD9K 2YLCA 3UPUA 2VXFA 2LT1A 3PTAA 1M9SA 5GAMe 2H3JA 1BI3A 2CGHA 3Q1JA 1VQ6T 2HAXA 4E7JA 1KD1C 3MEWA 3M53A 2QQBA 4RG8A 2E1HA 5FROA 1VQ7T 4M7AC 3CCUT 2E5QA 2KVQG 2RHZA 3OSVA 1O9SA 3HHTB 4LDVA 3ER0A 4N0AC 4OB1B 4E7LA 4JRKA 4BACA 1VQOA 2KK4A 3SWNA 3OW2A 2EQMA 2GFAA 2KDSA 5FU6B 5GANe 2F5TX 2GQVA 5LJ3g 3LW5E 3M56A 2ZPFB 5CKBA 1WNLA 1N9SA 4FIBA 3G71A 1I5LA 4PJOB 2V8JA 2P0QA 3CPWA 2QQ9A 2RJFA 2EIFA 1VQ9A 3JCMV 2LT4A 3CC4A 4HT9A 2IG0A 5A2QE 3JCMb 1VQKT 3OMGA 4OF1A 2FVUA 3JCMW 2LCLA 2P4TA 2RJEA 5GAMh 4M7AG 4EMKC 3JAME 4C8QB 1YJNT 3OBWA 3MCAB 1Q86C 4FM4B 3M54A 4QQGA 3MP6A 3JSCA 4PKCC 3QIIA 5GANf 3HKSA 4KUIA 4PJOD 3OQ5A 4M78D 4XTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQF A;  1WID A;  1NA6 A;  4LDV A;  1YEL A;  4LDY A;  4LDW A;  4I1K A;  4LDU A;  4LDX A; 
#chains in the Genus database with same CATH topology
 4X1V A;  4XU2 A;  3MEV A;  2VYT A;  5GMK l;  2XMF A;  1VQL T;  1QVF A;  1M1K U;  2WAC A;  2LNH B;  2GGR A;  3L2R A;  1G3T A;  2Y4X A;  1ZA2 B;  1RL2 A;  5CAI A;  3VKI A;  2JM8 A;  4Y91 A;  1B34 A;  5GMK h;  4Z89 A;  3OYF A;  3PMI A;  2MWO A;  2ZPH B;  3M59 A;  5GAM d;  1K4U S;  3SHW A;  3H0I A;  3HRU A;  1K0X A;  3CCV Q;  4LDY A;  1Z9Z A;  4M7A B;  1D3B B;  1G3W A;  4RUG A;  1QP2 A;  4WCI A;  3G1J A;  2RJD A;  2O9V A;  3EFO A;  2PVG B;  3OW2 S;  2QEX T;  1LVK A;  2LQK A;  1XOV A;  1ZHI A;  4OP0 A;  4N4G A;  4DBF A;  1T3L A;  1VQO Q;  3DKM A;  3M55 A;  2I2L A;  3SWN C;  1FX7 A;  2C0I A;  4J6W A;  1WYX A;  2RMO A;  4QVD A;  1GXI E;  1LNX A;  3DLM A;  4AFU C;  2LCC A;  3LLR A;  1OUL A;  4L59 A;  2CUD A;  5A0G A;  4ZGE B;  2E12 A;  1U5S A;  4C8Q D;  2DD4 A;  3JB9 I;  3E9F A;  4DQ2 A;  3UA7 A;  4HXJ A;  3TRE A;  1T3S A;  3BDL A;  2SEM A;  1R0C B;  4ZTF A;  1M3B A;  1X6G A;  4ATO A;  3OYH A;  4JS4 A;  5CIU A;  5GAM j;  3M0R A;  2XIC A;  3HFO A;  2YLB A;  2CSI A;  3CCV A;  2VGM A;  5GAN g;  1E7O A;  2HQH A;  3UF4 A;  2JTM A;  4C0Z A;  3ZL7 C;  1UGP B;  2XDP A;  3E1S A;  2QAS A;  4J9C A;  5FW9 A;  2DER A;  4J5Y A;  4QKU A;  5AYF A;  1MUZ A;  5GJV B;  3FJ5 A;  4E7K A;  4PLL A;  1YJ9 A;  4JRI A;  2RN8 A;  1VQ6 Q;  2X4W A;  1C0M A;  1ZSZ A;  4IUP A;  3GLX A;  1G3Y A;  1UEB A;  1ZSG A;  2FB7 A;  3JCM c;  1QW1 A;  1IRE B;  1LOJ A;  1UGQ B;  4M78 E;  4M7D C;  4FL6 A;  4ZN3 A;  5I2M A;  5IH2 A;  2XKO C;  2SRC A;  4IUR A;  1UJ0 A;  1UFF A;  1BI1 A;  2KGT A;  2OAW A;  4X34 A;  5CQX A;  2LQ8 A;  1W70 A;  1H3Z A;  3SFM A;  1OX9 A;  3ULR B;  3HPW A;  1Q82 R;  3OMC A;  3CCJ Q;  3ZFJ A;  2L89 A;  3QBY A;  1WHM A;  1M2O A;  5GAN h;  4LDW A;  3JB9 F;  2EBP A;  4OMM A;  4MDX A;  1OYX A;  5KH6 A;  1YHQ A;  3T9N A;  2P84 A;  2EQK A;  4MDW A;  5J3B A;  4ZN1 A;  1PSE A;  4JJB A;  1VA7 A;  5FRM A;  3X26 B;  4M78 F;  2B86 A;  2LZ6 B;  4WF2 A;  3CC2 T;  4EMH A;  4A4G A;  2KRS A;  2R57 A;  2NUP A;  4RTT A;  2CT3 A;  2XDB A;  4BI8 B;  3NTK A;  3P8D A;  3M4Y A;  2KEA A;  2OTL A;  4J8O A;  4M75 D;  3OB9 A;  4OMP A;  2RQU A;  2WSF E;  3JCM e;  5FLX E;  5FU7 B;  3MP1 A;  4RTY A;  4C5G A;  1JBM A;  2L3Q A;  2RB6 A;  4BI3 A;  1W2B P;  1YJW Q;  4NL3 A;  2VV5 A;  5LJ5 h;  1QCF A;  3QJ6 A;  3BDU A;  2XU8 A;  3JB9 G;  1VQN A;  3GBQ A;  4M77 A;  2HKN A;  1I8F A;  1TG0 A;  5DLO A;  4LDU A;  4IUQ A;  1M8M A;  4FW1 A;  1NJI U;  3MPU B;  2YHT A;  4A54 A;  2VVK A;  1Q81 C;  2JNG A;  2JMC A;  1OQK A;  3CC4 Q;  3S3N A;  2KT8 A;  1VQM A;  1YIJ T;  2DEQ A;  2NUZ A;  4C0F A;  3TU4 K;  4J6X A;  2PQW A;  1K8A U;  3G6E Q;  2M0Y A;  3I56 Q;  1QMC A;  3M0Q A;  2LC4 A;  3CCE Q;  2EQU A;  3NHN A;  3I55 T;  1Y0M A;  1M8V A;  5IHN A;  1BIB A;  2JTE A;  2V1Q A;  3GPL A;  2LCS A;  1UTI A;  3EFS A;  3UAT A;  1N0G A;  4IUV A;  4J83 A;  1Q86 R;  2EKH A;  2O4X A;  1SSF A;  2AT1 B;  3FDR A;  4PJM A;  5IHK A;  1PD1 A;  4FYV B;  1Q86 U;  3M4G A;  3PMT A;  1S72 Q;  1KC8 U;  1Y96 B;  2HKQ B;  3X24 B;  3A98 A;  1B07 A;  1X75 C;  1VQP T;  3CMA A;  3OYM A;  2CKK A;  1VQM Q;  4E7Z A;  4DA4 A;  3JCM Q;  2RK1 A;  1K9A A;  3PGG A;  1XQH A;  2YUQ A;  2YXY A;  4NL2 A;  1M1K R;  1JJ2 S;  1XTD A;  3FB9 A;  3JCM d;  1SKU B;  3CCJ T;  2KYB A;  4M77 G;  1AVZ C;  5KE2 A;  3V8J A;  1X6B A;  2LNV A;  3OY9 A;  1Y7X A;  4M78 B;  1PRL C;  3OW2 P;  3JB9 H;  3J81 E;  4LXC A;  8ATC B;  2QG9 B;  3RMS A;  4KUL A;  2KQW A;  1KJW A;  5J26 A;  2QA4 T;  2MIO A;  4HA8 A;  3REB B;  9ATC B;  5GAO p;  3S3M A;  2DVE A;  2PVO B;  5C0M A;  1GCQ A;  3OYE A;  3GP8 A;  1RAB B;  3V7R A;  1K9M C;  2NYS A;  3L2Z A;  5CO7 A;  1C1A A;  3CPW S;  2E10 A;  1JEG A;  5M9O A;  3SDZ A;  4QW2 A;  5GAN 6;  2OX7 A;  1HK9 A;  4FYW B;  2MWP A;  2RQW A;  1G8X A;  4HCC A;  5GMK j;  4X9C A;  2QEX A;  1D0X A;  1BIA A;  1NG2 A;  4OMF B;  1QCN A;  1TS9 A;  3A8M B;  2KAF A;  1Z9Q A;  2HSP A;  4C0G A;  2E4H A;  2EYQ A;  4HKE A;  4M7A A;  1ZA1 B;  4BY6 C;  2ESW A;  4JRQ A;  2X9H A;  3SWN B;  5HKC A;  3TCJ A;  3QUI A;  1H92 A;  4C0D C;  2J6F A;  4PFP A;  1VQ8 A;  1D0Y A;  1JRI A;  2AKK A;  1KD1 R;  3X25 B;  5I22 A;  1IHV A;  5LJ3 h;  2J6K A;  4MML A;  3C94 A;  2NUT B;  1WHK A;  4M7A E;  1S72 T;  2HL5 C;  1CKB A;  4J7I A;  1BKB A;  2CSQ A;  2FHD A;  1E6H A;  2LQW A;  3WXM B;  2X51 A;  4PFZ A;  4CC7 A;  2CP6 A;  3I55 Q;  1B34 B;  2PZ1 A;  1AT1 B;  5GAM e;  2DFU A;  2HAX A;  1Y57 A;  1MMD A;  1GBR A;  5FRO A;  1QVF P;  2E5Q A;  1Q7Y R;  1O9S A;  2CUB A;  3HHT B;  4LDV A;  3EG2 A;  2L3P A;  1CSK A;  1NEG A;  3G71 A;  1I5L A;  1MND A;  2RJF A;  1M2V A;  2LT4 A;  3CC4 A;  3JCM b;  3OMG A;  2NUP B;  2LCL A;  2RJE A;  4M7A G;  1YJN T;  1Q86 C;  3VS7 A;  4FM4 B;  1AWJ A;  3M54 A;  4QQG A;  3OQ5 A;  1NYF A;  4XTZ A;  2K6D A;  1TUD A;  2BZX A;  1P92 A;  3R6N A;  1H64 1;  1BCO A;  1PHT A;  3M0P A;  3HTR A;  1UJY A;  2J6O A;  3JCM f;  3QG1 A;  3OYI A;  1MMG A;  4F7U B;  1SF9 A;  3VU3 C;  1OOT A;  2I0N A;  3ME9 A;  2KRN A;  1X6O A;  1IHW A;  2RNA A;  2QA4 A;  1NLO C;  3URG A;  1NBE B;  1EIF A;  4ZGD B;  1AZG B;  4D6W A;  1X01 A;  1V29 B;  2HSE B;  2Y4Y A;  1AEY A;  4JPB W;  4QVZ A;  4OVA A;  3HFN A;  3ZEH A;  4ZNX A;  2L8D A;  1ZQ1 A;  2FYK A;  1RI9 A;  1YJN A;  1Q7Y C;  1W1F A;  1QCO A;  1R77 A;  1VQ7 A;  3OYK A;  2X3X D;  2A08 A;  1GL5 A;  2HQX A;  2YRD A;  3CME A;  2Z0W A;  1UG1 A;  3I5R A;  1YJ9 Q;  5CR2 A;  2DTO A;  3GF5 A;  3H0F A;  1Y96 A;  4C8Q G;  3CCU Q;  4ZGJ B;  1U8R A;  4KH0 B;  1YWO A;  1O75 A;  3G4S T;  4E7H A;  7AT1 B;  3M9Q A;  3OBY A;  3CCQ Q;  5KE3 A;  1RI0 A;  3QJY A;  4RTV A;  3CCS Q;  2G3R A;  2ZPG B;  3N5B B;  1SSH A;  3QSU A;  2JTF A;  1KQ2 A;  2O9S A;  2F5K A;  4M75 G;  3OYG A;  3CCL Q;  2A3L A;  2V1R A;  2EKO A;  3QHS A;  1BI0 A;  2YSQ A;  3RDV A;  3OS2 A;  1RLQ C;  4QQ6 A;  1W2B S;  4E47 A;  3CBM A;  3VYG A;  3VS2 A;  3VS1 A;  3UT1 A;  1SHF A;  4F16 A;  2F2W A;  2ZPE B;  3QZ9 B;  1YP5 A;  4M7A F;  2YWW A;  1KC8 C;  2VKN A;  1M30 A;  2RJC A;  1IGU A;  3GNG A;  4J9B A;  1KQ1 A;  2CP0 A;  5GAN 7;  4A4H A;  1YWP A;  1OZ2 A;  1D1C A;  2M16 A;  2HD0 A;  2L0A A;  2GFU A;  2RQR A;  1IB8 A;  3EH2 A;  2C0T A;  4M75 B;  4JDS A;  2H3E B;  1NJI R;  2JN0 A;  2HEQ A;  1FXX A;  1JQQ A;  2AZS A;  5IXF A;  3KBG A;  3CXC S;  2AKL A;  4R0K A;  4C8Q A;  2KT1 A;  2LJ0 A;  4C92 B;  4ELZ C;  3THK A;  3EGX A;  1D0Z A;  1VQP A;  3EHR A;  1K8A R;  1FWZ A;  2QTX A;  3A5Z B;  2KMT A;  5IAY A;  4LE9 A;  5LJ3 d;  1N5Z A;  2JXB A;  3QXE B;  4O5V A;  5GAN 3;  2A7Y A;  2ATC B;  2NLU A;  4OB3 B;  2CP5 A;  2FL7 A;  5EG2 A;  1GFC A;  1ZBX A;  3I56 T;  2DAQ A;  2RF0 A;  4PFO A;  4HCB A;  4KT0 E;  4Q5W A;  1YIJ Q;  2JW4 A;  2K3X A;  2R5A A;  5L8R E;  1PWT A;  4FYY B;  5GAO q;  2E6Z A;  1W6X A;  4RTU A;  4M77 D;  1VIE A;  4KUD K;  1N6A A;  4MZP A;  1SRL A;  3CCE T;  3CPF A;  1GRI A;  2D6F A;  6AT1 B;  4F7U F;  3CCS T;  2AK5 A;  2DYI A;  1UGS B;  1D09 B;  2RM4 A;  1ZSZ B;  3HL8 A;  4BD3 A;  4FT4 A;  2KXD A;  3LWI A;  3MO8 A;  3QO3 A;  3CCL T;  1Q7Y U;  1WJS A;  3FJP A;  2LVM A;  4ZTJ A;  1VQ5 Q;  2LDM A;  2DO3 A;  4BE1 A;  4C92 E;  1BYM A;  2GBQ A;  2RI5 A;  4F17 A;  3V8L A;  1WHJ A;  3JRZ A;  1X2K A;  1PC0 A;  2VWF A;  4CRI A;  2HZY A;  2DPP B;  3JV3 A;  1NYG A;  2FZC B;  1K8A C;  2QYZ A;  3H8Z A;  3CC2 Q;  2WSE E;  3QWX X;  4KGV B;  4AFZ C;  1QVG P;  3E2U A;  5GAN 4;  1YIJ A;  2QAZ A;  2M0O A;  1VQ7 T;  2DXB A;  4BE2 A;  3CCR A;  2RK2 A;  2M9U A;  3H9N A;  4C0D B;  4J9G A;  4C8Q C;  5IHI A;  2QXF A;  4QQD A;  2CH4 A;  5KYX B;  2COY A;  2MMP A;  2F2X A;  2LRQ A;  5CCA A;  1M90 U;  1TOV A;  4OML A;  2E5K A;  4J9H A;  2M51 A;  1NEB A;  1EX4 A;  3PVL A;  2MOX A;  1WX6 A;  1VQN T;  2JVV A;  2CZ6 B;  2C0O A;  3CPW P;  3PT9 A;  2OTJ A;  2D8H A;  1YNZ A;  2DXT A;  1VQL A;  2DET A;  1M90 C;  1PM3 A;  1R0B G;  1YN8 A;  1UE9 A;  4ELY C;  1PNJ A;  5HCK A;  3A8L B;  3BY7 A;  5A0D A;  2KRM A;  2V26 A;  2W0Z A;  1OPL A;  1M5Q 1;  1QLY A;  5LJ5 e;  2R5M A;  2C1L A;  3BW1 A;  2GNC A;  2JM9 A;  2AHJ B;  2KRO A;  4HCZ A;  1LCK A;  2QDL A;  3OYL A;  5CK9 A;  1YI2 A;  1KHI A;  3TSW A;  2QGG A;  4XU1 A;  2BKD N;  3I56 A;  5A0L A;  2HNI A;  3OYY A;  4GY5 A;  4PK4 A;  4A63 B;  4MZT A;  2ZAE A;  4AMC A;  3M58 A;  1WGS A;  5D7U A;  4J9F A;  4BDY A;  1M27 C;  3LX7 A;  4M4Z A;  2EGC A;  1VYV A;  2E3H A;  3PVQ A;  2XD0 A;  1M1F A;  4E2F B;  4XTX A;  4C5H A;  5GAO n;  5EC7 A;  1OI1 A;  4C5E A;  1UUE A;  4M75 F;  2XG8 D;  4V2S A;  4M77 C;  3X20 B;  3VS5 A;  2ZPB B;  1VQP Q;  1EZZ B;  3NPF A;  5LL6 S;  2K57 A;  5LJ3 j;  4ORZ A;  2KR3 A;  1N8R U;  3CCQ A;  3RKX A;  1DJ7 B;  2YT6 A;  3BE3 A;  3A8H B;  4A53 A;  4K11 A;  1OZ3 A;  4OB2 B;  2NWM A;  4JLI A;  2J06 A;  2O88 A;  1IZ6 A;  2GTJ A;  2E65 A;  3D7S B;  2YLC A;  2LT1 A;  1MNE A;  4IIO A;  3I5S A;  2ENM A;  1S1N A;  3CXC P;  2P4R A;  4E7J A;  3MEW A;  1KD1 C;  3M53 A;  4M7A C;  1KIK A;  2JT4 A;  2DRK A;  3ER0 A;  4N0A C;  1X69 A;  3EH1 A;  2KDS A;  5GAN e;  2GQV A;  1VOM A;  3M56 A;  1SPK A;  1N9S A;  2QTV A;  1TSF A;  2QQ9 A;  1VYU A;  1ZBJ A;  1VQ9 A;  3JCM V;  4OF1 A;  2P4T A;  2AIR B;  3OBW A;  4F04 B;  4GLM A;  5GAN f;  3QII A;  4M78 D;  1V1C A;  1NLP C;  4LNP A;  1WIE A;  2EGE A;  3CCS A;  4MMK A;  2YDL A;  2EQI A;  1WQ7 A;  3G71 T;  3QYG B;  1VQN Q;  2CS7 A;  4A4K A;  2XHC A;  4BY6 B;  1N27 A;  3EG0 A;  2K4Y A;  2K79 A;  4KGX B;  1QVG S;  4PJL A;  2CYZ B;  2R58 A;  2K9G A;  4J6Y A;  1WA7 A;  4IIM A;  3QDF A;  3RIR A;  4M7D A;  5L23 A;  3EGX B;  4Y28 E;  3CD6 Q;  3JCM g;  4KRT A;  1K9M R;  4DEX A;  3HQF A;  2GF7 A;  4N4H A;  1VIF A;  2BIV A;  3IQL A;  2F69 A;  1YBY A;  4PJN A;  2E64 A;  1WID A;  2CH4 W;  2CZ7 B;  1VQM T;  4HVW A;  3OYD A;  2DZC A;  1N0E A;  3CCE A;  1K73 C;  1MV0 B;  3LWH A;  2HBW A;  3CBP A;  3OYB A;  2RHI A;  2DIQ A;  3NTH A;  5CQY A;  2IVW A;  2DXC A;  4Z88 A;  5FU7 C;  3OYN A;  4EIK A;  1UEC A;  1YCS B;  3CMA T;  1U1S A;  2RI3 A;  2P0P A;  1VQ5 T;  2LJ1 A;  1JJ2 A;  1OU8 A;  3RES A;  3V7S A;  2QGF B;  2PNI A;  1B7T A;  3PE0 A;  3J80 E;  4M77 B;  3WVE B;  3CCM T;  4M75 A;  1YFN A;  1PKS A;  4C8Q E;  1ACM B;  5C6S A;  1GBQ A;  5FU6 C;  1U1T A;  1B3Q A;  2PUO B;  1NM7 A;  4BI4 A;  3TSZ A;  2VUB A;  2RA2 A;  3VUZ A;  4PJO E;  4LN2 A;  5LJ3 e;  2K3Y A;  4JZ4 A;  1CKA A;  3G7Z A;  3DLL A;  5CKE A;  1ZSZ C;  1TWB A;  4O6J A;  2B8A A;  1VQO T;  2K2V A;  1I5O B;  5GMK m;  2HDA A;  2K3B A;  1RAF B;  2HCK A;  1ARK A;  4XAX B;  2X4J A;  2KI7 A;  4J7F A;  2EJG A;  2CRE A;  4C92 G;  3C12 A;  2DRM A;  2VAS A;  1BCM A;  3S3O A;  5HK3 A;  2IIM A;  1MMN A;  2EAY A;  2H8H A;  3NFC A;  3H41 A;  3G71 Q;  2X4X A;  1JXO A;  1XJW B;  3LGL A;  4XQ3 A;  5I2S A;  1WHH A;  4ANJ A;  1AD5 A;  1BB9 A;  1D3B A;  1KD1 U;  1JU5 C;  1WFW A;  3FLG A;  4J9D A;  4EMK B;  4JJN K;  4QT7 A;  4DOV A;  3I55 A;  1BI2 A;  3VV0 A;  1I07 A;  1VQK Q;  4EDU A;  4P5N A;  4JJD A;  5D6W A;  2EJ9 A;  1YIT Q;  1WHL A;  5HK0 A;  5FWB A;  2ZGW A;  4IUT A;  2MPX C;  1HXD A;  5GAO r;  4N4I A;  1ZLM A;  5CKH A;  1ZX6 A;  5GAM f;  3SD4 A;  4KBM B;  2KY9 A;  2O01 E;  3KFV A;  1GFD A;  2ZZD A;  4RTW A;  4L5G A;  1M1G A;  1UHC A;  3U23 A;  3NMZ C;  4DBH A;  3GOX A;  3G4S Q;  3CCU A;  4R55 A;  2EWN A;  2DXU A;  5I11 A;  4GBQ A;  2A37 A;  2P0K A;  5KYW B;  4M78 G;  1QVF S;  1VQ4 A;  2A36 A;  3E19 A;  2DZ9 A;  4J9E A;  1FMK A;  4LDX A;  2XK0 A;  5LJ5 j;  3RKY A;  2GTO A;  5IN1 A;  2RQT A;  4ME7 A;  1AOJ A;  2QDY B;  2DNU A;  3KUF A;  3CMA Q;  5KYX A;  3PIP A;  3EGU A;  3QDR B;  4M7D D;  1IO6 A;  3HP9 A;  4RG2 A;  4NS5 A;  4C8Q F;  2DL3 A;  1VQ8 Q;  4BB7 A;  3CME T;  3MEA A;  3I35 A;  2FRW A;  3INZ A;  1KHC A;  2ZPI B;  4AG2 C;  3UA6 A;  3VS6 A;  2D1X A;  4N0A A;  5J39 A;  3OS5 A;  1YHQ T;  3EGD B;  1D1A A;  2L5Q A;  1M90 R;  3CQT A;  4CC3 A;  5KYY B;  1UGR B;  2D8J A;  3JCM X;  4FSX A;  1IGQ A;  2CP7 A;  2MI6 A;  3RNJ A;  2ED1 A;  3GIB A;  3CCJ A;  4LD6 A;  2PVD B;  2E70 A;  2MK5 A;  1RAD B;  2EGA A;  1QKX A;  2KSS A;  3H0H A;  1YEL A;  4KGZ B;  1X43 A;  3JB9 D;  2FEI A;  4RCC A;  3EG9 A;  3CC4 T;  4NOY A;  1RAE B;  1NPP A;  4M75 C;  3UWN A;  2MAM A;  1M1K C;  4M7D F;  5KYN A;  4BDZ A;  1E6G A;  3MP8 A;  4E6R A;  4F7U A;  1RAC B;  1YIT T;  4AT1 B;  4PJO A;  1SG5 A;  4XU3 A;  1RUW A;  3A8O B;  2MYS A;  1S72 A;  1C6V X;  1IXD A;  1NZ9 A;  1G2B A;  2DL8 A;  2YRV A;  1U3O A;  3JCM h;  1W2B A;  2FPF A;  4R56 A;  5D6Y A;  2Y90 A;  2OI3 A;  1TUC A;  4RMO A;  3RER A;  2D0N A;  3CEY A;  3EG3 A;  1MV3 A;  4RCB A;  3BFM A;  2BZ8 A;  4JUV A;  1K1Z A;  3CCQ T;  4Y92 A;  3EHQ A;  2OTJ T;  1ABQ A;  4M77 E;  2QI2 A;  2DM1 A;  1N8R R;  1H3H A;  1WXB A;  4XU0 A;  2LX9 A;  2QQS A;  3CCM Q;  1N0F A;  4OMQ A;  2D0Q B;  5DM7 R;  1A0N B;  3MET A;  4OB0 B;  1FMW A;  1G83 A;  4ESR A;  4TVR A;  1BU1 A;  1SRM A;  1Q82 U;  2DYB A;  2F1L A;  2DIG A;  1YJN Q;  3HRS A;  3L42 A;  4XTV A;  3OYC A;  1V76 A;  1UHF A;  1QP3 A;  5GJW B;  1PD0 A;  3CC7 A;  2E3I A;  2YUO A;  5LJ5 f;  3CCR Q;  3EGD A;  3QYH B;  2BUD A;  2BZY A;  2YRC A;  3M5A A;  4RKU E;  2AZV A;  3QWY A;  3M57 A;  4YTL A;  4E7I A;  2FRY A;  1BBZ A;  3QZ5 B;  2QQR A;  2E41 A;  2LQN A;  3EFO B;  4BE0 A;  3CC2 A;  1QVG A;  2KNB B;  2EPD A;  3PIO A;  1YHQ Q;  4PL6 A;  3VS3 A;  1OU9 A;  4F14 A;  2BE7 D;  2H3J A;  4HCK A;  3RBB B;  3O5Z A;  1WDX A;  2FZG B;  2QQB A;  2E1H A;  4RG8 A;  2YUP A;  3OSV A;  1IRX A;  4D8D A;  4OB1 B;  4BAC A;  1VQO A;  4OMN A;  3OW2 A;  2GFA A;  2DL7 A;  2F5T X;  3LW5 E;  5CKB A;  4JJC A;  4PJO B;  2P0Q A;  1VQ4 Q;  2A28 A;  2EIF A;  1VQK T;  1UDL A;  4EMK C;  3JAM E;  4C8Q B;  4DBR A;  2DVJ A;  3MP6 A;  3JSC A;  4PKC C;  2KYM A;  4KUI A;  4PJO D;  2FO0 A;  1ZUY A;  1I81 A;  3MJX A;  1AWW A;  3QKJ A;  1KQS S;  4DOW A;  3CD6 T;  5CVI A;  2DX1 A;  1VYT A;  3E9G A;  1WPY A;  3F70 A;  3PFS A;  5GMK e;  4C92 C;  4M7D G;  5D6X A;  2EYW A;  2V8K A;  3L2U A;  3OYJ A;  1KSW A;  2DD5 A;  4JRP A;  4XTU A;  5GAN 8;  2RI2 A;  1KC8 R;  4IUU A;  2RD1 A;  2M02 A;  2FPD A;  3AT1 B;  1QVP A;  2MCN A;  4AFS C;  4EPC A;  1JJ2 P;  3LH5 A;  2NUT A;  2GQI A;  1WXU A;  1VQK A;  4C92 F;  3V8K A;  3CCV T;  4AFQ C;  1TU0 B;  3SB2 A;  2CT4 A;  2ROT A;  3L1A A;  4E7S A;  5CKD A;  4CC2 A;  2C06 A;  3CCR T;  2COW A;  3MHX A;  1LJO A;  2JMA A;  1YI2 T;  5KYU A;  3CME Q;  3OYA A;  5DY9 A;  2JUF A;  4FSS A;  2PU9 B;  4F7U E;  2KE9 A;  2OAU A;  4MZM A;  2QEX Q;  4FT2 A;  1OEB A;  5GAN 5;  4OGE A;  2LTO A;  5FWC A;  2L3R A;  2QA4 Q;  2DTH A;  1NA6 A;  1TXQ A;  2O2O A;  5LJ3 f;  1Y07 A;  2L3S A;  4EMK A;  3R6O A;  3EG9 B;  4EMG A;  1AWX A;  1YJW T;  2JOY A;  3C0C A;  4LUD A;  4C5I A;  1K73 U;  4BUG A;  2KXC A;  1K73 R;  1K0S A;  3L2Q A;  3EFR A;  1Q82 C;  4PLI A;  5HY6 A;  2LMJ A;  4JZ3 A;  4A4F A;  4DBQ A;  5KCH A;  4C92 A;  3MKD A;  4OGC A;  4FU6 A;  3X28 B;  4IKF A;  2K7A A;  3M0S A;  3NGP A;  3M0T A;  3RR6 A;  4UC4 A;  2ZCF B;  2RO0 A;  1YJW A;  2PTK A;  3A8G B;  2K2M A;  3V7C A;  1TUG B;  3CC7 Q;  2RHX A;  4CI0 C;  5GMK i;  3I9Q A;  3RKW A;  4DEY A;  1SEM A;  2EVR A;  3EG1 A;  3FIF A;  1I4K 1;  5KYW A;  3OS0 A;  1MGQ A;  3S6W A;  2HL3 A;  1UGV A;  1N8R C;  2XDD A;  2O4X B;  5KCO A;  2DIL A;  3C95 A;  5GAN j;  4D8K A;  1SHG A;  2CZ0 B;  3M0U A;  3RUX A;  4A4E A;  3CD6 A;  4B9X A;  2EYY A;  2JZ2 A;  3C4S A;  2COZ A;  4HVV A;  3H6Z A;  4PJJ A;  1KG1 A;  1PKT A;  2VC8 A;  2EFI A;  4B9W A;  2MF2 A;  1KQS P;  3SEM A;  1Y71 A;  2IPO B;  4RTX A;  2EQJ A;  3REA B;  2BE9 B;  4M7A D;  1Q81 R;  3A1P A;  2ROL A;  1GCP A;  2RQV A;  1Q81 U;  2RHY A;  2M1H A;  3VYH B;  5LJ5 g;  3OA6 A;  1VQL Q;  5FRN A;  4M78 C;  5KYY A;  2JJ9 A;  1RAG B;  1I1J A;  4M78 A;  1XNI A;  2FZK B;  3OSS C;  3PNW C;  4XTW A;  1FYN A;  4JLG A;  1I0C A;  1M4Z A;  1VQ6 A;  2K5F A;  1WI7 A;  4PJO F;  1NPR A;  2EJF A;  4GLK A;  4I1K A;  4FYX B;  3VRY A;  3P8H A;  3HRT A;  4M77 F;  1G5V A;  4II1 A;  3JCM J;  1MHN A;  3VUB A;  2DK3 A;  3OS1 A;  1G3S A;  4X9D A;  2ECZ A;  1M3A A;  1VQ9 T;  2ED0 A;  3DB3 A;  4L6V 5;  1KK7 A;  2A0F B;  2OTL Q;  3TEE A;  4JS5 A;  1J3T A;  1N9R A;  1TH7 A;  1PCX A;  2DF6 A;  3CCM A;  3L2V A;  2X35 A;  1PG5 B;  2QQA A;  1QWF A;  4PNO A;  4J9I A;  3ZI5 A;  2KBT A;  2GCX A;  4Z02 A;  1VQ5 A;  1PRM C;  2XID A;  3J7A F;  4XK8 E;  1WJQ A;  2PUK B;  1PSF A;  3ASK A;  1EFN A;  1QWE A;  2CZ1 B;  2CP3 A;  2VB6 A;  4M7D E;  4XTY A;  2DKG A;  1KQS A;  4HT8 A;  2J7I A;  3MEU A;  1MMA A;  1OPK A;  2DLP A;  3QPH A;  8AT1 B;  4OMO A;  3CC7 T;  1X27 A;  3CCL A;  4F7U G;  4WTO B;  1JXM A;  5I21 A;  1AZE A;  2DMO A;  1K9M U;  2HMA A;  4PJO G;  1R8O B;  1KFZ A;  5IT9 E;  3VJP A;  2K5L A;  3CBO A;  2YUN A;  3LYI A;  1U06 A;  4CC4 B;  1YJ9 T;  2FPE A;  2V8I A;  2X3W D;  1QQJ A;  5GAO m;  2DBK A;  3FRN A;  1W4S A;  5CKF A;  2RHU A;  1ZUU A;  1VUB A;  2DL4 A;  2X4Y A;  4QVC A;  2W10 A;  2CP2 A;  2LJ3 A;  1JO8 A;  1FMV A;  5ECA A;  5GAN 2;  3ZBD A;  1M3C A;  4AG1 C;  1HSQ A;  1T0H A;  2DA9 A;  2RH2 A;  2DL5 A;  1Q95 G;  3L2W A;  1QKW A;  2QK0 A;  3G4S A;  1JB0 E;  1AWO A;  2RPN A;  2XI9 A;  3TVT A;  3JB9 J;  4VUB A;  1YIT A;  1NJI C;  3LH0 A;  1M2V B;  1HJD A;  2J05 A;  3KXT A;  3GNF B;  5KYU B;  3AHU A;  2WSC E;  1VQ8 T;  3FC3 A;  1YI2 Q;  1WXT A;  4RTZ A;  1AHJ B;  2K5I A;  1WHG A;  3TQ7 P;  5GAN d;  4Z8A A;  3G6E A;  1VQ9 Q;  2DBM A;  2DE0 X;  1VQ7 Q;  1WLP B;  3HSB A;  1UB4 A;  1X2Q A;  1WQW A;  3FEO A;  2JS2 A;  4B6M A;  4FCY A;  3NTI A;  2EW3 A;  3WVD B;  4PJO C;  3O8V A;  2HQE A;  3EAE A;  1H8K A;  3VRZ A;  1RAH B;  3LGF A;  2O31 A;  4M75 E;  3UDC A;  3CXC A;  1LPL A;  2EYZ A;  5GAM g;  4C92 D;  2OTL T;  2DJQ A;  1F1B B;  1RAI B;  1OX8 A;  2VGN A;  1T0J A;  4M7D B;  2L2P A;  3JCM P;  1GCQ C;  1WJR A;  3P8B B;  3DB4 A;  2F2V A;  5LJ5 d;  1HD3 A;  1NE8 A;  5GAO l;  1RLP C;  2LX7 A;  1TTH B;  2VXE A;  1YCY A;  2HBP A;  3RMQ A;  2JS0 A;  4KH1 B;  2E6N A;  2D9T A;  3G6E T;  5DLQ E;  1BK2 A;  2DJZ A;  1VQ4 T;  4LD9 K;  2DTI A;  1WZO A;  2CDT A;  3UPU A;  2VXF A;  3PTA A;  1M9S A;  1D1B A;  1BI3 A;  2CGH A;  3Q1J A;  1VQ6 T;  2FG0 A;  3VS0 A;  3CCU T;  1RAA B;  2KVQ G;  2LP5 A;  2RHZ A;  3VS4 A;  4E7L A;  2OJ2 A;  4FW2 A;  4JRK A;  2G6F X;  2KK4 A;  3SWN A;  2EQM A;  5FU6 B;  5LJ3 g;  1OV3 A;  2BTT A;  4LUE A;  2ABL A;  2ZPF B;  1WNL A;  4FIB A;  5IXB A;  2V8J A;  3CPW A;  5AT1 B;  1HYO A;  1ABO A;  2DEU A;  4HT9 A;  2IG0 A;  5A2Q E;  2FVU A;  1K76 A;  3JCM W;  2OTJ Q;  5GAM h;  4HVU A;  3MCA B;  1ZUK A;  3HKS A;  2EYX A; 
#chains in the Genus database with same CATH homology
 1I81 A;  4XU2 A;  3MEV A;  1P92 A;  3QKJ A;  2VYT A;  1H64 1;  4DOW A;  5GMK l;  1KQS S;  1VQL T;  1M1K U;  2WAC A;  1QVF A;  3CD6 T;  5CVI A;  3CCS A;  4MMK A;  3L2R A;  1G3T A;  1WQ7 A;  3G71 T;  2Y4X A;  3E9G A;  1WPY A;  3F70 A;  3PFS A;  3QYG B;  1RL2 A;  5GMK e;  4C92 C;  5CAI A;  4M7D G;  3JCM f;  2CS7 A;  3QG1 A;  4A4K A;  3OYI A;  2XHC A;  5D6X A;  3VKI A;  2V8K A;  4F7U B;  4Y91 A;  1B34 A;  3VU3 C;  4BY6 B;  5GMK h;  3L2U A;  1N27 A;  3OYJ A;  3OYF A;  3PMI A;  2DD5 A;  2K4Y A;  2MWO A;  3ME9 A;  4JRP A;  2ZPH B;  3M59 A;  4XTU A;  5GAM d;  5GAN 8;  2RI2 A;  1X6O A;  1QVG S;  2QA4 A;  3URG A;  4IUU A;  2RD1 A;  3HRU A;  2CYZ B;  2R58 A;  4J6Y A;  1EIF A;  4ZGD B;  1QVP A;  4LDY A;  4EPC A;  3RIR A;  4M7D A;  4D6W A;  1X01 A;  4M7A B;  1V29 B;  1D3B B;  1G3W A;  4Y28 E;  2Y4Y A;  3JCM g;  4QVZ A;  4OVA A;  1QP2 A;  3HFN A;  3ZEH A;  3HQF A;  2GF7 A;  1VQK A;  4C92 F;  2L8D A;  3V8K A;  1ZQ1 A;  3CCV T;  2FYK A;  4N4H A;  1VIF A;  2BIV A;  2RJD A;  2F69 A;  3SB2 A;  1YJN A;  1YBY A;  1Q7Y C;  2E64 A;  3L1A A;  1WID A;  5CKD A;  1VQ7 A;  1VQM T;  2CZ7 B;  2PVG B;  3OYK A;  3CCR T;  2QEX T;  3MHX A;  3OYD A;  3OW2 S;  2C06 A;  1LJO A;  2DZC A;  1YI2 T;  3CCE A;  1K73 C;  2LQK A;  1XOV A;  1ZHI A;  4OP0 A;  3LWH A;  3CBP A;  2HQX A;  4N4G A;  3OYB A;  2RHI A;  2DIQ A;  3OYA A;  5DY9 A;  3NTH A;  3CME A;  3DKM A;  2JUF A;  3M55 A;  2I2L A;  3SWN C;  5CQY A;  2IVW A;  2DXC A;  2PU9 B;  1FX7 A;  5FU7 C;  2OAU A;  4MZM A;  4F7U E;  3OYN A;  4FT2 A;  4J6W A;  5GAN 5;  3CMA T;  4OGE A;  1U1S A;  2LTO A;  2L3R A;  2RI3 A;  1LNX A;  2P0P A;  2DTH A;  3DLM A;  4QVD A;  2LCC A;  3LLR A;  5CR2 A;  1VQ5 T;  4L59 A;  2DTO A;  1JJ2 A;  3GF5 A;  5A0G A;  3RES A;  4ZGE B;  2E12 A;  1Y96 A;  1NA6 A;  3V7S A;  4C8Q D;  5LJ3 f;  4C8Q G;  1Y07 A;  4ZGJ B;  1U8R A;  2DD4 A;  3JB9 I;  3J80 E;  4M77 B;  1O75 A;  3WVE B;  4EMK A;  3CCM T;  3R6O A;  3G4S T;  4E7H A;  3E9F A;  4DQ2 A;  4M75 A;  4EMG A;  3TRE A;  3BDL A;  4C8Q E;  3M9Q A;  2JOY A;  5C6S A;  4ZTF A;  1YJW T;  5FU6 C;  4C5I A;  1K73 U;  4ATO A;  1U1T A;  4BUG A;  3OYH A;  2PUO B;  3OBY A;  5KE3 A;  1RI0 A;  4JS4 A;  5CIU A;  4BI4 A;  3L2Q A;  5GAM j;  2XIC A;  2VUB A;  3HFO A;  3EFR A;  3QJY A;  2G3R A;  2YLB A;  2ZPG B;  3CCV A;  2VGM A;  2RA2 A;  3VUZ A;  3N5B B;  4PLI A;  5GAN g;  1Q82 C;  5HY6 A;  5LJ3 e;  4PJO E;  2K3Y A;  4A4F A;  2JTM A;  4C0Z A;  4C92 A;  5KCH A;  3QSU A;  2JTF A;  1KQ2 A;  1UGP B;  2F5K A;  2XDP A;  3G7Z A;  4M75 G;  4OGC A;  3E1S A;  3OYG A;  5CKE A;  3DLL A;  2A3L A;  4FU6 A;  2EKO A;  4J5Y A;  3QHS A;  3X28 B;  4IKF A;  5AYF A;  1BI0 A;  4O6J A;  2B8A A;  1VQO T;  2K2V A;  4E7K A;  4UC4 A;  2ZCF B;  4PLL A;  1YJ9 A;  4JRI A;  5GMK m;  3OS2 A;  4QQ6 A;  1W2B S;  2RO0 A;  1YJW A;  2X4W A;  4E47 A;  3CBM A;  4IUP A;  3GLX A;  1G3Y A;  1UEB A;  2FB7 A;  3A8G B;  4XAX B;  3VYG A;  2X4J A;  3V7C A;  4J7F A;  3JCM c;  1QW1 A;  2EJG A;  1IRE B;  1LOJ A;  2RHX A;  1UGQ B;  3UT1 A;  4C92 G;  4M78 E;  4CI0 C;  5GMK i;  3RKW A;  4M7D C;  4FL6 A;  4ZN3 A;  5I2M A;  3C12 A;  2XKO C;  2ZPE B;  3FIF A;  4IUR A;  3QZ9 B;  3S3O A;  1BI1 A;  1I4K 1;  4X34 A;  4M7A F;  5CQX A;  5HK3 A;  1KC8 C;  3OS0 A;  2EAY A;  2LQ8 A;  1MGQ A;  3NFC A;  3S6W A;  2X4X A;  2RJC A;  1H3Z A;  3SFM A;  1N8R C;  2XDD A;  2O4X B;  5KCO A;  3HPW A;  3GNG A;  3OMC A;  3LGL A;  3C95 A;  1KQ1 A;  4XQ3 A;  3ZFJ A;  2L89 A;  5GAN j;  5I2S A;  5GAN 7;  3QBY A;  4A4H A;  2CZ0 B;  3RUX A;  1OZ2 A;  2M16 A;  1D3B A;  2HD0 A;  4A4E A;  5GAN h;  1KD1 U;  3CD6 A;  3FLG A;  4LDW A;  2GFU A;  4B9X A;  4EMK B;  4JJN K;  2JZ2 A;  3C4S A;  3JB9 F;  4DOV A;  4MDX A;  4M75 B;  3H6Z A;  4JDS A;  1OYX A;  5KH6 A;  3I55 A;  1BI2 A;  1YHQ A;  3T9N A;  3VV0 A;  1KG1 A;  2VC8 A;  2EFI A;  2EQK A;  4B9W A;  2MF2 A;  4MDW A;  5J3B A;  4P5N A;  1PSE A;  2JN0 A;  4EDU A;  4ZN1 A;  5D6W A;  5FRM A;  1FXX A;  1Y71 A;  3X26 B;  2EJ9 A;  4M78 F;  2EQJ A;  4WF2 A;  3KBG A;  4EMH A;  5HK0 A;  3CC2 T;  2ZGW A;  4IUT A;  4A4G A;  3CXC S;  2R57 A;  4M7A D;  2XDB A;  4C8Q A;  4BI8 B;  1HXD A;  4C92 B;  1Q81 U;  2RHY A;  2M1H A;  3VYH B;  3NTK A;  4ELZ C;  5LJ5 g;  3OA6 A;  5GAO r;  5FRN A;  4M78 C;  4N4I A;  5CKH A;  3P8D A;  1VQP A;  3M4Y A;  5GAM f;  3SD4 A;  2OTL A;  4J8O A;  4KBM B;  4M75 D;  3OB9 A;  2KY9 A;  1FWZ A;  2WSF E;  2O01 E;  3JCM e;  5FLX E;  2QTX A;  3A5Z B;  5FU7 B;  2KMT A;  4M78 A;  3MP1 A;  1XNI A;  4C5G A;  1JBM A;  3OSS C;  2ZZD A;  2RB6 A;  3PNW C;  4XTW A;  5LJ3 d;  4BI3 A;  4JLG A;  4L5G A;  1M1G A;  1M4Z A;  3QXE B;  4O5V A;  1VQ6 A;  5GAN 3;  2K5F A;  2A7Y A;  4NL3 A;  2VV5 A;  5LJ5 h;  2NLU A;  4PJO F;  4OB3 B;  2D6F A;  1NPR A;  3QJ6 A;  3BDU A;  3GOX A;  3CCU A;  2XU8 A;  2EJF A;  3JB9 G;  1VQN A;  4GLK A;  2FL7 A;  4M77 A;  5EG2 A;  1ZBX A;  4R55 A;  4I1K A;  2EWN A;  1I8F A;  5DLO A;  2DXU A;  4LDU A;  3I56 T;  2DAQ A;  3P8H A;  4IUQ A;  3HRT A;  2P0K A;  4HCB A;  4M77 F;  1NJI U;  4KT0 E;  1G5V A;  2YHT A;  4M78 G;  4A54 A;  4II1 A;  3JCM J;  1QVF S;  1MHN A;  3VUB A;  1VQ4 A;  4Q5W A;  2K3X A;  2DZ9 A;  2R5A A;  3E19 A;  1Q81 C;  2DK3 A;  5L8R E;  3OS1 A;  2JNG A;  4LDX A;  2XK0 A;  5LJ5 j;  3RKY A;  1G3S A;  2E6Z A;  4X9D A;  5GAO q;  5IN1 A;  4M77 D;  4ME7 A;  1VQ9 T;  1VIE A;  2QDY B;  3KUF A;  3DB3 A;  4L6V 5;  3S3N A;  1VQM A;  1YIJ T;  3PIP A;  2DEQ A;  3QDR B;  4M7D D;  4KUD K;  1N6A A;  4MZP A;  3HP9 A;  3CCE T;  4RG2 A;  4NS5 A;  4C8Q F;  3CPF A;  3TEE A;  4C0F A;  4JS5 A;  3TU4 K;  4J6X A;  2PQW A;  1N9R A;  4BB7 A;  1TH7 A;  4F7U F;  1UGS B;  2RM4 A;  3CCS T;  1K8A U;  3CME T;  3CCM A;  3MEA A;  3HL8 A;  3L2V A;  4BD3 A;  2X35 A;  4FT4 A;  3INZ A;  2QQA A;  1KHC A;  2ZPI B;  2LC4 A;  3LWI A;  3MO8 A;  3QO3 A;  4PNO A;  2EQU A;  4N0A A;  3CCL T;  5J39 A;  1Q7Y U;  1WJS A;  3OS5 A;  3I55 T;  1YHQ T;  2GCX A;  3FJP A;  4Z02 A;  2LVM A;  1VQ5 A;  1M8V A;  2XID A;  3J7A F;  4ZTJ A;  4XK8 E;  1BIB A;  1WJQ A;  2L5Q A;  2LDM A;  2PUK B;  3GPL A;  1UGR B;  2DO3 A;  3EFS A;  4BE1 A;  1PSF A;  4C92 E;  4IUV A;  3JCM X;  3ASK A;  4J83 A;  4FSX A;  2O4X A;  1SSF A;  1BYM A;  3FDR A;  2MI6 A;  1Q86 U;  3GIB A;  3CCJ A;  3M4G A;  2RI5 A;  2CZ1 B;  2PVD B;  3PMT A;  2E70 A;  4LD6 A;  3JRZ A;  3V8L A;  1KC8 U;  4M7D E;  1Y96 B;  2DKG A;  4XTY A;  4CRI A;  1KQS A;  2DPP B;  4HT8 A;  3MEU A;  3X24 B;  1VQP T;  1X75 C;  2KSS A;  3QPH A;  1K8A C;  3CMA A;  5IAY A;  3H8Z A;  2CKK A;  2WSE E;  3OYM A;  3JB9 D;  1YEL A;  4RCC A;  3CC7 T;  3CCL A;  4DA4 A;  4F7U G;  5I21 A;  3JCM Q;  2RK1 A;  3CC4 T;  4NOY A;  1K9M U;  1NPP A;  4M75 C;  5GAN 4;  3UWN A;  2MAM A;  1R8O B;  1XQH A;  3PGG A;  4PJO G;  1YIJ A;  4NL2 A;  1JJ2 S;  5IT9 E;  1XTD A;  1M1K C;  3VJP A;  2M0O A;  4M7D F;  3FB9 A;  2DXB A;  3JCM d;  2K5L A;  3CBO A;  3CCR A;  3LYI A;  4BDZ A;  4BE2 A;  2RK2 A;  2M9U A;  4C0D B;  4C8Q C;  4M77 G;  3CCJ T;  5KE2 A;  2QXF A;  1YJ9 T;  4QQD A;  3V8J A;  2MMP A;  2V8I A;  2LNV A;  3MP8 A;  2LRQ A;  4F7U A;  5GAO m;  3FRN A;  1W4S A;  3OY9 A;  5CCA A;  1Y7X A;  5CKF A;  2RHU A;  1M90 U;  1VUB A;  2X4Y A;  4M78 B;  1YIT T;  4QVC A;  4PJO A;  3JB9 H;  3J81 E;  4XU3 A;  5GAN 2;  3ZBD A;  3A8O B;  1S72 A;  2RH2 A;  1VQN T;  2JVV A;  3RMS A;  2CZ6 B;  3L2W A;  1NZ9 A;  3PT9 A;  2OTJ A;  4KUL A;  2KQW A;  3G4S A;  1JB0 E;  2YRV A;  2DXT A;  1VQL A;  5J26 A;  2QA4 T;  1M90 C;  4HA8 A;  3JCM h;  5GAO p;  1W2B A;  3S3M A;  2DVE A;  2PVO B;  4ELY C;  5A0D A;  3A8L B;  3BY7 A;  5C0M A;  3OYE A;  4R56 A;  5D6Y A;  2XI9 A;  3GP8 A;  3V7R A;  2Y90 A;  1M5Q 1;  1K9M C;  3JB9 J;  4VUB A;  3L2Z A;  4RMO A;  5CO7 A;  3CPW S;  5LJ5 e;  3CEY A;  1YIT A;  1NJI C;  3RER A;  2R5M A;  2E10 A;  3BW1 A;  4RCB A;  5M9O A;  3SDZ A;  3LH0 A;  2AHJ B;  3BFM A;  4QW2 A;  5GAN 6;  3KXT A;  1HK9 A;  3GNF B;  4JUV A;  2MWP A;  3AHU A;  4HCZ A;  3OYL A;  2WSC E;  3CCQ T;  1VQ8 T;  5CK9 A;  3FC3 A;  4HCC A;  5GMK j;  2OTJ T;  4X9C A;  4M77 E;  2QEX A;  2QI2 A;  1YI2 A;  1KHI A;  1BIA A;  4XU0 A;  1AHJ B;  4OMF B;  2K5I A;  4XU1 A;  2BKD N;  2LX9 A;  2QQS A;  3A8M B;  2KAF A;  5GAN d;  3I56 A;  3G6E A;  4C0G A;  2D0Q B;  3HSB A;  1UB4 A;  5A0L A;  1WQW A;  5DM7 R;  2EYQ A;  2HNI A;  3OYY A;  4HKE A;  4GY5 A;  3FEO A;  4M7A A;  4BY6 C;  4MZT A;  4JRQ A;  3MET A;  3M58 A;  3NTI A;  3SWN B;  4OB0 B;  3WVD B;  5HKC A;  3TCJ A;  4PJO C;  3O8V A;  3QUI A;  1WGS A;  2HQE A;  3EAE A;  4C0D C;  4TVR A;  1GXI E;  4BDY A;  1Q82 U;  1VQ8 A;  3LX7 A;  2DIG A;  3LGF A;  3HRS A;  3L42 A;  4M75 E;  4XTV A;  1JRI A;  1M1F A;  3UDC A;  3OYC A;  3CXC A;  2XD0 A;  4XTX A;  4C5H A;  1QP3 A;  5GAM g;  4C92 D;  5GAO n;  3X25 B;  2OTL T;  1OI1 A;  4C5E A;  3CC7 A;  4M75 F;  2XG8 D;  5LJ5 f;  4M77 C;  2VGN A;  4V2S A;  3X20 B;  4M7D B;  2ZPB B;  3JCM P;  5LJ3 h;  1WJR A;  3QYH B;  2BUD A;  3P8B B;  4MML A;  3C94 A;  3DB4 A;  3M5A A;  5LL6 S;  2K57 A;  5LJ3 j;  4M7A E;  5LJ5 d;  1S72 T;  4RKU E;  1NE8 A;  5GAO l;  1N8R U;  3M57 A;  4YTL A;  4E7I A;  3CCQ A;  4J7I A;  1DJ7 B;  3RKX A;  3QZ5 B;  2VXE A;  3A8H B;  1BKB A;  1YCY A;  4A53 A;  2FHD A;  2QQR A;  2E41 A;  2HBP A;  1OZ3 A;  4OB2 B;  3WXM B;  4JLI A;  4BE0 A;  3CC2 A;  3RMQ A;  1QVG A;  1IZ6 A;  2E6N A;  2D9T A;  3G6E T;  5DLQ E;  2DJZ A;  3PIO A;  2E65 A;  1VQ4 T;  2DTI A;  4PL6 A;  1B34 B;  4LD9 K;  2YLC A;  3UPU A;  2VXF A;  2LT1 A;  3PTA A;  1M9S A;  5GAM e;  2H3J A;  1BI3 A;  2CGH A;  3Q1J A;  1VQ6 T;  2HAX A;  4E7J A;  1KD1 C;  3MEW A;  3M53 A;  2QQB A;  4RG8 A;  2E1H A;  5FRO A;  1VQ7 T;  4M7A C;  3CCU T;  2E5Q A;  2KVQ G;  2RHZ A;  3OSV A;  1O9S A;  3HHT B;  4LDV A;  3ER0 A;  4N0A C;  4OB1 B;  4E7L A;  4JRK A;  4BAC A;  1VQO A;  2KK4 A;  3SWN A;  3OW2 A;  2EQM A;  2GFA A;  2KDS A;  5FU6 B;  5GAN e;  2F5T X;  2GQV A;  5LJ3 g;  3LW5 E;  3M56 A;  2ZPF B;  5CKB A;  1WNL A;  1N9S A;  4FIB A;  3G71 A;  1I5L A;  4PJO B;  2V8J A;  2P0Q A;  3CPW A;  2QQ9 A;  2RJF A;  2EIF A;  1VQ9 A;  3JCM V;  2LT4 A;  3CC4 A;  4HT9 A;  2IG0 A;  5A2Q E;  3JCM b;  1VQK T;  3OMG A;  4OF1 A;  2FVU A;  3JCM W;  2LCL A;  2P4T A;  2RJE A;  5GAM h;  4M7A G;  4EMK C;  3JAM E;  4C8Q B;  1YJN T;  3OBW A;  3MCA B;  1Q86 C;  4FM4 B;  3M54 A;  4QQG A;  3MP6 A;  3JSC A;  4PKC C;  3QII A;  5GAN f;  3HKS A;  4KUI A;  4PJO D;  3OQ5 A;  4M78 D;  4XTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...