4LDXA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1 (arf1) in complex with protomor-like sequence er7
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
341
structure length
332
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin response factor 1
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription/dna
total genus 75
structure length 332
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldxA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldxA02
1YELA 3HQFA 4LDWA 4LDYA 4LDVA 4LDXA 4LDUA 1WIDA 4I1KA 1NA6A
chains in the Genus database with same CATH superfamily
1QVGS 4QVZA 3BFMA 1QKXA 2RI2A 2O9SA 3FRNA 1FMVA 3A8GB 3CCLT 3CCQQ 1VQ6Q 3OYMA 3X25B 1GBQA 1TH7A 1YWPA 5KYWB 3MP6A 2KSSA 1BI1A 4M78C 2O2OA 2EYYA 2FRYA 3MO8A 3VV0A 1AZGB 1X2KA 1PC0A 2CZ1B 2MWOA 4OMPA 1E6GA 1K9MC 2DA9A 2DJQA 1I8FA 5FU6B 4XTVA 1H3HA 2KXCA 4K11A 3OYKA 4C8QE 2A7YA 4JJCA 2EFIA 2MAMA 2VXFA 1WHKA 5CIUA 1K8AU 2DMOA 2JTEA 2DIQA 3AHUA 2EJGA 3JB9D 1VQ8A 4OMMA 4XTXA 4RKUE 4HCCA 2PVDB 2FB7A 3JRZA 3JCMb 2LNHB 4N0AA 1HD3A 2DVJA 5I2SA 1AOJA 4E7HA 3UT1A 3ME9A 4OVAA 1K9MR 2PVGB 1X43A 2YRDA 4D6WA 4EIKA 4JRKA 4I1KA 2ESWA 4IKFA 2YHTA 4ANJA 1RABB 5KH6A 1M2OA 1SKUB 2KYMA 5GMKi 2GFUA 4PLIA 4GBQA 3OB9A 1EIFA 3CPWP 2YUPA 3HFNA 3JCMc 1LVKA 1JQQA 2GTOA 1F1BB 1RAFB 1SRLA 1M2VA 1NPPA 2FPEA 5KYUA 4XU1A 3OYDA 4IUPA 4E7IA 2Y4YA 2K6DA 4HT8A 1M90C 1OYXA 3N5BB 3V7RA 2KEAA 2HQEA 2ZCFB 4DA4A 2Z0WA 1WDXA 4M7DD 4RCCA 2M1HA 4M75G 1NLOC 3X28B 2V8IA 4A4EA 2ED1A 3M9QA 1UJ0A 1KC8U 2O31A 2QYZA 4HKEA 4C92C 1GXIE 1PG5B 2QDYB 5D6WA 4C8QA 2HEQA 3UWNA 4TVRA 1M90R 3FC3A 2FZGB 4DOWA 3VJPA 2XD0A 4FT2A 3REAB 2H3EB 2FZCB 4M7DB 1YIJQ 2E1HA 2A37A 4FL6A 1IGQA 4HVVA 1V29B 1QVFA 4OB3B 5GMKe 1D1AA 1YJNQ 2JVVA 1WJRA 2JS2A 4QQDA 4M77C 1NEGA 3BE3A 1OPLA 2DK3A 2EBPA 2DXTA 1N9SA 3OYIA 2ZPGB 1Y71A 3UDCA 4M7AG 1QWEA 1RAAB 1LNXA 1LOJA 2QA4T 1VQ4T 3CD6T 1YWOA 4C5IA 1B3QA 3GIBA 2J06A 3RNJA 1YCYA 1JB0E 2KRSA 1VQLQ 2OTLT 2AKLA 2EYXA 4J7FA 1R8OB 3CCJT 5GJWB 4CRIA 5EG2A 4PJMA 3JCMV 2AKKA 3RKXA 1AWJA 4ORZA 8ATCB 1YELA 3NGPA 4AFQC 2LX9A 1Q86U 3FDRA 2RF0A 3META 3MJXA 3ZI5A 4XTUA 4KRTA 4DBRA 1YI2Q 4J7IA 2VGNA 2QQAA 4Z88A 4FYWB 1S72Q 2DZCA 2XDDA 2E6ZA 3CCRA 1VQ9T 1N5ZA 1XQHA 3EH1A 2E65A 3JCMh 4ELZC 1K4US 3ZBDA 2V1RA 2DL4A 3WVEB 2HQXA 3QHSA 5IXBA 2CYZB 1KK7A 1R0CB 4PKCC 1QVPA 2P0PA 2O01E 3MHXA 4V2SA 1G3YA 4ZN1A 2EQJA 1O75A 2PQWA 4M78A 5KYYA 4HCZA 3CCUA 1WHHA 1JJ2S 3ZEHA 2ZZDA 1AVZC 1K0SA 3VS1A 3Q1JA 3OBYA 3VUBA 2DL8A 3M58A 2K3YA 3M0QA 2X3XD 3RMSA 4E6RA 2NLUA 1TTHB 2RK2A 3A1PA 4Y28E 3CCVT 2DILA 4JZ4A 2RQTA 1M2VB 4A63B 3SEMA 2IPOB 2F5KA 1TSFA 4RTXA 4PFZA 3OW2S 1OX9A 4E7JA 1TUDA 3TVTA 1VQOA 5CR2A 2ABLA 3JCMd 2ROLA 4C8QD 1YN8A 2V8JA 3M4YA 1ZLMA 2QK0A 5CKFA 2RN8A 4LXCA 3OS5A 1ZQ1A 5DY9A 1AWWA 1OV3A 3UA7A 5GAN2 4OGCA 1Y96A 4C0GA 1TG0A 3D7SB 2HKQB 4QQ6A 2KQWA 3LYIA 3I5SA 1KD1U 4PFOA 3I56Q 3GOXA 5FRMA 2DETA 4C8QB 1WHJA 1O9SA 4QVDA 5HK0A 4J9DA 4EMGA 3EG1A 2LNVA 4J9IA 3HKSA 4RMOA 4M7DC 5L8RE 1VQ6T 1QVFP 2ENMA 1ZUUA 2DPPB 1M3AA 3RUXA 5KE3A 3I55Q 2QGFB 1BYMA 3SB2A 4XAXB 2LX7A 4KH0B 2XMFA 2LJ1A 4AG2C 2DO3A 3CCMT 3OW2A 3L2WA 2DL7A 4OMFB 4PJLA 2E12A 2DL3A 3M57A 4C5HA 1GCPA 4JS4A 1FYNA 1KQSS 2EYWA 1YJ9A 5D6XA 2L3SA 2VUBA 1VQMA 4JPBW 2CH4A 8AT1B 4PK4A 1EFNA 4ESRA 3HRTA 1VQ7A 1AWXA 1VQ5Q 4X9DA 2RJEA 3G6EA 1LJOA 2XDPA 4XTZA 5FW9A 1OZ2A 3M0RA 3AT1B 5FU7C 3LH0A 2LQNA 3TU4K 1VA7A 1QP3A 4M78D 4M77A 2EGCA 3EFOA 3MEUA 3CC7A 3MP1A 1QMCA 3CC4Q 2KYBA 1N8RC 2K5LA 1MNEA 2K79A 1ZSZB 4PNOA 4A4KA 4KGXB 5GANe 2FZKB 1D0XA 3EFSA 4Y92A 1ARKA 4PJOE 4M78B 2DD5A 1YBYA 4Y91A 2E3IA 2KY9A 4N0AC 2D9TA 1KHIA 3LGLA 4C0ZA 1X6GA 2K5FA 1A0NB 3CXCA 2E70A 3ZL7C 5GAOn 2HSPA 2HZYA 2DD4A 3CCLA 3UA6A 2X4WA 3URGA 3S3MA 2GNCA 1VQPT 1YHQQ 3E9GA 3ER0A 5KCOA 3BW1A 3WVDB 1N8RR 1VQ4Q 5KE2A 2SRCA 5IN1A 1WQ7A 2RQVA 4MMLA 1N0FA 2OTLQ 2GQVA 4F7UF 3EGUA 3CCJQ 3RDVA 5FWBA 2KGTA 1MMNA 3V8JA 3JB9J 1YITQ 4QQGA 1K73C 1H641 1WXTA 2RM4A 4LDWA 3KFVA 3J81E 2NUPB 4RG2A 4C0DC 3CC2Q 1NYFA 3O5ZA 2GF7A 1KQ2A 4DEYA 5LJ5e 1T0HA 1UEBA 2F2VA 4RTYA 3P8HA 4LDUA 4KULA 2HL5C 4B6MA 1NJIU 1Y96B 4GY5A 3EG9A 1YJNT 2KNBB 1QQJA 5GAOm 4N4IA 3CCSA 2X4YA 1T3LA 4KGVB 2RJCA 3CCEA 2KMTA 2XHCA 1RAEB 1U8RA 1I4K1 4KH1B 2NUTA 5GAN5 2K4YA 2LMJA 1PSEA 4C8QC 4FIBA 1Q82R 3V8LA 2DYBA 3PIOA 1K73R 2MWPA 2HMAA 2EQIA 4C0FA 1VQLT 2CT4A 1UUEA 2L3PA 2OI3A 1BU1A 5I2MA 2JXBA 2J6KA 4HT9A 4Z89A 2JZ2A 3M0PA 2CH4W 3H9NA 2OJ2A 4PJNA 3NFCA 4PJOA 1WLPB 4M75F 2KR3A 3L2ZA 3R6OA 2P4RA 4ELYC 4FW1A 3LWIA 1TUGB 4B9WA 1ZBXA 5FROA 2X4XA 5CKHA 3CCVQ 1BCMA 1M27C 4MZMA 1S72T 2KK4A 4A4HA 2CP7A 4LDVA 2EPDA 4M77D 2HBWA 4XU3A 2QQ9A 4C92F 2E10A 3OQ5A 3OMGA 3QO3A 2BIVA 2HNIA 5FRNA 1G2BA 4FCYA 1W1FA 4ZGDB 1IZ6A 2D8JA 3LGFA 3BDUA 1K0XA 1SEMA 1VQNQ 2B86A 4M77B 5IT9E 2J7IA 2BZ8A 2AHJB 3H0FA 1WHGA 5J3BA 4JRIA 3HFOA 1CKBA 1R0BG 1OPKA 3M55A 1EZZB 2EYQA 1BCOA 3EH2A 1Q7YC 3NTKA 1ZSZC 2RQUA 1PSFA 2RHZA 2LQWA 3BDLA 4R0KA 2EVRA 3G7ZA 2QA4A 3CD6A 1X69A 4L5GA 4F17A 2DLPA 2FYKA 3E19A 5I22A 1T0JA 1LCKA 2KAFA 3CXCP 1W2BS 4DBHA 1NBEB 3CCMQ 3A8OB 1ZX6A 4M78G 2XU8A 1VOMA 1IHWA 5CAIA 2EIFA 2VYTA 1UGPB 3JAME 1BI2A 3CMEQ 1Q7YR 2X9HA 4JJDA 4FSSA 2QDLA 3CEYA 3I56T 2DTIA 1WXBA 2LTOA 2YWWA 2RHYA 1W6XA 2RO0A 1M1KC 5EC7A 2CS7A 1VQ9A 1WZOA 1SPKA 2KROA 2L3QA 2MK5A 4RTWA 4FU6A 4F7UG 2LDMA 2C06A 3HP9A 3NTIA 2JJ9A 5IHKA 4AT1B 1QVGA 2KBTA 3EG9B 3I55T 1PD1A 1G8XA 1VYTA 2BTTA 1BIBA 4PJOD 1E7OA 3C12A 5C6SA 5DM7R 2RD1A 2NUTB 1Q82U 1M1KR 1K73U 3JB9F 1WA7A 2RJDA 2A28A 2BE7D 1W2BA 1YP5A 4ZN3A 4JLIA 1X01A 2DF6A 4JDSA 1JBMA 3X24B 1VQ5T 1PHTA 1WI7A 2K3BA 4LE9A 4BB7A 1ZSGA 4PJOB 1AT1B 4MDXA 2KRMA 2L89A 1Y7XA 3G71T 1OU8A 1I5OB 2EKHA 4II1A 4PJJA 1VQPQ 1VIEA 2I2LA 4KUDK 1IB8A 1QP2A 2XDBA 2G6FX 3CC4T 2B8AA 1QW1A 5FLXE 2XI9A 2ECZA 1KFZA 4X34A 4HXJA 2D8HA 3JCMg 4DQ2A 3PNWC 3PIPA 1XTDA 1VQKA 3V7CA 2LZ6B 2P84A 1UFFA 5CKBA 4EPCA 3CMAT 4KBMB 1ZBJA 2EW3A 3QZ5B 3HHTB 3MEWA 4C92G 5CKDA 2OTJT 4XTYA 3GF5A 4NOYA 3JCMW 1BIAA 1G5VA 4M7DF 2ZPEB 1WNLA 1XNIA 2VC8A 4ME7A 2D1XA 1X27A 1U1SA 3G4ST 1N0GA 3EHRA 3VRYA 3CCQA 1VQ6A 3F70A 4CC4B 1YHQT 3A98A 2YRVA 4HVUA 1LPLA 5HCKA 4HCBA 4ZNXA 3T9NA 3JCMP 4M77G 5L23A 5GMKj 3EAEA 2D0NA 3HL8A 4NL3A 1TWBA 3PVQA 3J7AF 3GLXA 3OYFA 4RTZA 1WPYA 3QUIA 2RI3A 1YITT 3ZFJA 1PM3A 2JT4A 5FU7B 2CP2A 1YJWQ 4N4HA 1NZ9A 3OMCA 3CC2T 5GAN7 1RACB 1GCQC 3HRUA 5DLQE 1UDLA 2RI5A 2JOYA 4B9XA 4BE0A 1TXQA 2CP6A 1B34A 9ATCB 3OYNA 1KQ1A 2ZPHB 2CUDA 5GAMe 3HTRA 2K2VA 4YTLA 2GQIA 5CO7A 3M0SA 2AK5A 1VUBA 2OAWA 1ZSZA 2YDLA 5GMKh 3VRZA 1QCOA 1OI1A 2BKDN 2DJZA 2E5KA 4D8KA 1K9MU 1QVGP 4L6V5 1KG1A 3RIRA 3QKJA 1BI0A 1PNJA 1D1BA 2DYIA 2C0TA 4GLMA 4F16A 4M75E 4OMQA 3S3NA 4FYXB 2YSQA 2R5AA 1WIDA 4CC7A 1MMAA 3DB3A 3VS3A 2QQRA 5ECAA 3PMTA 3A8MB 2RNAA 1XOVA 5IH2A 2YLBA 5AT1B 1W2BP 1ZA1B 4CI0C 1NM7A 3E2UA 1GBRA 1QKWA 3JB9G 3ULRB 2EKOA 4OB0B 2MCNA 1D1CA 3JCMf 4C0DB 4PJOC 1Q81C 1T3SA 2J05A 1MGQA 2QEXT 2NUPA 2VKNA 3PMIA 1RLPC 2EJFA 1VQNT 3VU3C 4LN2A 1CKAA 2EJ9A 2CGHA 4M7AE 1AEYA 2K5IA 2ZPFB 3DLLA 1NYGA 4BDZA 1YIJA 3L2RA 4JZ3A 2JMCA 2SEMA 3OSVA 1M90U 1S1NA 2E5QA 2LVMA 1YJNA 3OYGA 3QYGB 4MZTA 1JJ2A 1PWTA 2H3JA 4C8QF 1H92A 3LH5A 1MMGA 3TSZA 1TUCA 1Q81R 2X3WD 2K2MA 2FG0A 2K9GA 2YXYA 3L2QA 2EQMA 4OGEA 4DBQA 2CSIA 3QYHB 5CQXA 2BE9B 4BUGA 4ZTJA 1C6VX 2HD0A 3OYCA 1RAGB 1VQLA 5A0LA 2V8KA 4M7DG 1U1TA 2EQKA 2CZ0B 2CUBA 4ATOA 2BUDA 1NG2A 5GAN4 3M0UA 3CMET 2YUOA 3H0HA 5GAMd 1YI2A 2PUOB 1G3WA 1MNDA 1HXDA 2ED0A 1S72A 3KXTA 5LJ3e 1I0CA 1TS9A 3G71Q 1M3CA 3UF4A 4N4GA 4C5GA 5GMKl 1Y07A 3SWNC 4A4FA 1B34B 2COYA 4QW2A 5M9OA 2M16A 2DNUA 2WSEE 4M7AA 5CQYA 2DAQA 5HK3A 3GP8A 4E47A 1SG5A 3CMAQ 4BI4A 3MP8A 2VVKA 1YCSB 3EHQA 1ACMB 2LP5A 1WXUA 4IIOA 2OTJQ 3FJ5A 3H41A 4HCKA 3TSWA 3VUZA 5DLOA 2JN0A 4R56A 2CREA 2DL5A 3KBGA 3INZA 1RL2A 4M78F 2A0FB 3G4SQ 3CCUT 3FB9A 1KQSA 1FXXA 2DM1A 2ZPIB 4LD9K 1GCQA 2HQHA 5GANj 2D6FA 3QDRB 1JXMA 4M4ZA 4MDWA 2M02A 4IUTA 2P0KA 5LJ3h 2QAZA 4LUDA 5HY6A 3CPWS 1MUZA 1NLPC 3MPUB 1K8AC 2IVWA 1BKBA 3P8DA 4WCIA 1UHCA 2EGEA 3PVLA 4JJBA 2CP0A 1ABOA 4EDUA 3S3OA 2A36A 5IXFA 2L5QA 3I56A 2XG8D 3SD4A 2VB6A 1ZUYA 4OMNA 3EG3A 1JEGA 1JO8A 4M7DE 2KI7A 3EGDA 2R58A 5GANh 2J6OA 1K8AR 5A0GA 3JCMX 2VGMA 1WHLA 1PD0A 1RI9A 1WGSA 1D09B 3I55A 4E7KA 1JJ2P 5LJ5j 1GFDA 2RPNA 3C94A 1Q81U 2DRKA 1PKSA 3QG1A 1N9RA 4J9EA 4XK8E 2JUFA 5LJ3d 1M4ZA 4AG1C 4Z8AA 5GAOr 4ZTFA 1VQ8Q 5KCHA 3FIFA 1WHMA 4C8QG 1Y57A 1BB9A 4AMCA 1YJWT 4RG8A 1VQ5A 2HAXA 3OW2P 2E3HA 4J6XA 3FEOA 2ZPBB 5IHNA 2G3RA 3I35A 1KC8C 1EX4A 4J9HA 4R55A 2X51A 3PT9A 1FX7A 1N0EA 1GRIA 2LJ0A 4J6WA 2QTVA 3LWHA 4RCBA 2RJFA 1UGQB 4O6JA 3RMQA 2JS0A 1Z9QA 2RHUA 1K76A 5A2QE 3J80E 3M59A 5LJ5h 5GANf 1VQMT 2LQ8A 5A0DA 5GANd 5GJVB 3H8ZA 1H3ZA 4F04B 3CC4A 1VQ7T 4M7AD 3M4GA 2JM9A 4BD3A 1K9AA 1FWZA 2QEXQ 3JCMJ 3VS5A 2I0NA 4ZGEB 2JM8A 3GNGA 1RUWA 3SHWA 4BE2A 1GL5A 1NE8A 1WJSA 4FYVB 2LT4A 2QTXA 1KC8R 2BZYA 4EMKC 5CK9A 4FW2A 2A08A 1KIKA 4M77F 3JV3A 3OS2A 2C1LA 3THKA 2YUNA 4M7AB 1RAIB 1VIFA 4J9GA 3GPLA 2KDSA 1OOTA 4KUIA 3OS1A 2XKOC 1YHQA 2JW4A 2FL7A 3FJPA 2R5MA 1W70A 1VQ4A 1FMWA 3TCJA 3GBQA 1OQKA 1YFNA 1Q86C 4X1VA 5AYFA 3JB9I 3L2UA 1KQSP 2OTLA 1WX6A 4DBFA 2L0AA 5LJ5f 1N8RU 5LJ5d 3CCJA 2L3RA 3SWNA 2WACA 1YITA 3FLGA 3OSSC 2F2XA 2DVEA 3CC2A 4IURA 2DIGA 1M8VA 3WXMB 1MV3A 3MEAA 2ZGWA 3CBPA 1Q86R 4JJNK 2DKGA 2PUKB 2DE0X 2NUZA 2A3LA 3QXEB 3QIIA 1ZUKA 2F69A 2RHIA 2CSQA 1AD5A 4JRPA 3HRSA 3LW5E 4PL6A 1V1CA 3RR6A 1NA6A 3EGDB 4BY6B 2LCSA 3C95A 3RESA 1ZHIA 3CCST 3CCRQ 4IUQA 2QXFA 3EGXA 2OAUA 1E6HA 2XIDA 4XU0A 1I07A 3CCET 1IGUA 1M1FA 1Y0MA 1BI3A 4J83A 4A54A 4XQ3A 5GAOq 2O4XB 2DERA 3H6ZA 4ZGJB 3CCVA 1B7TA 1OU9A 3PGGA 1QVFS 2DX1A 3CCUQ 3QSUA 4E7SA 4LDYA 1NPRA 3OYEA 3LLRA 4PJOF 2CP3A 4GLKA 4FT4A 1JXOA 1PCXA 3OA6A 1SSFA 5KYNA 1KD1C 1IO6A 1IRXA 1KJWA 1WJQA 2RB6A 3OYBA 2DFUA 4RTUA 5KYXB 3QDFA 2QEXA 4M75C 6AT1B 1VQNA 5D7UA 2LJ3A 4QVCA 3X20B 1UGRB 1D0YA 1WYXA 3OYHA 4BDYA 1KHCA 5I11A 3VS0A 2FPDA 2DXUA 2AT1B 1OX8A 3TREA 3VYGA 4CC3A 3EFRA 3A8HB 1QCNA 2PNIA 4A4GA 3O8VA 4IUUA 1VQOQ 3REBB 2VASA 4EMHA 2KE9A 2RMOA 1KD1R 2JNGA 3PTAA 4M78E 4QKUA 4O5VA 2JTFA 3NPFA 4J9BA 2EQUA 2MIOA 2KVQG 4FM4B 3E9FA 3JCMe 3I5RA 1UGSB 2F5TX 3QWYA 1OULA 2K3XA 4M7AC 3DKMA 2DTOA 2DXBA 3DLMA 3CCMA 5D6YA 2KXDA 3E1SA 3A8LB 3L2VA 2CZ6B 3QZ9B 4F7UE 2PTKA 1RADB 3CMEA 5CVIA 1MHNA 4OB2B 1M3BA 1FMKA 4NS5A 2EWNA 2DZ9A 1UG1A 4OP0A 1GFCA 2LC4A 1M8MA 1SHGA 3SWNB 3OYYA 4IIMA 5GAMg 2LT1A 4EMKA 1Q7YU 4XTWA 3MEVA 3PE0A 1HK9A 2O9VA 2FHDA 2KT1A 5GAOp 1AWOA 1U06A 3I9QA 4LD6A 3EG0A 2EGAA 1YJ9Q 2GFAA 1VQMQ 2VXEA 2LCCA 1VQ7Q 3G6EQ 5FU6C 1VQ8T 5GAMj 1HJDA 1G83A 1B07A 1M30A 3X26B 3NMZC 2FO0A 4BY6C 4BACA 2HBPA 3CC7Q 1M1GA 4JS5A 4JUVA 1M1KU 3UATA 1D0ZA 3EGXB 1SRMA 2YT6A 1Z9ZA 1G3SA 5CCAA 2DXCA 1VQPA 1D3BA 4D8DA 2YUQA 2DRMA 1BK2A 4AFUC 1W4SA 4KT0E 3CBOA 3NHNA 2X35A 4C92E 3HQFA 3V7SA 1AHJB 1QLYA 1SF9A 4XU2A 3RERA 2VWFA 2D0QB 2RQRA 4F14A 5J26A 2JTMA 1J3TA 1NJIC 2L8DA 2M9UA 2MOXA 4VUBA 4WF2A 4F7UA 5GAMh 4RUGA 2AZVA 5KYUB 4OMLA 2Y90A 1PRMC 1XJWB 3CCLQ 4OB1B 4MMKA 4BE1A 4PJOG 4JLGA 3RKWA 2EYZA 2GGRA 2L2PA 4M77E 4A53A 3L1AA 4C5EA 1C1AA 4E7ZA 1U5SA 4RTTA 1R77A 2VV5A 3OBWA 1NJIR 1VQKT 1N6AA 3CPFA 2JMAA 5C0MA 2RA2A 2FRWA 3C0CA 1WIEA 4NL2A 5GMKm 4JRQA 2F2WA 3QJYA 3P8BB 2J6FA 2IG0A 1WQWA 3CCSQ 1X75C 1X2QA 3QJ6A 3R6NA 1CSKA 3M54A 1OZ3A 1RAHB 3JSCA 3CCQT 3RBBB 4M75A 3CCEQ 1YJWA 3H0IA 5GAMf 4L59A 2OX7A 5LJ3g 2E41A 2H8HA 4J8OA 1SSHA 4IUVA 3U23A 2XICA 2EAYA 2CZ7B 4J9CA 3BY7A 2M51A 1U3OA 4OF1A 3S6WA 3QBYA 1AZEA 2P0QA 3V8KA 2WSCE 2MMPA 3CXCS 2DTHA 2DEUA 4C92A 2CDTA 1N27A 3VKIA 4EMKB 4OMOA 3L42A 4BI8B 1HSQA 2BZXA 2FPFA 2MI6A 5LJ3j 4LUEA 4Q5WA 5IHIA 5GANg 4AFSC 3ASKA 3NTHA 3CCRT 1UHFA 2QQBA 2QI2A 5FWCA 3C4SA 2QG9B 1JU5C 2HL3A 3HSBA 1OEBA 3DB4A 3M56A 2WSFE 4PFPA 2YLCA 2F1LA 3OYAA 1ABQA 2P4TA 3SDZA 1Q95G 3VYHB 1X6BA 4DEXA 5HKCA 2R57A 4E2FB 7AT1B 3UPUA 1ZA2B 1DJ7B 5I21A 1UE9A 2K57A 2KRNA 3M5AA 2E4HA 4HVWA 2ZAEA 1YNZA 2HCKA 2C0IA 5KYYB 3G1JA 2COWA 2PU9B 4J6YA 5KYWA 4AFZC 3MKDA 1D3BB 3QWXX 3VS2A 1HYOA 1BBZA 1TU0B 1H8KA 2RHXA 3JCMQ 2KT8A 5J39A 2LQKA 1NEBA 3OYJA 2QA4Q 3CD6Q 4DOVA 5LJ5g 1MMDA 4FYYB 4X9CA 4J5YA 2XK0A 4F7UB 1VQOT 2AZSA 2GBQA 4LDXA 2QQSA 3MCAB 3HPWA 4PLLA 2E6NA 3OS0A 2NYSA 4UC4A 4Z02A 2COZA 1PRLC 2QASA 2NWMA 3A5ZB 2ROTA 1Q82C 3M0TA 1VYUA 2GTJA 1VYVA 2YRCA 4MZPA 2V26A 2HKNA 3RKYA 5GAN8 1YIJT 2CT3A 3SFMA 1G3TA 3KUFA 2E64A 4P5NA 1V76A 4QT7A 3TQ7P 2LCLA 2Y4XA 2PVOB 1I5LA 3PFSA 2HDAA 2M0YA 2LRQA 4M75D 5LJ3f 1VQ9Q 2O4XA 2HSEB 2W10A 2MYSA 3CPWA 3LX7A 3M53A 2MF2A 2ATCB 2RQWA 1SHFA 3CQTA 2MPXC 3GNFB 4WTOB 4E7LA 2DEQA 1MV0B 1UTIA 3JB9H 3G71A 1M9SA 4M75B 1C0MA 4C92D 2QGGA 2CKKA 2DBMA 1UJYA 5KYXA 1RLQC 1UECA 2IIMA 1RI0A 2FVUA 1IXDA 5CKEA 1X6OA 2C0OA 5GAN6 4BI3A 3TEEA 1YJ9T 1WFWA 5IAYA 1QCFA 2RH2A 1PKTA 4KGZB 5GAOl 1YI2T 1IREB 4LNPA 4J9FA 5LL6S 3EG2A 1I81A 5GAN3 3G6ET 3OYLA 2AIRB 4C92B 2DBKA 4HA8A 2O88A 2GCXA 3CMAA 1P92A 1JRIA 2FEIA 3VS6A 1UGVA 2OTJA 4RTVA 3CBMA 2V1QA 3IQLA 1K1ZA 2M0OA 3VS7A 2K7AA 4FSXA 3CC7T 4M7DA 2W0ZA 2PZ1A 4CC2A 3G4SA 1KSWA 1QWFA 4M7AF 1UB4A 3EFOB 1IHVA 2X4JA 1I1JA 3OY9A 1VQKQ 3VS4A 2RK1A 3QPHA 1M5Q1 1TOVA 2CP5A
chains in the Genus database with same CATH topology
3BW1A 3VU3C 3WVDB 1QVGS 4QVZA 3BFMA 5KE2A 5IN1A 2EJ9A 2JNGA 2RI2A 2CGHA 4M7AE 3PTAA 4M78E 2K5IA 2ZPFB 1WQ7A 3DLLA 4O5VA 2JTFA 4BDZA 1YIJA 3FRNA 4MMLA 3L2RA 2EQUA 2KVQG 3A8GB 4FM4B 3E9FA 3OSVA 2GQVA 3JCMe 3CCLT 1M90U 4F7UF 1UGSB 2F5TX 2E5QA 2LVMA 2K3XA 3OYMA 3X25B 1TH7A 3OYGA 1YJNA 3MP6A 2KSSA 3QYGB 1BI1A 4M78C 4MZTA 4M7AC 3V8JA 3DKMA 2H3JA 3JB9J 1JJ2A 2DTOA 2DXBA 4QQGA 4C8QF 3DLMA 1K73C 3CCMA 3MO8A 3VV0A 1H641 2RM4A 4LDWA 5D6YA 3J81E 4RG2A 4C0DC 3E1SA 3A8LB 2GF7A 2CZ1B 1KQ2A 3L2VA 2CZ6B 3QZ9B 2MWOA 4F7UE 5LJ5e 1UEBA 3L2QA 2EQMA 4OGEA 5CVIA 3CMEA 1MHNA 3P8HA 4LDUA 4OB2B 3QYHB 5CQXA 1K9MC 4KULA 4NS5A 4BUGA 1NJIU 1I8FA 5FU6B 1Y96B 2EWNA 2DZ9A 2HD0A 4GY5A 4OP0A 4XTVA 4ZTJA 3OYCA 1YJNT 1VQ5T 5GAOm 3OYKA 4N4IA 4C8QE 3CCSA 1VQLA 2X4YA 2A7YA 5A0LA 2V8KA 2EFIA 2LC4A 3SWNB 4M7DG 1U1TA 2EQKA 2CZ0B 2RJCA 2MAMA 2KMTA 3OYYA 3CCEA 2XHCA 4ATOA 2BUDA 5GAMg 2LT1A 2VXFA 4EMKA 1Q7YU 5GAN4 1U8RA 5CIUA 1K8AU 1I4K1 4XTWA 3MEVA 2DIQA 5GAN5 2K4YA 3CMET 3AHUA 1PSEA 2EJGA 4C8QC 1HK9A 4FIBA 3V8LA 2FHDA 5GAMd 5GAOp 3JB9D 1VQ8A 3PIOA 2MWPA 4LD6A 5KCOA 4C0FA 4XTXA 1VQLT 4RKUE 4HCCA 2PVDB 2PUOB 2FB7A 1G3WA 1YI2A 5I2MA 3JRZA 2GFAA 1HXDA 4HT9A 3JCMb 4N0AA 2JZ2A 3KXTA 5LJ3e 1S72A 5I2SA 4E7HA 3UT1A 3ME9A 2VXEA 4OVAA 2LCCA 2PVGB 4D6WA 4PJOA 3NFCA 4JRKA 4M75F 4I1KA 3L2ZA 3R6OA 4N4GA 4IKFA 2YHTA 5FU6C 4ELYC 5KH6A 1VQ8T 4C5GA 5GMKl 5GAMj 1Y07A 5GMKi 2GFUA 3LWIA 4B9WA 4PLIA 3OB9A 1EIFA 1ZBXA 3SWNC 2X4XA 5FROA 5CKHA 3HFNA 3JCMc 4MZMA 4A4FA 1S72T 1B34B 2KK4A 4A4HA 4QW2A 3X26B 5M9OA 2M16A 1NPPA 4LDVA 4M77D 4BY6C 4BACA 2HBPA 1M1GA 4XU3A 2WSEE 4JS5A 4JUVA 4XU1A 2QQ9A 4IUPA 3OYDA 4E7IA 1M1KU 4C92F 4M7AA 2Y4YA 2E10A 4HT8A 3OQ5A 5CQYA 1M90C 1OYXA 1G3SA 2DAQA 3OMGA 3QO3A 5CCAA 2BIVA 2HNIA 2DXCA 5HK3A 4E47A 3GP8A 5FRNA 3N5BB 3V7RA 4BI4A 3MP8A 1D3BA 1VQPA 4ZGDB 1IZ6A 5DLOA 2HQEA 3VUZA 1W4SA 2ZCFB 3LGFA 4DA4A 3BDUA 2JN0A 4R56A 4KT0E 3CBOA 2X35A 4C92E 3HQFA 3KBGA 3V7SA 3INZA 1AHJB 1RL2A 4M78F 4RCCA 4XU2A 2M1HA 4M77B 4M7DD 4M75G 3RERA 5IT9E 3X28B 3CCUT 2D0QB 3FB9A 2V8IA 2JTMA 5J26A 1FXXA 1KQSA 4A4EA 2ZPIB 1NJIC 2L8DA 2M9UA 3M9QA 2AHJB 5GANj 4LD9K 4VUBA 2D6FA 4WF2A 5J3BA 4F7UA 5GAMh 3QDRB 4JRIA 1KC8U 3HFOA 4MDWA 2Y90A 4IUTA 4HKEA 3M55A 4OB1B 4C92C 2P0KA 2EYQA 4MMKA 1GXIE 5LJ3h 2QDYB 5D6WA 5HY6A 4C8QA 3CPWS 4BE1A 3UWNA 4TVRA 4PJOG 1Q7YC 3FC3A 4JLGA 4DOWA 1K8AC 2IVWA 3NTKA 3RKWA 4FT2A 3VJPA 2XD0A 1BKBA 1PSFA 2RHZA 3BDLA 4M7DB 4M77E 3P8DA 4A53A 2QA4A 3G7ZA 2E1HA 3CD6A 3L1AA 4L5GA 4C5EA 4FL6A 4EDUA 1V29B 1QVFA 4OB3B 3S3OA 5GMKe 2FYKA 3E19A 2KAFA 1W2BS 2JVVA 2VV5A 2L5QA 1WJRA 3OBWA 3I56A 4QQDA 2XG8D 4M77C 3SD4A 1VQKT 2DK3A 1N6AA 1N9SA 2DXTA 2ZPGB 1Y71A 3UDCA 3OYIA 3CPFA 3A8OB 4M7AG 4M78G 2XU8A 2RA2A 5C0MA 2QA4T 1LNXA 1LOJA 1VQ4T 3CD6T 4M7DE 4C5IA 5CAIA 4NL2A 2EIFA 2VYTA 1UGPB 3JAME 3GIBA 1BI2A 5GMKm 4JRQA 2R58A 3QJYA 5GANh 3P8BB 2IG0A 1YCYA 5A0GA 1JB0E 1WQWA 3JCMX 2VGMA 3CEYA 1X75C 3I56T 2DTIA 2OTLT 3QJ6A 2LTOA 3M54A 2RHYA 1OZ3A 1R8OB 4J7FA 1WGSA 3JSCA 3CCJT 2RO0A 3I55A 3CCQT 4E7KA 4M75A 5LJ5j 1M1KC 4CRIA 5EG2A 1YJWA 5GAMf 2CS7A 4L59A 3JCMV 5LJ3g 1VQ9A 2E41A 3C94A 3RKXA 1Q81U 3QG1A 1N9RA 4IUVA 4J8OA 4XK8E 4FU6A 2XICA 4F7UG 1YELA 2EAYA 2JUFA 2CZ7B 2LDMA 3BY7A 2C06A 5LJ3d 1M4ZA 5GAOr 4ZTFA 2LX9A 3HP9A 1Q86U 3FDRA 3NTIA 4OF1A 5KCHA 3META 3FIFA 3S6WA 1QVGA 4XTUA 3QBYA 4J7IA 4C8QG 2VGNA 2P0QA 2QQAA 3V8KA 2WSCE 2MMPA 3CXCS 3I55T 2DZCA 2DTHA 2XDDA 2E6ZA 3CCRA 1YJWT 4RG8A 1BIBA 1VQ9T 1VQ5A 2HAXA 4PJOD 1XQHA 4C92A 4J6XA 3FEOA 2ZPBB 1N27A 2G3RA 3VKIA 2E65A 3JCMh 4ELZC 3C12A 3ZBDA 4EMKB 3L42A 5C6SA 1KC8C 4BI8B 5DM7R 4R55A 3WVEB 2RD1A 2HQXA 3QHSA 1Q82U 2MI6A 5LJ3j 2CYZB 1K73U 3PT9A 1FX7A 3JB9F 2RJDA 4PKCC 1QVPA 2P0PA 1W2BA 4Q5WA 2O01E 3MHXA 4J6WA 4V2SA 5GANg 4ZN3A 3LWHA 4RCBA 1G3YA 2RJFA 4JLIA 1UGQB 4ZN1A 4O6JA 1X01A 3RMQA 4JDSA 2RHUA 2EQJA 3ASKA 1O75A 1JBMA 2PQWA 3NTHA 4M78A 2QQBA 3X24B 2QI2A 5A2QE 3J80E 4HCZA 3M59A 5LJ5h 5GANf 3CCUA 1VQMT 3C4SA 2LQ8A 5A0DA 5GANd 4BB7A 3H8ZA 1H3ZA 1JJ2S 3HSBA 3ZEHA 2ZZDA 3CC4A 4PJOB 1VQ7T 4M7AD 3M4GA 4MDXA 4BD3A 2L89A 1Y7XA 3G71T 1FWZA 3Q1JA 3DB4A 3M56A 2WSFE 3OBYA 3VUBA 3JCMJ 3M58A 4II1A 4ZGEB 2YLCA 1VIEA 2K3YA 3GNGA 3OYAA 4BE2A 3RMSA 2P4TA 2NLUA 3SDZA 3VYHB 2RK2A 5HKCA 1NE8A 1WJSA 2R57A 2I2LA 2LT4A 2QTXA 4Y28E 4KUDK 3CCVT 3UPUA 1QP2A 2XDBA 1DJ7B 4EMKC 5CK9A 5I21A 2K57A 3M5AA 4M77F 3CC4T 2F5KA 3OS2A 2B8AA 1QW1A 5FLXE 2XI9A 3OW2S 4M7AB 4X34A 4E7JA 1VIFA 3JCMg 4DQ2A 3PNWC 2PU9B 4J6YA 3PIPA 3GPLA 1XTDA 1VQKA 2KDSA 1VQOA 1D3BB 3V7CA 4KUIA 5CR2A 5CKBA 4EPCA 2XKOC 3OS1A 1YHQA 3CMAT 2FL7A 3FJPA 3QZ5B 4KBMB 3JCMd 2R5MA 4C8QD 2V8JA 3HHTB 2RHXA 3M4YA 3MEWA 4C92G 5CKDA 1VQ4A 4XTYA 3GF5A 3JCMQ 5CKFA 2OTJT 4NOYA 3JCMW 5J39A 3TCJA 3OS5A 1BIAA 1ZQ1A 1G5VA 4M7DF 5DY9A 2LQKA 2ZPEB 3OYJA 1WNLA 1XNIA 4DOVA 2VC8A 4ME7A 5LJ5g 4X9CA 5GAN2 1Q86C 1U1SA 4OGCA 5AYFA 3JB9I 4J5YA 3L2UA 1Y96A 3G4ST 2OTLA 2XK0A 4C0GA 5LJ5f 4QQ6A 4F7UB 1VQOT 5LJ5d 2KQWA 3CCJA 3CCQA 1N8RU 1VQ6A 3LYIA 2L3RA 3F70A 1KD1U 3SWNA 2QQSA 3MCAB 1YHQT 4LDXA 3HPWA 4PLLA 2E6NA 2YRVA 3OS0A 2WACA 1YITA 3GOXA 3FLGA 4UC4A 4Z02A 5FRMA 4HCBA 4C8QB 3T9NA 3OSSC 1O9SA 3A5ZB 4M77G 3JCMP 5GMKj 2DVEA 1Q82C 3CC2A 3EAEA 4QVDA 5HK0A 4IURA 3HL8A 4NL3A 4EMGA 2LNVA 3HKSA 4RMOA 4MZPA 2DIGA 3RKYA 3GLXA 5GAN8 3OYFA 1YIJT 3J7AF 3WXMB 3SFMA 1G3TA 5L8RE 4M7DC 1VQ6T 1M8VA 3KUFA 2E64A 4P5NA 1WPYA 3MEAA 3QUIA 2LCLA 2ZGWA 2RI3A 2DPPB 2Y4XA 1YITT 3CBPA 2PVOB 3RUXA 3ZFJA 4JJNK 3PFSA 1I5LA 5KE3A 2DKGA 2PUKB 2A3LA 5FU7B 1BYMA 3SB2A 2LRQA 4M75D 4XAXB 5LJ3f 4N4HA 3QXEB 1NZ9A 2O4XA 3QIIA 3OMCA 3CC2T 5GAN7 2F69A 2RHIA 2DO3A 3CCMT 3OW2A 3HRUA 5DLQE 3L2WA 4JRPA 3HRSA 3LW5E 4OMFB 4PL6A 2E12A 3M57A 2RI5A 2JOYA 4B9XA 4C5HA 4BE0A 1VQNT 3CPWA 1NA6A 3LX7A 4JS4A 3M53A 2MF2A 4BY6B 1B34A 1KQSS 3OYNA 1KQ1A 1YJ9A 5D6XA 3C95A 2VUBA 2ZPHB 3RESA 1VQMA 5GAMe 3GNFB 1ZHIA 4E7LA 3CCST 2DEQA 2K2VA 3HRTA 4YTLA 1VQ7A 4X9DA 5CO7A 2RJEA 4IUQA 1VUBA 2QXFA 3G71A 3JB9H 1M9SA 4M75B 2OAUA 2XIDA 4XU0A 4C92D 5GMKh 3G6EA 2CKKA 3CCET 1LJOA 2XDPA 4XTZA 2BKDN 1M1FA 1OI1A 2DJZA 1RI0A 1BI3A 4J83A 4A54A 4XQ3A 2FVUA 5CKEA 1OZ2A 1X6OA 2O4XB 5GAN6 4BI3A 5GAOq 3H6ZA 3TEEA 1YJ9T 4ZGJB 3CCVA 1K9MU 5FU7C 5IAYA 4L6V5 2RH2A 3PGGA 3LH0A 5GAOl 3TU4K 1QVFS 3RIRA 1YI2T 1KG1A 1IREB 1BI0A 3QKJA 1QP3A 4M78D 4M77A 3QSUA 4LDYA 5LL6S 3CCRT 3MEUA 1NPRA 3CC7A 1I81A 3MP1A 5GAN3 3OYEA 3G6ET 3LLRA 3OYLA 4M75E 4PJOF 3S3NA 4C92B 4GLKA 4FT4A 2R5AA 4HA8A 3OA6A 1SSFA 1WIDA 1N8RC 3DB3A 1KD1C 2K5LA 2GCXA 2QQRA 3CMAA 1P92A 1JRIA 3PMTA 3A8MB 1WJQA 1XOVA 2RB6A 4PNOA 4A4KA 2YLBA 3OYBA 2OTJA 3CBMA 2QEXA 5GANe 3EFSA 2M0OA 4M75C 4PJOE 4CI0C 1VQNA 4FSXA 4QVCA 3CC7T 4M7DA 3X20B 4M78B 1UGRB 2DD5A 3OYHA 1YBYA 4BDYA 3G4SA 1KHCA 4Y91A 3JB9G 2EKOA 4OB0B 2KY9A 2DXUA 4N0AC 4M7AF 3TREA 2D9TA 1KHIA 1UB4A 3LGLA 3EFRA 3JCMf 3VYGA 2K5FA 4C0DB 4C0ZA 3CXCA 2X4JA 3A8HB 2E70A 5GAOn 4PJOC 4A4GA 3O8VA 2DD4A 3OY9A 1Q81C 3CCLA 1MGQA 4IUUA 2RK1A 2X4WA 3PMIA 3QPHA 1M5Q1 3URGA 2QEXT 3S3MA 1VQPT 4EMHA 3E9GA 3ER0A 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEL A;  3HQF A;  4LDW A;  4LDY A;  4LDV A;  4LDX A;  4LDU A;  1WID A;  4I1K A;  1NA6 A; 
#chains in the Genus database with same CATH topology
 1QVG S;  4QVZ A;  3BFM A;  1QKX A;  2RI2 A;  2O9S A;  3FRN A;  1FMV A;  3A8G B;  3CCL T;  3CCQ Q;  1VQ6 Q;  3OYM A;  3X25 B;  1GBQ A;  1TH7 A;  1YWP A;  5KYW B;  3MP6 A;  2KSS A;  1BI1 A;  4M78 C;  2O2O A;  2EYY A;  2FRY A;  3MO8 A;  3VV0 A;  1AZG B;  1X2K A;  1PC0 A;  2CZ1 B;  2MWO A;  4OMP A;  1E6G A;  1K9M C;  2DA9 A;  2DJQ A;  1I8F A;  5FU6 B;  4XTV A;  1H3H A;  2KXC A;  4K11 A;  3OYK A;  4C8Q E;  2A7Y A;  4JJC A;  2EFI A;  2MAM A;  2VXF A;  1WHK A;  5CIU A;  1K8A U;  2DMO A;  2JTE A;  2DIQ A;  3AHU A;  2EJG A;  3JB9 D;  1VQ8 A;  4OMM A;  4XTX A;  4RKU E;  4HCC A;  2PVD B;  2FB7 A;  3JRZ A;  3JCM b;  2LNH B;  4N0A A;  1HD3 A;  2DVJ A;  5I2S A;  1AOJ A;  4E7H A;  3UT1 A;  3ME9 A;  4OVA A;  1K9M R;  2PVG B;  1X43 A;  2YRD A;  4D6W A;  4EIK A;  4JRK A;  4I1K A;  2ESW A;  4IKF A;  2YHT A;  4ANJ A;  1RAB B;  5KH6 A;  1M2O A;  1SKU B;  2KYM A;  5GMK i;  2GFU A;  4PLI A;  4GBQ A;  3OB9 A;  1EIF A;  3CPW P;  2YUP A;  3HFN A;  3JCM c;  1LVK A;  1JQQ A;  2GTO A;  1F1B B;  1RAF B;  1SRL A;  1M2V A;  1NPP A;  2FPE A;  5KYU A;  4XU1 A;  3OYD A;  4IUP A;  4E7I A;  2Y4Y A;  2K6D A;  4HT8 A;  1M90 C;  1OYX A;  3N5B B;  3V7R A;  2KEA A;  2HQE A;  2ZCF B;  4DA4 A;  2Z0W A;  1WDX A;  4M7D D;  4RCC A;  2M1H A;  4M75 G;  1NLO C;  3X28 B;  2V8I A;  4A4E A;  2ED1 A;  3M9Q A;  1UJ0 A;  1KC8 U;  2O31 A;  2QYZ A;  4HKE A;  4C92 C;  1GXI E;  1PG5 B;  2QDY B;  5D6W A;  4C8Q A;  2HEQ A;  3UWN A;  4TVR A;  1M90 R;  3FC3 A;  2FZG B;  4DOW A;  3VJP A;  2XD0 A;  4FT2 A;  3REA B;  2H3E B;  2FZC B;  4M7D B;  1YIJ Q;  2E1H A;  2A37 A;  4FL6 A;  1IGQ A;  4HVV A;  1V29 B;  1QVF A;  4OB3 B;  5GMK e;  1D1A A;  1YJN Q;  2JVV A;  1WJR A;  2JS2 A;  4QQD A;  4M77 C;  1NEG A;  3BE3 A;  1OPL A;  2DK3 A;  2EBP A;  2DXT A;  1N9S A;  3OYI A;  2ZPG B;  1Y71 A;  3UDC A;  4M7A G;  1QWE A;  1RAA B;  1LNX A;  1LOJ A;  2QA4 T;  1VQ4 T;  3CD6 T;  1YWO A;  4C5I A;  1B3Q A;  3GIB A;  2J06 A;  3RNJ A;  1YCY A;  1JB0 E;  2KRS A;  1VQL Q;  2OTL T;  2AKL A;  2EYX A;  4J7F A;  1R8O B;  3CCJ T;  5GJW B;  4CRI A;  5EG2 A;  4PJM A;  3JCM V;  2AKK A;  3RKX A;  1AWJ A;  4ORZ A;  8ATC B;  1YEL A;  3NGP A;  4AFQ C;  2LX9 A;  1Q86 U;  3FDR A;  2RF0 A;  3MET A;  3MJX A;  3ZI5 A;  4XTU A;  4KRT A;  4DBR A;  1YI2 Q;  4J7I A;  2VGN A;  2QQA A;  4Z88 A;  4FYW B;  1S72 Q;  2DZC A;  2XDD A;  2E6Z A;  3CCR A;  1VQ9 T;  1N5Z A;  1XQH A;  3EH1 A;  2E65 A;  3JCM h;  4ELZ C;  1K4U S;  3ZBD A;  2V1R A;  2DL4 A;  3WVE B;  2HQX A;  3QHS A;  5IXB A;  2CYZ B;  1KK7 A;  1R0C B;  4PKC C;  1QVP A;  2P0P A;  2O01 E;  3MHX A;  4V2S A;  1G3Y A;  4ZN1 A;  2EQJ A;  1O75 A;  2PQW A;  4M78 A;  5KYY A;  4HCZ A;  3CCU A;  1WHH A;  1JJ2 S;  3ZEH A;  2ZZD A;  1AVZ C;  1K0S A;  3VS1 A;  3Q1J A;  3OBY A;  3VUB A;  2DL8 A;  3M58 A;  2K3Y A;  3M0Q A;  2X3X D;  3RMS A;  4E6R A;  2NLU A;  1TTH B;  2RK2 A;  3A1P A;  4Y28 E;  3CCV T;  2DIL A;  4JZ4 A;  2RQT A;  1M2V B;  4A63 B;  3SEM A;  2IPO B;  2F5K A;  1TSF A;  4RTX A;  4PFZ A;  3OW2 S;  1OX9 A;  4E7J A;  1TUD A;  3TVT A;  1VQO A;  5CR2 A;  2ABL A;  3JCM d;  2ROL A;  4C8Q D;  1YN8 A;  2V8J A;  3M4Y A;  1ZLM A;  2QK0 A;  5CKF A;  2RN8 A;  4LXC A;  3OS5 A;  1ZQ1 A;  5DY9 A;  1AWW A;  1OV3 A;  3UA7 A;  5GAN 2;  4OGC A;  1Y96 A;  4C0G A;  1TG0 A;  3D7S B;  2HKQ B;  4QQ6 A;  2KQW A;  3LYI A;  3I5S A;  1KD1 U;  4PFO A;  3I56 Q;  3GOX A;  5FRM A;  2DET A;  4C8Q B;  1WHJ A;  1O9S A;  4QVD A;  5HK0 A;  4J9D A;  4EMG A;  3EG1 A;  2LNV A;  4J9I A;  3HKS A;  4RMO A;  4M7D C;  5L8R E;  1VQ6 T;  1QVF P;  2ENM A;  1ZUU A;  2DPP B;  1M3A A;  3RUX A;  5KE3 A;  3I55 Q;  2QGF B;  1BYM A;  3SB2 A;  4XAX B;  2LX7 A;  4KH0 B;  2XMF A;  2LJ1 A;  4AG2 C;  2DO3 A;  3CCM T;  3OW2 A;  3L2W A;  2DL7 A;  4OMF B;  4PJL A;  2E12 A;  2DL3 A;  3M57 A;  4C5H A;  1GCP A;  4JS4 A;  1FYN A;  1KQS S;  2EYW A;  1YJ9 A;  5D6X A;  2L3S A;  2VUB A;  1VQM A;  4JPB W;  2CH4 A;  8AT1 B;  4PK4 A;  1EFN A;  4ESR A;  3HRT A;  1VQ7 A;  1AWX A;  1VQ5 Q;  4X9D A;  2RJE A;  3G6E A;  1LJO A;  2XDP A;  4XTZ A;  5FW9 A;  1OZ2 A;  3M0R A;  3AT1 B;  5FU7 C;  3LH0 A;  2LQN A;  3TU4 K;  1VA7 A;  1QP3 A;  4M78 D;  4M77 A;  2EGC A;  3EFO A;  3MEU A;  3CC7 A;  3MP1 A;  1QMC A;  3CC4 Q;  2KYB A;  1N8R C;  2K5L A;  1MNE A;  2K79 A;  1ZSZ B;  4PNO A;  4A4K A;  4KGX B;  5GAN e;  2FZK B;  1D0X A;  3EFS A;  4Y92 A;  1ARK A;  4PJO E;  4M78 B;  2DD5 A;  1YBY A;  4Y91 A;  2E3I A;  2KY9 A;  4N0A C;  2D9T A;  1KHI A;  3LGL A;  4C0Z A;  1X6G A;  2K5F A;  1A0N B;  3CXC A;  2E70 A;  3ZL7 C;  5GAO n;  2HSP A;  2HZY A;  2DD4 A;  3CCL A;  3UA6 A;  2X4W A;  3URG A;  3S3M A;  2GNC A;  1VQP T;  1YHQ Q;  3E9G A;  3ER0 A;  5KCO A;  3BW1 A;  3WVD B;  1N8R R;  1VQ4 Q;  5KE2 A;  2SRC A;  5IN1 A;  1WQ7 A;  2RQV A;  4MML A;  1N0F A;  2OTL Q;  2GQV A;  4F7U F;  3EGU A;  3CCJ Q;  3RDV A;  5FWB A;  2KGT A;  1MMN A;  3V8J A;  3JB9 J;  1YIT Q;  4QQG A;  1K73 C;  1H64 1;  1WXT A;  2RM4 A;  4LDW A;  3KFV A;  3J81 E;  2NUP B;  4RG2 A;  4C0D C;  3CC2 Q;  1NYF A;  3O5Z A;  2GF7 A;  1KQ2 A;  4DEY A;  5LJ5 e;  1T0H A;  1UEB A;  2F2V A;  4RTY A;  3P8H A;  4LDU A;  4KUL A;  2HL5 C;  4B6M A;  1NJI U;  1Y96 B;  4GY5 A;  3EG9 A;  1YJN T;  2KNB B;  1QQJ A;  5GAO m;  4N4I A;  3CCS A;  2X4Y A;  1T3L A;  4KGV B;  2RJC A;  3CCE A;  2KMT A;  2XHC A;  1RAE B;  1U8R A;  1I4K 1;  4KH1 B;  2NUT A;  5GAN 5;  2K4Y A;  2LMJ A;  1PSE A;  4C8Q C;  4FIB A;  1Q82 R;  3V8L A;  2DYB A;  3PIO A;  1K73 R;  2MWP A;  2HMA A;  2EQI A;  4C0F A;  1VQL T;  2CT4 A;  1UUE A;  2L3P A;  2OI3 A;  1BU1 A;  5I2M A;  2JXB A;  2J6K A;  4HT9 A;  4Z89 A;  2JZ2 A;  3M0P A;  2CH4 W;  3H9N A;  2OJ2 A;  4PJN A;  3NFC A;  4PJO A;  1WLP B;  4M75 F;  2KR3 A;  3L2Z A;  3R6O A;  2P4R A;  4ELY C;  4FW1 A;  3LWI A;  1TUG B;  4B9W A;  1ZBX A;  5FRO A;  2X4X A;  5CKH A;  3CCV Q;  1BCM A;  1M27 C;  4MZM A;  1S72 T;  2KK4 A;  4A4H A;  2CP7 A;  4LDV A;  2EPD A;  4M77 D;  2HBW A;  4XU3 A;  2QQ9 A;  4C92 F;  2E10 A;  3OQ5 A;  3OMG A;  3QO3 A;  2BIV A;  2HNI A;  5FRN A;  1G2B A;  4FCY A;  1W1F A;  4ZGD B;  1IZ6 A;  2D8J A;  3LGF A;  3BDU A;  1K0X A;  1SEM A;  1VQN Q;  2B86 A;  4M77 B;  5IT9 E;  2J7I A;  2BZ8 A;  2AHJ B;  3H0F A;  1WHG A;  5J3B A;  4JRI A;  3HFO A;  1CKB A;  1R0B G;  1OPK A;  3M55 A;  1EZZ B;  2EYQ A;  1BCO A;  3EH2 A;  1Q7Y C;  3NTK A;  1ZSZ C;  2RQU A;  1PSF A;  2RHZ A;  2LQW A;  3BDL A;  4R0K A;  2EVR A;  3G7Z A;  2QA4 A;  3CD6 A;  1X69 A;  4L5G A;  4F17 A;  2DLP A;  2FYK A;  3E19 A;  5I22 A;  1T0J A;  1LCK A;  2KAF A;  3CXC P;  1W2B S;  4DBH A;  1NBE B;  3CCM Q;  3A8O B;  1ZX6 A;  4M78 G;  2XU8 A;  1VOM A;  1IHW A;  5CAI A;  2EIF A;  2VYT A;  1UGP B;  3JAM E;  1BI2 A;  3CME Q;  1Q7Y R;  2X9H A;  4JJD A;  4FSS A;  2QDL A;  3CEY A;  3I56 T;  2DTI A;  1WXB A;  2LTO A;  2YWW A;  2RHY A;  1W6X A;  2RO0 A;  1M1K C;  5EC7 A;  2CS7 A;  1VQ9 A;  1WZO A;  1SPK A;  2KRO A;  2L3Q A;  2MK5 A;  4RTW A;  4FU6 A;  4F7U G;  2LDM A;  2C06 A;  3HP9 A;  3NTI A;  2JJ9 A;  5IHK A;  4AT1 B;  1QVG A;  2KBT A;  3EG9 B;  3I55 T;  1PD1 A;  1G8X A;  1VYT A;  2BTT A;  1BIB A;  4PJO D;  1E7O A;  3C12 A;  5C6S A;  5DM7 R;  2RD1 A;  2NUT B;  1Q82 U;  1M1K R;  1K73 U;  3JB9 F;  1WA7 A;  2RJD A;  2A28 A;  2BE7 D;  1W2B A;  1YP5 A;  4ZN3 A;  4JLI A;  1X01 A;  2DF6 A;  4JDS A;  1JBM A;  3X24 B;  1VQ5 T;  1PHT A;  1WI7 A;  2K3B A;  4LE9 A;  4BB7 A;  1ZSG A;  4PJO B;  1AT1 B;  4MDX A;  2KRM A;  2L89 A;  1Y7X A;  3G71 T;  1OU8 A;  1I5O B;  2EKH A;  4II1 A;  4PJJ A;  1VQP Q;  1VIE A;  2I2L A;  4KUD K;  1IB8 A;  1QP2 A;  2XDB A;  2G6F X;  3CC4 T;  2B8A A;  1QW1 A;  5FLX E;  2XI9 A;  2ECZ A;  1KFZ A;  4X34 A;  4HXJ A;  2D8H A;  3JCM g;  4DQ2 A;  3PNW C;  3PIP A;  1XTD A;  1VQK A;  3V7C A;  2LZ6 B;  2P84 A;  1UFF A;  5CKB A;  4EPC A;  3CMA T;  4KBM B;  1ZBJ A;  2EW3 A;  3QZ5 B;  3HHT B;  3MEW A;  4C92 G;  5CKD A;  2OTJ T;  4XTY A;  3GF5 A;  4NOY A;  3JCM W;  1BIA A;  1G5V A;  4M7D F;  2ZPE B;  1WNL A;  1XNI A;  2VC8 A;  4ME7 A;  2D1X A;  1X27 A;  1U1S A;  3G4S T;  1N0G A;  3EHR A;  3VRY A;  3CCQ A;  1VQ6 A;  3F70 A;  4CC4 B;  1YHQ T;  3A98 A;  2YRV A;  4HVU A;  1LPL A;  5HCK A;  4HCB A;  4ZNX A;  3T9N A;  3JCM P;  4M77 G;  5L23 A;  5GMK j;  3EAE A;  2D0N A;  3HL8 A;  4NL3 A;  1TWB A;  3PVQ A;  3J7A F;  3GLX A;  3OYF A;  4RTZ A;  1WPY A;  3QUI A;  2RI3 A;  1YIT T;  3ZFJ A;  1PM3 A;  2JT4 A;  5FU7 B;  2CP2 A;  1YJW Q;  4N4H A;  1NZ9 A;  3OMC A;  3CC2 T;  5GAN 7;  1RAC B;  1GCQ C;  3HRU A;  5DLQ E;  1UDL A;  2RI5 A;  2JOY A;  4B9X A;  4BE0 A;  1TXQ A;  2CP6 A;  1B34 A;  9ATC B;  3OYN A;  1KQ1 A;  2ZPH B;  2CUD A;  5GAM e;  3HTR A;  2K2V A;  4YTL A;  2GQI A;  5CO7 A;  3M0S A;  2AK5 A;  1VUB A;  2OAW A;  1ZSZ A;  2YDL A;  5GMK h;  3VRZ A;  1QCO A;  1OI1 A;  2BKD N;  2DJZ A;  2E5K A;  4D8K A;  1K9M U;  1QVG P;  4L6V 5;  1KG1 A;  3RIR A;  3QKJ A;  1BI0 A;  1PNJ A;  1D1B A;  2DYI A;  2C0T A;  4GLM A;  4F16 A;  4M75 E;  4OMQ A;  3S3N A;  4FYX B;  2YSQ A;  2R5A A;  1WID A;  4CC7 A;  1MMA A;  3DB3 A;  3VS3 A;  2QQR A;  5ECA A;  3PMT A;  3A8M B;  2RNA A;  1XOV A;  5IH2 A;  2YLB A;  5AT1 B;  1W2B P;  1ZA1 B;  4CI0 C;  1NM7 A;  3E2U A;  1GBR A;  1QKW A;  3JB9 G;  3ULR B;  2EKO A;  4OB0 B;  2MCN A;  1D1C A;  3JCM f;  4C0D B;  4PJO C;  1Q81 C;  1T3S A;  2J05 A;  1MGQ A;  2QEX T;  2NUP A;  2VKN A;  3PMI A;  1RLP C;  2EJF A;  1VQN T;  3VU3 C;  4LN2 A;  1CKA A;  2EJ9 A;  2CGH A;  4M7A E;  1AEY A;  2K5I A;  2ZPF B;  3DLL A;  1NYG A;  4BDZ A;  1YIJ A;  3L2R A;  4JZ3 A;  2JMC A;  2SEM A;  3OSV A;  1M90 U;  1S1N A;  2E5Q A;  2LVM A;  1YJN A;  3OYG A;  3QYG B;  4MZT A;  1JJ2 A;  1PWT A;  2H3J A;  4C8Q F;  1H92 A;  3LH5 A;  1MMG A;  3TSZ A;  1TUC A;  1Q81 R;  2X3W D;  2K2M A;  2FG0 A;  2K9G A;  2YXY A;  3L2Q A;  2EQM A;  4OGE A;  4DBQ A;  2CSI A;  3QYH B;  5CQX A;  2BE9 B;  4BUG A;  4ZTJ A;  1C6V X;  2HD0 A;  3OYC A;  1RAG B;  1VQL A;  5A0L A;  2V8K A;  4M7D G;  1U1T A;  2EQK A;  2CZ0 B;  2CUB A;  4ATO A;  2BUD A;  1NG2 A;  5GAN 4;  3M0U A;  3CME T;  2YUO A;  3H0H A;  5GAM d;  1YI2 A;  2PUO B;  1G3W A;  1MND A;  1HXD A;  2ED0 A;  1S72 A;  3KXT A;  5LJ3 e;  1I0C A;  1TS9 A;  3G71 Q;  1M3C A;  3UF4 A;  4N4G A;  4C5G A;  5GMK l;  1Y07 A;  3SWN C;  4A4F A;  1B34 B;  2COY A;  4QW2 A;  5M9O A;  2M16 A;  2DNU A;  2WSE E;  4M7A A;  5CQY A;  2DAQ A;  5HK3 A;  3GP8 A;  4E47 A;  1SG5 A;  3CMA Q;  4BI4 A;  3MP8 A;  2VVK A;  1YCS B;  3EHQ A;  1ACM B;  2LP5 A;  1WXU A;  4IIO A;  2OTJ Q;  3FJ5 A;  3H41 A;  4HCK A;  3TSW A;  3VUZ A;  5DLO A;  2JN0 A;  4R56 A;  2CRE A;  2DL5 A;  3KBG A;  3INZ A;  1RL2 A;  4M78 F;  2A0F B;  3G4S Q;  3CCU T;  3FB9 A;  1KQS A;  1FXX A;  2DM1 A;  2ZPI B;  4LD9 K;  1GCQ A;  2HQH A;  5GAN j;  2D6F A;  3QDR B;  1JXM A;  4M4Z A;  4MDW A;  2M02 A;  4IUT A;  2P0K A;  5LJ3 h;  2QAZ A;  4LUD A;  5HY6 A;  3CPW S;  1MUZ A;  1NLP C;  3MPU B;  1K8A C;  2IVW A;  1BKB A;  3P8D A;  4WCI A;  1UHC A;  2EGE A;  3PVL A;  4JJB A;  2CP0 A;  1ABO A;  4EDU A;  3S3O A;  2A36 A;  5IXF A;  2L5Q A;  3I56 A;  2XG8 D;  3SD4 A;  2VB6 A;  1ZUY A;  4OMN A;  3EG3 A;  1JEG A;  1JO8 A;  4M7D E;  2KI7 A;  3EGD A;  2R58 A;  5GAN h;  2J6O A;  1K8A R;  5A0G A;  3JCM X;  2VGM A;  1WHL A;  1PD0 A;  1RI9 A;  1WGS A;  1D09 B;  3I55 A;  4E7K A;  1JJ2 P;  5LJ5 j;  1GFD A;  2RPN A;  3C94 A;  1Q81 U;  2DRK A;  1PKS A;  3QG1 A;  1N9R A;  4J9E A;  4XK8 E;  2JUF A;  5LJ3 d;  1M4Z A;  4AG1 C;  4Z8A A;  5GAO r;  4ZTF A;  1VQ8 Q;  5KCH A;  3FIF A;  1WHM A;  4C8Q G;  1Y57 A;  1BB9 A;  4AMC A;  1YJW T;  4RG8 A;  1VQ5 A;  2HAX A;  3OW2 P;  2E3H A;  4J6X A;  3FEO A;  2ZPB B;  5IHN A;  2G3R A;  3I35 A;  1KC8 C;  1EX4 A;  4J9H A;  4R55 A;  2X51 A;  3PT9 A;  1FX7 A;  1N0E A;  1GRI A;  2LJ0 A;  4J6W A;  2QTV A;  3LWH A;  4RCB A;  2RJF A;  1UGQ B;  4O6J A;  3RMQ A;  2JS0 A;  1Z9Q A;  2RHU A;  1K76 A;  5A2Q E;  3J80 E;  3M59 A;  5LJ5 h;  5GAN f;  1VQM T;  2LQ8 A;  5A0D A;  5GAN d;  5GJV B;  3H8Z A;  1H3Z A;  4F04 B;  3CC4 A;  1VQ7 T;  4M7A D;  3M4G A;  2JM9 A;  4BD3 A;  1K9A A;  1FWZ A;  2QEX Q;  3JCM J;  3VS5 A;  2I0N A;  4ZGE B;  2JM8 A;  3GNG A;  1RUW A;  3SHW A;  4BE2 A;  1GL5 A;  1NE8 A;  1WJS A;  4FYV B;  2LT4 A;  2QTX A;  1KC8 R;  2BZY A;  4EMK C;  5CK9 A;  4FW2 A;  2A08 A;  1KIK A;  4M77 F;  3JV3 A;  3OS2 A;  2C1L A;  3THK A;  2YUN A;  4M7A B;  1RAI B;  1VIF A;  4J9G A;  3GPL A;  2KDS A;  1OOT A;  4KUI A;  3OS1 A;  2XKO C;  1YHQ A;  2JW4 A;  2FL7 A;  3FJP A;  2R5M A;  1W70 A;  1VQ4 A;  1FMW A;  3TCJ A;  3GBQ A;  1OQK A;  1YFN A;  1Q86 C;  4X1V A;  5AYF A;  3JB9 I;  3L2U A;  1KQS P;  2OTL A;  1WX6 A;  4DBF A;  2L0A A;  5LJ5 f;  1N8R U;  5LJ5 d;  3CCJ A;  2L3R A;  3SWN A;  2WAC A;  1YIT A;  3FLG A;  3OSS C;  2F2X A;  2DVE A;  3CC2 A;  4IUR A;  2DIG A;  1M8V A;  3WXM B;  1MV3 A;  3MEA A;  2ZGW A;  3CBP A;  1Q86 R;  4JJN K;  2DKG A;  2PUK B;  2DE0 X;  2NUZ A;  2A3L A;  3QXE B;  3QII A;  1ZUK A;  2F69 A;  2RHI A;  2CSQ A;  1AD5 A;  4JRP A;  3HRS A;  3LW5 E;  4PL6 A;  1V1C A;  3RR6 A;  1NA6 A;  3EGD B;  4BY6 B;  2LCS A;  3C95 A;  3RES A;  1ZHI A;  3CCS T;  3CCR Q;  4IUQ A;  2QXF A;  3EGX A;  2OAU A;  1E6H A;  2XID A;  4XU0 A;  1I07 A;  3CCE T;  1IGU A;  1M1F A;  1Y0M A;  1BI3 A;  4J83 A;  4A54 A;  4XQ3 A;  5GAO q;  2O4X B;  2DER A;  3H6Z A;  4ZGJ B;  3CCV A;  1B7T A;  1OU9 A;  3PGG A;  1QVF S;  2DX1 A;  3CCU Q;  3QSU A;  4E7S A;  4LDY A;  1NPR A;  3OYE A;  3LLR A;  4PJO F;  2CP3 A;  4GLK A;  4FT4 A;  1JXO A;  1PCX A;  3OA6 A;  1SSF A;  5KYN A;  1KD1 C;  1IO6 A;  1IRX A;  1KJW A;  1WJQ A;  2RB6 A;  3OYB A;  2DFU A;  4RTU A;  5KYX B;  3QDF A;  2QEX A;  4M75 C;  6AT1 B;  1VQN A;  5D7U A;  2LJ3 A;  4QVC A;  3X20 B;  1UGR B;  1D0Y A;  1WYX A;  3OYH A;  4BDY A;  1KHC A;  5I11 A;  3VS0 A;  2FPD A;  2DXU A;  2AT1 B;  1OX8 A;  3TRE A;  3VYG A;  4CC3 A;  3EFR A;  3A8H B;  1QCN A;  2PNI A;  4A4G A;  3O8V A;  4IUU A;  1VQO Q;  3REB B;  2VAS A;  4EMH A;  2KE9 A;  2RMO A;  1KD1 R;  2JNG A;  3PTA A;  4M78 E;  4QKU A;  4O5V A;  2JTF A;  3NPF A;  4J9B A;  2EQU A;  2MIO A;  2KVQ G;  4FM4 B;  3E9F A;  3JCM e;  3I5R A;  1UGS B;  2F5T X;  3QWY A;  1OUL A;  2K3X A;  4M7A C;  3DKM A;  2DTO A;  2DXB A;  3DLM A;  3CCM A;  5D6Y A;  2KXD A;  3E1S A;  3A8L B;  3L2V A;  2CZ6 B;  3QZ9 B;  4F7U E;  2PTK A;  1RAD B;  3CME A;  5CVI A;  1MHN A;  4OB2 B;  1M3B A;  1FMK A;  4NS5 A;  2EWN A;  2DZ9 A;  1UG1 A;  4OP0 A;  1GFC A;  2LC4 A;  1M8M A;  1SHG A;  3SWN B;  3OYY A;  4IIM A;  5GAM g;  2LT1 A;  4EMK A;  1Q7Y U;  4XTW A;  3MEV A;  3PE0 A;  1HK9 A;  2O9V A;  2FHD A;  2KT1 A;  5GAO p;  1AWO A;  1U06 A;  3I9Q A;  4LD6 A;  3EG0 A;  2EGA A;  1YJ9 Q;  2GFA A;  1VQM Q;  2VXE A;  2LCC A;  1VQ7 Q;  3G6E Q;  5FU6 C;  1VQ8 T;  5GAM j;  1HJD A;  1G83 A;  1B07 A;  1M30 A;  3X26 B;  3NMZ C;  2FO0 A;  4BY6 C;  4BAC A;  2HBP A;  3CC7 Q;  1M1G A;  4JS5 A;  4JUV A;  1M1K U;  3UAT A;  1D0Z A;  3EGX B;  1SRM A;  2YT6 A;  1Z9Z A;  1G3S A;  5CCA A;  2DXC A;  1VQP A;  1D3B A;  4D8D A;  2YUQ A;  2DRM A;  1BK2 A;  4AFU C;  1W4S A;  4KT0 E;  3CBO A;  3NHN A;  2X35 A;  4C92 E;  3HQF A;  3V7S A;  1AHJ B;  1QLY A;  1SF9 A;  4XU2 A;  3RER A;  2VWF A;  2D0Q B;  2RQR A;  4F14 A;  5J26 A;  2JTM A;  1J3T A;  1NJI C;  2L8D A;  2M9U A;  2MOX A;  4VUB A;  4WF2 A;  4F7U A;  5GAM h;  4RUG A;  2AZV A;  5KYU B;  4OML A;  2Y90 A;  1PRM C;  1XJW B;  3CCL Q;  4OB1 B;  4MMK A;  4BE1 A;  4PJO G;  4JLG A;  3RKW A;  2EYZ A;  2GGR A;  2L2P A;  4M77 E;  4A53 A;  3L1A A;  4C5E A;  1C1A A;  4E7Z A;  1U5S A;  4RTT A;  1R77 A;  2VV5 A;  3OBW A;  1NJI R;  1VQK T;  1N6A A;  3CPF A;  2JMA A;  5C0M A;  2RA2 A;  2FRW A;  3C0C A;  1WIE A;  4NL2 A;  5GMK m;  4JRQ A;  2F2W A;  3QJY A;  3P8B B;  2J6F A;  2IG0 A;  1WQW A;  3CCS Q;  1X75 C;  1X2Q A;  3QJ6 A;  3R6N A;  1CSK A;  3M54 A;  1OZ3 A;  1RAH B;  3JSC A;  3CCQ T;  3RBB B;  4M75 A;  3CCE Q;  1YJW A;  3H0I A;  5GAM f;  4L59 A;  2OX7 A;  5LJ3 g;  2E41 A;  2H8H A;  4J8O A;  1SSH A;  4IUV A;  3U23 A;  2XIC A;  2EAY A;  2CZ7 B;  4J9C A;  3BY7 A;  2M51 A;  1U3O A;  4OF1 A;  3S6W A;  3QBY A;  1AZE A;  2P0Q A;  3V8K A;  2WSC E;  2MMP A;  3CXC S;  2DTH A;  2DEU A;  4C92 A;  2CDT A;  1N27 A;  3VKI A;  4EMK B;  4OMO A;  3L42 A;  4BI8 B;  1HSQ A;  2BZX A;  2FPF A;  2MI6 A;  5LJ3 j;  4LUE A;  4Q5W A;  5IHI A;  5GAN g;  4AFS C;  3ASK A;  3NTH A;  3CCR T;  1UHF A;  2QQB A;  2QI2 A;  5FWC A;  3C4S A;  2QG9 B;  1JU5 C;  2HL3 A;  3HSB A;  1OEB A;  3DB4 A;  3M56 A;  2WSF E;  4PFP A;  2YLC A;  2F1L A;  3OYA A;  1ABQ A;  2P4T A;  3SDZ A;  1Q95 G;  3VYH B;  1X6B A;  4DEX A;  5HKC A;  2R57 A;  4E2F B;  7AT1 B;  3UPU A;  1ZA2 B;  1DJ7 B;  5I21 A;  1UE9 A;  2K57 A;  2KRN A;  3M5A A;  2E4H A;  4HVW A;  2ZAE A;  1YNZ A;  2HCK A;  2C0I A;  5KYY B;  3G1J A;  2COW A;  2PU9 B;  4J6Y A;  5KYW A;  4AFZ C;  3MKD A;  1D3B B;  3QWX X;  3VS2 A;  1HYO A;  1BBZ A;  1TU0 B;  1H8K A;  2RHX A;  3JCM Q;  2KT8 A;  5J39 A;  2LQK A;  1NEB A;  3OYJ A;  2QA4 Q;  3CD6 Q;  4DOV A;  5LJ5 g;  1MMD A;  4FYY B;  4X9C A;  4J5Y A;  2XK0 A;  4F7U B;  1VQO T;  2AZS A;  2GBQ A;  4LDX A;  2QQS A;  3MCA B;  3HPW A;  4PLL A;  2E6N A;  3OS0 A;  2NYS A;  4UC4 A;  4Z02 A;  2COZ A;  1PRL C;  2QAS A;  2NWM A;  3A5Z B;  2ROT A;  1Q82 C;  3M0T A;  1VYU A;  2GTJ A;  1VYV A;  2YRC A;  4MZP A;  2V26 A;  2HKN A;  3RKY A;  5GAN 8;  1YIJ T;  2CT3 A;  3SFM A;  1G3T A;  3KUF A;  2E64 A;  4P5N A;  1V76 A;  4QT7 A;  3TQ7 P;  2LCL A;  2Y4X A;  2PVO B;  1I5L A;  3PFS A;  2HDA A;  2M0Y A;  2LRQ A;  4M75 D;  5LJ3 f;  1VQ9 Q;  2O4X A;  2HSE B;  2W10 A;  2MYS A;  3CPW A;  3LX7 A;  3M53 A;  2MF2 A;  2ATC B;  2RQW A;  1SHF A;  3CQT A;  2MPX C;  3GNF B;  4WTO B;  4E7L A;  2DEQ A;  1MV0 B;  1UTI A;  3JB9 H;  3G71 A;  1M9S A;  4M75 B;  1C0M A;  4C92 D;  2QGG A;  2CKK A;  2DBM A;  1UJY A;  5KYX A;  1RLQ C;  1UEC A;  2IIM A;  1RI0 A;  2FVU A;  1IXD A;  5CKE A;  1X6O A;  2C0O A;  5GAN 6;  4BI3 A;  3TEE A;  1YJ9 T;  1WFW A;  5IAY A;  1QCF A;  2RH2 A;  1PKT A;  4KGZ B;  5GAO l;  1YI2 T;  1IRE B;  4LNP A;  4J9F A;  5LL6 S;  3EG2 A;  1I81 A;  5GAN 3;  3G6E T;  3OYL A;  2AIR B;  4C92 B;  2DBK A;  4HA8 A;  2O88 A;  2GCX A;  3CMA A;  1P92 A;  1JRI A;  2FEI A;  3VS6 A;  1UGV A;  2OTJ A;  4RTV A;  3CBM A;  2V1Q A;  3IQL A;  1K1Z A;  2M0O A;  3VS7 A;  2K7A A;  4FSX A;  3CC7 T;  4M7D A;  2W0Z A;  2PZ1 A;  4CC2 A;  3G4S A;  1KSW A;  1QWF A;  4M7A F;  1UB4 A;  3EFO B;  1IHV A;  2X4J A;  1I1J A;  3OY9 A;  1VQK Q;  3VS4 A;  2RK1 A;  3QPH A;  1M5Q 1;  1TOV A;  2CP5 A; 
#chains in the Genus database with same CATH homology
 3BW1 A;  3VU3 C;  3WVD B;  1QVG S;  4QVZ A;  3BFM A;  5KE2 A;  5IN1 A;  2EJ9 A;  2JNG A;  2RI2 A;  2CGH A;  4M7A E;  3PTA A;  4M78 E;  2K5I A;  2ZPF B;  1WQ7 A;  3DLL A;  4O5V A;  2JTF A;  4BDZ A;  1YIJ A;  3FRN A;  4MML A;  3L2R A;  2EQU A;  2KVQ G;  3A8G B;  4FM4 B;  3E9F A;  3OSV A;  2GQV A;  3JCM e;  3CCL T;  1M90 U;  4F7U F;  1UGS B;  2F5T X;  2E5Q A;  2LVM A;  2K3X A;  3OYM A;  3X25 B;  1TH7 A;  3OYG A;  1YJN A;  3MP6 A;  2KSS A;  3QYG B;  1BI1 A;  4M78 C;  4MZT A;  4M7A C;  3V8J A;  3DKM A;  2H3J A;  3JB9 J;  1JJ2 A;  2DTO A;  2DXB A;  4QQG A;  4C8Q F;  3DLM A;  1K73 C;  3CCM A;  3MO8 A;  3VV0 A;  1H64 1;  2RM4 A;  4LDW A;  5D6Y A;  3J81 E;  4RG2 A;  4C0D C;  3E1S A;  3A8L B;  2GF7 A;  2CZ1 B;  1KQ2 A;  3L2V A;  2CZ6 B;  3QZ9 B;  2MWO A;  4F7U E;  5LJ5 e;  1UEB A;  3L2Q A;  2EQM A;  4OGE A;  5CVI A;  3CME A;  1MHN A;  3P8H A;  4LDU A;  4OB2 B;  3QYH B;  5CQX A;  1K9M C;  4KUL A;  4NS5 A;  4BUG A;  1NJI U;  1I8F A;  5FU6 B;  1Y96 B;  2EWN A;  2DZ9 A;  2HD0 A;  4GY5 A;  4OP0 A;  4XTV A;  4ZTJ A;  3OYC A;  1YJN T;  1VQ5 T;  5GAO m;  3OYK A;  4N4I A;  4C8Q E;  3CCS A;  1VQL A;  2X4Y A;  2A7Y A;  5A0L A;  2V8K A;  2EFI A;  2LC4 A;  3SWN B;  4M7D G;  1U1T A;  2EQK A;  2CZ0 B;  2RJC A;  2MAM A;  2KMT A;  3OYY A;  3CCE A;  2XHC A;  4ATO A;  2BUD A;  5GAM g;  2LT1 A;  2VXF A;  4EMK A;  1Q7Y U;  5GAN 4;  1U8R A;  5CIU A;  1K8A U;  1I4K 1;  4XTW A;  3MEV A;  2DIQ A;  5GAN 5;  2K4Y A;  3CME T;  3AHU A;  1PSE A;  2EJG A;  4C8Q C;  1HK9 A;  4FIB A;  3V8L A;  2FHD A;  5GAM d;  5GAO p;  3JB9 D;  1VQ8 A;  3PIO A;  2MWP A;  4LD6 A;  5KCO A;  4C0F A;  4XTX A;  1VQL T;  4RKU E;  4HCC A;  2PVD B;  2PUO B;  2FB7 A;  1G3W A;  1YI2 A;  5I2M A;  3JRZ A;  2GFA A;  1HXD A;  4HT9 A;  3JCM b;  4N0A A;  2JZ2 A;  3KXT A;  5LJ3 e;  1S72 A;  5I2S A;  4E7H A;  3UT1 A;  3ME9 A;  2VXE A;  4OVA A;  2LCC A;  2PVG B;  4D6W A;  4PJO A;  3NFC A;  4JRK A;  4M75 F;  4I1K A;  3L2Z A;  3R6O A;  4N4G A;  4IKF A;  2YHT A;  5FU6 C;  4ELY C;  5KH6 A;  1VQ8 T;  4C5G A;  5GMK l;  5GAM j;  1Y07 A;  5GMK i;  2GFU A;  3LWI A;  4B9W A;  4PLI A;  3OB9 A;  1EIF A;  1ZBX A;  3SWN C;  2X4X A;  5FRO A;  5CKH A;  3HFN A;  3JCM c;  4MZM A;  4A4F A;  1S72 T;  1B34 B;  2KK4 A;  4A4H A;  4QW2 A;  3X26 B;  5M9O A;  2M16 A;  1NPP A;  4LDV A;  4M77 D;  4BY6 C;  4BAC A;  2HBP A;  1M1G A;  4XU3 A;  2WSE E;  4JS5 A;  4JUV A;  4XU1 A;  2QQ9 A;  4IUP A;  3OYD A;  4E7I A;  1M1K U;  4C92 F;  4M7A A;  2Y4Y A;  2E10 A;  4HT8 A;  3OQ5 A;  5CQY A;  1M90 C;  1OYX A;  1G3S A;  2DAQ A;  3OMG A;  3QO3 A;  5CCA A;  2BIV A;  2HNI A;  2DXC A;  5HK3 A;  4E47 A;  3GP8 A;  5FRN A;  3N5B B;  3V7R A;  4BI4 A;  3MP8 A;  1D3B A;  1VQP A;  4ZGD B;  1IZ6 A;  5DLO A;  2HQE A;  3VUZ A;  1W4S A;  2ZCF B;  3LGF A;  4DA4 A;  3BDU A;  2JN0 A;  4R56 A;  4KT0 E;  3CBO A;  2X35 A;  4C92 E;  3HQF A;  3KBG A;  3V7S A;  3INZ A;  1AHJ B;  1RL2 A;  4M78 F;  4RCC A;  4XU2 A;  2M1H A;  4M77 B;  4M7D D;  4M75 G;  3RER A;  5IT9 E;  3X28 B;  3CCU T;  2D0Q B;  3FB9 A;  2V8I A;  2JTM A;  5J26 A;  1FXX A;  1KQS A;  4A4E A;  2ZPI B;  1NJI C;  2L8D A;  2M9U A;  3M9Q A;  2AHJ B;  5GAN j;  4LD9 K;  4VUB A;  2D6F A;  4WF2 A;  5J3B A;  4F7U A;  5GAM h;  3QDR B;  4JRI A;  1KC8 U;  3HFO A;  4MDW A;  2Y90 A;  4IUT A;  4HKE A;  3M55 A;  4OB1 B;  4C92 C;  2P0K A;  2EYQ A;  4MMK A;  1GXI E;  5LJ3 h;  2QDY B;  5D6W A;  5HY6 A;  4C8Q A;  3CPW S;  4BE1 A;  3UWN A;  4TVR A;  4PJO G;  1Q7Y C;  3FC3 A;  4JLG A;  4DOW A;  1K8A C;  2IVW A;  3NTK A;  3RKW A;  4FT2 A;  3VJP A;  2XD0 A;  1BKB A;  1PSF A;  2RHZ A;  3BDL A;  4M7D B;  4M77 E;  3P8D A;  4A53 A;  2QA4 A;  3G7Z A;  2E1H A;  3CD6 A;  3L1A A;  4L5G A;  4C5E A;  4FL6 A;  4EDU A;  1V29 B;  1QVF A;  4OB3 B;  3S3O A;  5GMK e;  2FYK A;  3E19 A;  2KAF A;  1W2B S;  2JVV A;  2VV5 A;  2L5Q A;  1WJR A;  3OBW A;  3I56 A;  4QQD A;  2XG8 D;  4M77 C;  3SD4 A;  1VQK T;  2DK3 A;  1N6A A;  1N9S A;  2DXT A;  2ZPG B;  1Y71 A;  3UDC A;  3OYI A;  3CPF A;  3A8O B;  4M7A G;  4M78 G;  2XU8 A;  2RA2 A;  5C0M A;  2QA4 T;  1LNX A;  1LOJ A;  1VQ4 T;  3CD6 T;  4M7D E;  4C5I A;  5CAI A;  4NL2 A;  2EIF A;  2VYT A;  1UGP B;  3JAM E;  3GIB A;  1BI2 A;  5GMK m;  4JRQ A;  2R58 A;  3QJY A;  5GAN h;  3P8B B;  2IG0 A;  1YCY A;  5A0G A;  1JB0 E;  1WQW A;  3JCM X;  2VGM A;  3CEY A;  1X75 C;  3I56 T;  2DTI A;  2OTL T;  3QJ6 A;  2LTO A;  3M54 A;  2RHY A;  1OZ3 A;  1R8O B;  4J7F A;  1WGS A;  3JSC A;  3CCJ T;  2RO0 A;  3I55 A;  3CCQ T;  4E7K A;  4M75 A;  5LJ5 j;  1M1K C;  4CRI A;  5EG2 A;  1YJW A;  5GAM f;  2CS7 A;  4L59 A;  3JCM V;  5LJ3 g;  1VQ9 A;  2E41 A;  3C94 A;  3RKX A;  1Q81 U;  3QG1 A;  1N9R A;  4IUV A;  4J8O A;  4XK8 E;  4FU6 A;  2XIC A;  4F7U G;  1YEL A;  2EAY A;  2JUF A;  2CZ7 B;  2LDM A;  3BY7 A;  2C06 A;  5LJ3 d;  1M4Z A;  5GAO r;  4ZTF A;  2LX9 A;  3HP9 A;  1Q86 U;  3FDR A;  3NTI A;  4OF1 A;  5KCH A;  3MET A;  3FIF A;  3S6W A;  1QVG A;  4XTU A;  3QBY A;  4J7I A;  4C8Q G;  2VGN A;  2P0Q A;  2QQA A;  3V8K A;  2WSC E;  2MMP A;  3CXC S;  3I55 T;  2DZC A;  2DTH A;  2XDD A;  2E6Z A;  3CCR A;  1YJW T;  4RG8 A;  1BIB A;  1VQ9 T;  1VQ5 A;  2HAX A;  4PJO D;  1XQH A;  4C92 A;  4J6X A;  3FEO A;  2ZPB B;  1N27 A;  2G3R A;  3VKI A;  2E65 A;  3JCM h;  4ELZ C;  3C12 A;  3ZBD A;  4EMK B;  3L42 A;  5C6S A;  1KC8 C;  4BI8 B;  5DM7 R;  4R55 A;  3WVE B;  2RD1 A;  2HQX A;  3QHS A;  1Q82 U;  2MI6 A;  5LJ3 j;  2CYZ B;  1K73 U;  3PT9 A;  1FX7 A;  3JB9 F;  2RJD A;  4PKC C;  1QVP A;  2P0P A;  1W2B A;  4Q5W A;  2O01 E;  3MHX A;  4J6W A;  4V2S A;  5GAN g;  4ZN3 A;  3LWH A;  4RCB A;  1G3Y A;  2RJF A;  4JLI A;  1UGQ B;  4ZN1 A;  4O6J A;  1X01 A;  3RMQ A;  4JDS A;  2RHU A;  2EQJ A;  3ASK A;  1O75 A;  1JBM A;  2PQW A;  3NTH A;  4M78 A;  2QQB A;  3X24 B;  2QI2 A;  5A2Q E;  3J80 E;  4HCZ A;  3M59 A;  5LJ5 h;  5GAN f;  3CCU A;  1VQM T;  3C4S A;  2LQ8 A;  5A0D A;  5GAN d;  4BB7 A;  3H8Z A;  1H3Z A;  1JJ2 S;  3HSB A;  3ZEH A;  2ZZD A;  3CC4 A;  4PJO B;  1VQ7 T;  4M7A D;  3M4G A;  4MDX A;  4BD3 A;  2L89 A;  1Y7X A;  3G71 T;  1FWZ A;  3Q1J A;  3DB4 A;  3M56 A;  2WSF E;  3OBY A;  3VUB A;  3JCM J;  3M58 A;  4II1 A;  4ZGE B;  2YLC A;  1VIE A;  2K3Y A;  3GNG A;  3OYA A;  4BE2 A;  3RMS A;  2P4T A;  2NLU A;  3SDZ A;  3VYH B;  2RK2 A;  5HKC A;  1NE8 A;  1WJS A;  2R57 A;  2I2L A;  2LT4 A;  2QTX A;  4Y28 E;  4KUD K;  3CCV T;  3UPU A;  1QP2 A;  2XDB A;  1DJ7 B;  4EMK C;  5CK9 A;  5I21 A;  2K57 A;  3M5A A;  4M77 F;  3CC4 T;  2F5K A;  3OS2 A;  2B8A A;  1QW1 A;  5FLX E;  2XI9 A;  3OW2 S;  4M7A B;  4X34 A;  4E7J A;  1VIF A;  3JCM g;  4DQ2 A;  3PNW C;  2PU9 B;  4J6Y A;  3PIP A;  3GPL A;  1XTD A;  1VQK A;  2KDS A;  1VQO A;  1D3B B;  3V7C A;  4KUI A;  5CR2 A;  5CKB A;  4EPC A;  2XKO C;  3OS1 A;  1YHQ A;  3CMA T;  2FL7 A;  3FJP A;  3QZ5 B;  4KBM B;  3JCM d;  2R5M A;  4C8Q D;  2V8J A;  3HHT B;  2RHX A;  3M4Y A;  3MEW A;  4C92 G;  5CKD A;  1VQ4 A;  4XTY A;  3GF5 A;  3JCM Q;  5CKF A;  2OTJ T;  4NOY A;  3JCM W;  5J39 A;  3TCJ A;  3OS5 A;  1BIA A;  1ZQ1 A;  1G5V A;  4M7D F;  5DY9 A;  2LQK A;  2ZPE B;  3OYJ A;  1WNL A;  1XNI A;  4DOV A;  2VC8 A;  4ME7 A;  5LJ5 g;  4X9C A;  5GAN 2;  1Q86 C;  1U1S A;  4OGC A;  5AYF A;  3JB9 I;  4J5Y A;  3L2U A;  1Y96 A;  3G4S T;  2OTL A;  2XK0 A;  4C0G A;  5LJ5 f;  4QQ6 A;  4F7U B;  1VQO T;  5LJ5 d;  2KQW A;  3CCJ A;  3CCQ A;  1N8R U;  1VQ6 A;  3LYI A;  2L3R A;  3F70 A;  1KD1 U;  3SWN A;  2QQS A;  3MCA B;  1YHQ T;  4LDX A;  3HPW A;  4PLL A;  2E6N A;  2YRV A;  3OS0 A;  2WAC A;  1YIT A;  3GOX A;  3FLG A;  4UC4 A;  4Z02 A;  5FRM A;  4HCB A;  4C8Q B;  3T9N A;  3OSS C;  1O9S A;  3A5Z B;  4M77 G;  3JCM P;  5GMK j;  2DVE A;  1Q82 C;  3CC2 A;  3EAE A;  4QVD A;  5HK0 A;  4IUR A;  3HL8 A;  4NL3 A;  4EMG A;  2LNV A;  3HKS A;  4RMO A;  4MZP A;  2DIG A;  3RKY A;  3GLX A;  5GAN 8;  3OYF A;  1YIJ T;  3J7A F;  3WXM B;  3SFM A;  1G3T A;  5L8R E;  4M7D C;  1VQ6 T;  1M8V A;  3KUF A;  2E64 A;  4P5N A;  1WPY A;  3MEA A;  3QUI A;  2LCL A;  2ZGW A;  2RI3 A;  2DPP B;  2Y4X A;  1YIT T;  3CBP A;  2PVO B;  3RUX A;  3ZFJ A;  4JJN K;  3PFS A;  1I5L A;  5KE3 A;  2DKG A;  2PUK B;  2A3L A;  5FU7 B;  1BYM A;  3SB2 A;  2LRQ A;  4M75 D;  4XAX B;  5LJ3 f;  4N4H A;  3QXE B;  1NZ9 A;  2O4X A;  3QII A;  3OMC A;  3CC2 T;  5GAN 7;  2F69 A;  2RHI A;  2DO3 A;  3CCM T;  3OW2 A;  3HRU A;  5DLQ E;  3L2W A;  4JRP A;  3HRS A;  3LW5 E;  4OMF B;  4PL6 A;  2E12 A;  3M57 A;  2RI5 A;  2JOY A;  4B9X A;  4C5H A;  4BE0 A;  1VQN T;  3CPW A;  1NA6 A;  3LX7 A;  4JS4 A;  3M53 A;  2MF2 A;  4BY6 B;  1B34 A;  1KQS S;  3OYN A;  1KQ1 A;  1YJ9 A;  5D6X A;  3C95 A;  2VUB A;  2ZPH B;  3RES A;  1VQM A;  5GAM e;  3GNF B;  1ZHI A;  4E7L A;  3CCS T;  2DEQ A;  2K2V A;  3HRT A;  4YTL A;  1VQ7 A;  4X9D A;  5CO7 A;  2RJE A;  4IUQ A;  1VUB A;  2QXF A;  3G71 A;  3JB9 H;  1M9S A;  4M75 B;  2OAU A;  2XID A;  4XU0 A;  4C92 D;  5GMK h;  3G6E A;  2CKK A;  3CCE T;  1LJO A;  2XDP A;  4XTZ A;  2BKD N;  1M1F A;  1OI1 A;  2DJZ A;  1RI0 A;  1BI3 A;  4J83 A;  4A54 A;  4XQ3 A;  2FVU A;  5CKE A;  1OZ2 A;  1X6O A;  2O4X B;  5GAN 6;  4BI3 A;  5GAO q;  3H6Z A;  3TEE A;  1YJ9 T;  4ZGJ B;  3CCV A;  1K9M U;  5FU7 C;  5IAY A;  4L6V 5;  2RH2 A;  3PGG A;  3LH0 A;  5GAO l;  3TU4 K;  1QVF S;  3RIR A;  1YI2 T;  1KG1 A;  1IRE B;  1BI0 A;  3QKJ A;  1QP3 A;  4M78 D;  4M77 A;  3QSU A;  4LDY A;  5LL6 S;  3CCR T;  3MEU A;  1NPR A;  3CC7 A;  1I81 A;  3MP1 A;  5GAN 3;  3OYE A;  3G6E T;  3LLR A;  3OYL A;  4M75 E;  4PJO F;  3S3N A;  4C92 B;  4GLK A;  4FT4 A;  2R5A A;  4HA8 A;  3OA6 A;  1SSF A;  1WID A;  1N8R C;  3DB3 A;  1KD1 C;  2K5L A;  2GCX A;  2QQR A;  3CMA A;  1P92 A;  1JRI A;  3PMT A;  3A8M B;  1WJQ A;  1XOV A;  2RB6 A;  4PNO A;  4A4K A;  2YLB A;  3OYB A;  2OTJ A;  3CBM A;  2QEX A;  5GAN e;  3EFS A;  2M0O A;  4M75 C;  4PJO E;  4CI0 C;  1VQN A;  4FSX A;  4QVC A;  3CC7 T;  4M7D A;  3X20 B;  4M78 B;  1UGR B;  2DD5 A;  3OYH A;  1YBY A;  4BDY A;  3G4S A;  1KHC A;  4Y91 A;  3JB9 G;  2EKO A;  4OB0 B;  2KY9 A;  2DXU A;  4N0A C;  4M7A F;  3TRE A;  2D9T A;  1KHI A;  1UB4 A;  3LGL A;  3EFR A;  3JCM f;  3VYG A;  2K5F A;  4C0D B;  4C0Z A;  3CXC A;  2X4J A;  3A8H B;  2E70 A;  5GAO n;  4PJO C;  4A4G A;  3O8V A;  2DD4 A;  3OY9 A;  1Q81 C;  3CCL A;  1MGQ A;  4IUU A;  2RK1 A;  2X4W A;  3PMI A;  3QPH A;  1M5Q 1;  3URG A;  2QEX T;  3S3M A;  1VQP T;  4EMH A;  3E9G A;  3ER0 A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...