4LDXA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1 (arf1) in complex with protomor-like sequence er7
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
341
structure length
332
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Auxin response factor 1
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 75
structure length 332
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldxA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldxA02
4I1KA 1NA6A 4LDYA 4LDWA 4LDVA 1WIDA 1YELA 4LDXA 3HQFA 4LDUA
chains in the Genus database with same CATH superfamily
1N27A 4JRPA 2R5MA 1JQQA 1WI7A 3HP9A 2VGMA 1UFFA 8AT1B 1VQPQ 1YITQ 2LQWA 2LJ1A 4PFZA 1SKUB 2DVEA 2L5QA 1PRMC 1RLPC 5DLOA 3M0PA 1UB4A 4FM4B 2XKOC 5KYUB 1RAFB 1UUEA 3C12A 3OA6A 1Q82R 2CT4A 2LVMA 1WHJA 1AT1B 2X4JA 4L5GA 1PSFA 1R0CB 3VS4A 2HBPA 1WHKA 1UE9A 4XTXA 4AFQC 4OGCA 3DKMA 4E7KA 3HTRA 2F2VA 2V1QA 4BE1A 2BZYA 1SHFA 1MV3A 5GAOl 3M58A 2GQVA 3OS2A 1M8VA 3OYAA 2DFUA 3REAB 4C8QC 2K5IA 2QEXQ 1WXBA 1HK9A 2JT4A 2YLBA 3VJPA 1QWEA 2KE9A 5GMKh 2XDBA 2O88A 3INZA 2EQKA 5GAMd 2E5KA 2KSSA 3OYIA 2LCLA 1RUWA 4BI4A 2QQAA 2CREA 4OVAA 3OY9A 2OAWA 3QDRB 4HVWA 2EGAA 2ZCFB 1H92A 2DPPB 1M90U 3I5RA 2YRCA 1YJ9A 1UGVA 4PJOB 4M78B 3NMZC 2E3HA 4BD3A 4A4KA 1O9SA 3EFSA 3M0RA 1NBEB 4FCYA 4OMNA 1Y71A 2K2VA 2IPOB 2E6ZA 4EIKA 5CVIA 2EVRA 4C8QA 1GL5A 2EGCA 3RKWA 1RACB 1KC8U 2KEAA 1QW1A 2K79A 2RQVA 3EG1A 3CCJQ 1AWJA 3RNJA 2XK0A 4RCBA 3X26B 1K9MU 1KHCA 1M2VA 2QGFB 2ZPFB 3OSVA 1SRLA 3MEUA 2QA4A 1U06A 4X34A 3TSWA 1WHGA 1VQMQ 5GMKi 2DETA 1ABQA 2QQ9A 4M4ZA 4XTZA 1YJNA 2A3LA 2AHJB 1SPKA 1XNIA 3CPFA 3FEOA 4FYVB 1ZSGA 5IH2A 2A28A 3DLLA 2SRCA 1YIJA 2J6KA 2CP3A 2WACA 2L3QA 1PKTA 2ZPEB 5HCKA 2F69A 4OMLA 1VUBA 4LXCA 1RAHB 2DYIA 4YTLA 2DBKA 1YJWA 4PNOA 3RIRA 2CT3A 1FMKA 3A1PA 3JAME 4M7AC 1QVGP 1TUCA 3CCLQ 1JO8A 4C8QD 1V76A 2L3SA 1X2KA 2F5KA 4LDVA 4LD6A 3CD6Q 4C5IA 1ZSZC 2DMOA 4A54A 1T0JA 2DXBA 2O2OA 4CC2A 2EQIA 2ED1A 1M4ZA 4PJOE 4RCCA 2NUPB 1PNJA 3NFCA 2D8JA 4IUVA 3PFSA 3MEVA 5L8RE 1QVGA 2VYTA 3OMCA 3CEYA 3NTIA 2ENMA 2VXFA 1I4K1 2VWFA 3BY7A 4JUVA 2QA4T 1KD1R 3HL8A 4P5NA 2MK5A 1YJNT 4M7DC 1Q81U 2JTFA 3OW2P 4F7UG 2D9TA 3CBOA 4XTYA 2BUDA 4XAXB 1YIJT 5GAN7 3QSUA 1ACMB 1LVKA 3EFOA 1WLPB 2GTJA 2PUKB 3QWXX 1YJWT 2COYA 3JCMe 3OW2A 4B9XA 3ULRB 3CC7A 4C0ZA 1KIKA 4RTWA 4JJNK 4KGVB 2M0YA 4F7UE 1W4SA 3CMEQ 3CC2A 3S3OA 2FL7A 3NGPA 3OYNA 2RHZA 2D8HA 5LJ3d 1PCXA 2JNGA 4BDZA 2K5LA 3HRUA 4N4GA 1X27A 2P0QA 2HD0A 1OX9A 4X9CA 1PWTA 5C6SA 2KVQG 2HZYA 2L3PA 5KE2A 2FHDA 2R58A 4M7AD 1VQ8T 4LDYA 1I0CA 1SG5A 3OBYA 2OAUA 2GQIA 2RH2A 4Q5WA 4C5GA 4DOVA 3G6EA 1YP5A 2WSEE 1BCMA 1N9RA 5LJ5d 1IB8A 1M90R 2A7YA 1B3QA 2I0NA 1RADB 1X43A 3A8GB 1BI0A 2DK3A 2XMFA 4ME7A 1VQ6Q 3SEMA 4IUQA 4J7IA 4Z89A 1D3BB 1D1AA 2VGNA 4M75C 2KRMA 4PL6A 2E4HA 1WXUA 3LGFA 4M77G 4BACA 4MDWA 4ZGJB 4MMLA 5LL6S 4HCZA 1VQPA 5GAN5 2V8KA 2EQMA 3PIPA 1YITA 1WIDA 1K9MR 2RK1A 4HKEA 3CQTA 3CC7T 2HSPA 1NPRA 4M7DD 3MKDA 4HT9A 3CC2T 1VQLQ 1VIFA 4M77E 1EFNA 1NLOC 2K7AA 4OF1A 2CP6A 1N9SA 1PG5B 3JRZA 1SHGA 2QDLA 1VQ7Q 3DB3A 4QVCA 1MMGA 4LDUA 4M75A 1PM3A 4IIOA 1M1KC 3JB9D 4LD9K 4N0AA 2YT6A 4C92C 4FSSA 1QP2A 1Y96A 3ZFJA 2BE7D 4PFOA 3G6ET 2LDMA 1D09B 2BTTA 4LE9A 4DBHA 3OYEA 2A08A 4Z02A 2F2XA 1LJOA 5GMKl 2JS2A 2FZKB 2MOXA 4IUUA 1FWZA 1N5ZA 2EYQA 1I5OB 1OULA 3VUZA 4X9DA 4GLMA 3FC3A 2IIMA 1KQ2A 4IKFA 2K3YA 5ECAA 3ER0A 4M7AG 1KSWA 3CCSQ 1VQPT 3P8BB 5IHIA 3S3NA 1SEMA 1WJQA 2YWWA 1U1SA 5KYYA 2EWNA 3M56A 1O75A 4Z8AA 3EGXA 2RO0A 1BB9A 1AWWA 1CSKA 1JJ2S 2K3BA 3GP8A 2QQSA 1M3AA 4M75D 2ROTA 4M75F 2D0NA 1Q81R 2MMPA 3WVDB 3VRYA 2X3XD 3CCJA 1UTIA 1D1CA 2ECZA 1X69A 2FG0A 2XDDA 3QO3A 4A4GA 1VQNQ 2EJFA 2JM8A 4MZMA 4PJJA 5D7UA 1C1AA 1HXDA 6AT1B 3I55Q 1VQMA 1G83A 1RABB 2KAFA 1FXXA 1VYVA 4EDUA 3H6ZA 1KK7A 4BY6B 4J83A 3OYBA 1XTDA 3GIBA 2DKGA 1I07A 3JCMf 2ZPIB 5GAMe 3EG0A 1U5SA 2YUQA 2JTEA 3JSCA 5KYUA 2M9UA 2AKLA 4WF2A 2E6NA 1MMAA 1BIBA 2DEUA 1JRIA 1M2OA 3X24B 1Z9QA 3HPWA 3X25B 2RI5A 1FMVA 1U1TA 4C92D 2BIVA 2MAMA 5IAYA 2A37A 3L2QA 4EMKB 3TREA 1EZZB 3CCLA 1JXOA 4M78C 3WXMB 3L2VA 4EPCA 3IQLA 1EX4A 4N4IA 3R6OA 1NG2A 3JB9J 3JB9I 1IHVA 4KH1B 3CD6A 5I2SA 2LZ6B 4E7LA 1YCSB 5CQYA 1E6HA 2QAZA 4HCCA 5GANg 5LJ5g 1Q95G 2AZVA 1SSHA 1WFWA 2X3WD 4XK8E 5KCHA 1WGSA 2VASA 3MP6A 4LDWA 2VXEA 2O4XB 3CCJT 2KYBA 4C5HA 4J9FA 1MMDA 3BDLA 1VIEA 2DIQA 2JM9A 1BU1A 4J6YA 2MIOA 3HQFA 2MCNA 2RHIA 1U8RA 4KUDK 3HFOA 1VQMT 2YSQA 3VU3C 4PJOA 4M78A 3E2UA 4FYYB 1BYMA 1GFDA 1NPPA 2NLUA 4A63B 5FWCA 4IURA 1OU9A 2HQEA 2QGGA 2RI3A 4BE0A 5FRMA 3QBYA 1TUDA 1RAEB 2B8AA 3EG9B 1Q86C 4JJBA 4JRQA 1WYXA 3FIFA 3THKA 4JZ3A 2RI2A 2ZPHB 3AT1B 1GCPA 4RTXA 1IO6A 3V7CA 3UA6A 5CK9A 2JMCA 1JEGA 2P84A 5GAOp 4ANJA 4A4HA 1M3CA 3CMEA 3CCLT 1P92A 3CCMQ 4RG8A 3VS6A 2HQHA 3CD6T 1H641 1PC0A 1YFNA 4V2SA 4LNPA 2J05A 5GAN3 3META 4FW1A 4A4FA 3L2WA 2FYKA 3TEEA 2K9GA 3VS5A 4ATOA 3OB9A 3RUXA 2L2PA 1EIFA 2DNUA 4MZTA 4E6RA 2BZ8A 3CXCA 5EC7A 4FT4A 1UGSB 4C92G 2JVVA 4PJOF 2PTKA 1PKSA 4M78F 4NOYA 3OS0A 3I56Q 5HKCA 3R6NA 2NUZA 4JDSA 1X75C 1G2BA 2M1HA 3JCMh 2LT1A 2EFIA 4WCIA 5GAOm 2HL3A 4XU3A 1VQ6A 2ZAEA 2X9HA 2HL5C 4R0KA 3CMAQ 2FO0A 3LW5E 1D0ZA 1H3HA 1W2BA 1B07A 1N8RC 1QP3A 1Y57A 5J39A 2KR3A 2EJ9A 2NUPA 3FJ5A 4A53A 4CC4B 1BIAA 2DJZA 1YELA 3E1SA 1M5Q1 2XIDA 2YUOA 2O9SA 4BB7A 4OMMA 3QG1A 3SDZA 1N6AA 5LJ3e 3LH0A 1KD1C 4DQ2A 5DLQE 2O31A 2GF7A 3M0QA 2ZPBB 3LWHA 1QQJA 1VQLA 1NA6A 3OYLA 5I11A 3CCVQ 1YHQQ 4C0GA 2D0QB 1MHNA 4KBMB 1PHTA 4QKUA 2E64A 2EJGA 1VQ7A 4AG2C 3U23A 2JW4A 2BKDN 2O9VA 1D0XA 2LT4A 5GAMf 3CCRQ 1WJRA 2O01E 5GANe 2QI2A 5LJ5e 3JCMX 4PFPA 1I5LA 4J9HA 2JTMA 2QTVA 2PNIA 1BCOA 3TQ7P 1MMNA 4R56A 1WHMA 3CCUQ 3M4YA 4BDYA 3OYGA 3OYCA 3GOXA 3KXTA 1QVFP 4F7UB 5DM7R 1M1FA 2C0IA 1DJ7B 3A5ZB 3GNGA 4RTTA 2E65A 2CZ0B 1RAGB 2AIRB 1VQ6T 3JCMc 3BW1A 4BE2A 2J6OA 1NZ9A 4K11A 1UJYA 4ZGEB 4NL2A 2C0TA 4OP0A 4AFZC 4HVUA 3PMIA 1YJ9T 3V8LA 3EGDB 1K9AA 3CCSA 1QVFA 3PGGA 2LQNA 4LUDA 2J06A 2XDPA 3L42A 2J6FA 3G71Q 1HYOA 2KYMA 5FW9A 1QMCA 1W6XA 4RUGA 3CCQQ 2RF0A 1QVGS 3FDRA 1M90C 3RERA 2LQKA 5DY9A 3L2RA 2KRSA 5FRNA 2DL8A 5FLXE 5KE3A 3MHXA 2P0PA 1VQLT 4UC4A 4C0FA 1NEBA 4C5EA 5GAMj 4E7ZA 1H8KA 1M3BA 1D3BA 2DO3A 1HD3A 1NYGA 2CH4A 2CS7A 4J5YA 1VQNA 4M77F 1YI2Q 3I55A 2RK2A 3EHRA 3CPWP 1GBQA 1I8FA 2L8DA 3QZ9B 2RQUA 1S72Q 3OS5A 2EPDA 3HKSA 2OI3A 5FU6B 4B9WA 1LCKA 2RQRA 2FZCB 2CUBA 1IXDA 3OW2S 3RMSA 2BZXA 5CIUA 3CBPA 3JCMV 4M77B 3CPWS 3CPWA 1QLYA 3M0TA 2RQWA 1NJIU 3O5ZA 2RJFA 4QVZA 2LNHB 1CKBA 1TS9A 2DTHA 2LQ8A 3OQ5A 2ED0A 8ATCB 1R0BG 2VC8A 3OYMA 1ZX6A 2RB6A 2DAQA 1OZ3A 1M1KU 2QASA 2X4XA 5FU7B 2PVDB 4OB1B 5GAMh 1K0SA 2LMJA 2DTIA 3Q1JA 4RTZA 3C95A 5IHKA 3I9QA 3S3MA 5GANd 4C8QG 2DXUA 2K4YA 3GF5A 1ZBXA 3EH2A 3J80E 1JB0E 1TH7A 2KNBB 1VQNT 3C0CA 1N0EA 1AOJA 3OS1A 4HCBA 1ZQ1A 2DX1A 3I55T 4BY6C 1UHCA 4XQ3A 5A0GA 1AWXA 3V8KA 1WHHA 4LDXA 4HXJA 3TU4K 4B6MA 4OMOA 1NYFA 4N0AC 2DL3A 2GFAA 2KXDA 4PKCC 3SHWA 2VV5A 1KC8R 2CUDA 2F1LA 2K57A 4F17A 3ZEHA 3EG3A 4C8QE 5LJ3f 2KY9A 4XU2A 2YRVA 4IUTA 4DEXA 3BFMA 5CCAA 1GXIE 2LNVA 3A8MB 5L23A 3O8VA 1HJDA 5A0DA 2R5AA 2JUFA 2BE9B 1JU5C 1QVPA 4FIBA 2NYSA 5A0LA 3VS3A 4FW2A 2VB6A 2MYSA 2CP0A 1MGQA 2DD4A 1X2QA 2MWPA 3KFVA 4BUGA 1IZ6A 3CCMA 3URGA 1F1BB 1PSEA 4J9CA 3MP8A 2G6FX 2DA9A 3REBB 2PUOB 7AT1B 1WZOA 1H3ZA 2KXCA 5CKDA 5GAN8 3NHNA 1IHWA 2QG9B 4ZNXA 5IXFA 2KI7A 4GY5A 1G3SA 2FVUA 1AD5A 3JCMQ 3I56A 2QEXA 2ESWA 2PZ1A 1D1BA 2DL4A 2CP2A 3NTHA 2EQUA 4EMKA 2C06A 2LJ3A 2ATCB 5LJ3j 3T9NA 2MI6A 3H0IA 2JS0A 3SWNB 3UF4A 3DB4A 3CMAA 1OI1A 3M0UA 5GMKm 1D0YA 4RTUA 1CKAA 1Q7YC 2JN0A 1YITT 4OB0B 2D1XA 4II1A 2EYXA 1UGPB 2AKKA 2KDSA 5AYFA 5GAOn 3M57A 3OMGA 4ELYC 2W0ZA 2O4XA 1B7TA 5GANj 2HCKA 5LJ5j 4O5VA 3V8JA 1K73C 3GLXA 1IREB 2QQRA 4XU1A 4M7AE 4F16A 1K8AC 1GFCA 3H0HA 1N0GA 2RQTA 1E7OA 3LYIA 3OYHA 3CCMT 4X1VA 2K2MA 2IVWA 4OB3B 2MF2A 3CCVA 2M51A 1VQ8Q 5D6XA 3M59A 1YHQA 3TCJA 1TOVA 3OSSC 2RA2A 3H0FA 4QQDA 1IGUA 3UA7A 2QYZA 2EYWA 4BI8B 2EW3A 2DEQA 3TSZA 2P0KA 4FU6A 3CCRA 4IUPA 4CRIA 4M7DG 1GCQC 4RTYA 4BI3A 2HNIA 3EG9A 4N4HA 1NJIR 2V8IA 4HVVA 4JS4A 3CCUA 1Q82C 5GAN6 1B34B 3I56T 4RMOA 1UG1A 1T3LA 4AMCA 2QEXT 1Y07A 3M4GA 1JXMA 1V1CA 5LJ3h 1Q86U 3NTKA 3RR6A 3PVLA 3PMTA 1OQKA 4XTWA 4Y92A 4D8DA 4Y91A 3PNWC 1YWPA 2RJDA 1UJ0A 4M7DE 1VQOQ 1G3YA 1WPYA 1ZUUA 2RM4A 3JB9G 4PJOC 2CP5A 3CCEQ 4OGEA 1XJWB 3WVEB 3X20B 2CKKA 1NLPC 4QQ6A 5GJWB 3MCAB 3EAEA 4XTVA 2KMTA 4ELZC 4OMFB 2OJ2A 2YXYA 3G71A 1WQ7A 3ASKA 5D6YA 1Y0MA 1GCQA 3KBGA 5CKBA 3CCQA 2CH4W 4AG1C 1GRIA 2CP7A 5I22A 1ABOA 1OEBA 3SB2A 2WSCE 4HCKA 2FRWA 3QYGB 1W1FA 1UDLA 3I5SA 3CCVT 2HMAA 1UGQB 1AVZC 2AK5A 1YHQT 2AT1B 2DLPA 3M5AA 5KYXB 3RESA 1QKWA 2XHCA 2G3RA 2OTLQ 2EGEA 4C92B 2DD5A 2YRDA 3CCRT 1YI2A 3GBQA 1N0FA 2E5QA 2XI9A 2DZ9A 1OYXA 2HDAA 4D6WA 4FSXA 1OV3A 1XOVA 2KT1A 3EGUA 4M75G 1N8RU 3ZI5A 1S72A 3FLGA 5GAN2 5C0MA 4PJLA 1C6VX 2CSIA 4XU0A 3QIIA 3H9NA 1T3SA 4R55A 3G4SQ 3VS1A 5KH6A 3EG2A 3RMQA 2P4TA 1QCOA 5A2QE 1YBYA 4JLGA 4QW2A 5KYWB 1KD1U 1G3WA 4J8OA 3CXCP 3CC4Q 4LUEA 4M75E 2YDLA 1VOMA 3RDVA 2X4WA 4PLLA 2HKNA 2EYYA 2XG8D 4J9GA 3G71T 1VQ4Q 3D7SB 1RI0A 1SF9A 3CCQT 1HSQA 3CXCS 2OTJQ 1OPLA 2V1RA 4NS5A 1WJSA 2DL5A 4PJOD 4F7UA 4M78D 2CZ1B 1W2BP 1KHIA 5FWBA 5IHNA 3FJPA 4DOWA 2DRKA 4J9EA 3PT9A 3H41A 1VQKQ 1R8OB 4XTUA 2FB7A 2GGRA 2LX9A 3MP1A 2EKOA 1FX7A 1G3TA 4ZTFA 2QQBA 1YCYA 1YI2T 2QXFA 2A0FB 2V8JA 3LH5A 3EGDA 4TVRA 4JJCA 1W2BS 1ZA2B 4KULA 1J3TA 1KFZA 1TU0B 4C92E 1S72T 2DBMA 4MDXA 1R77A 2NUTB 2M0OA 1TUGB 1AEYA 2GTOA 2LTOA 1M9SA 5FU6C 4AFSC 4DA4A 1ZBJA 3JCMg 1AWOA 1VQ5Q 3KUFA 1I81A 3HHTB 2ZPGB 3MEAA 4M77C 1KQ1A 4DBFA 5FROA 4ZTJA 4ORZA 2L89A 1A0NB 1UEBA 2KBTA 2F5TX 1U3OA 4MMKA 2SEMA 2HSEB 3CMET 1BI2A 2KQWA 4C0DB 1X01A 2KRNA 1LNXA 1XQHA 3LGLA 2VVKA 2QDYB 4J9IA 2E3IA 4VUBA 4F7UF 3QKJA 3OYFA 2DRMA 3UDCA 2HAXA 3UWNA 3EH1A 3BE3A 1UGRB 3JCMP 5HK3A 5FU7C 3C4SA 3ZL7C 3QZ5B 1SRMA 1Q86R 3J7AF 2E1HA 3A8OB 2A36A 4KGZB 3A8HB 3UT1A 5D6WA 2W10A 3MO8A 2EIFA 3DLMA 4WTOB 3RBBB 2Y90A 2RMOA 1VQ9Q 5GAOq 2RHUA 2DL7A 4M77A 5CO7A 4AT1B 2H8HA 1OX8A 4QVDA 5KYNA 2JJ9A 4E7IA 2MWOA 5GJVB 2H3EB 3VYGA 2I2LA 3QUIA 4OMPA 3UPUA 2XU8A 4CC7A 2EYZA 1M1GA 1PD0A 3JB9H 4FL6A 2NWMA 1QVFS 1TG0A 2PU9B 2FPDA 4PJOG 1QKXA 3F70A 4M78G 4OB2B 1MNDA 1IGQA 3MEWA 3E9FA 1M8MA 1NE8A 2FZGB 2J7IA 1JBMA 4QQGA 4EMGA 2C1LA 1BI3A 4C8QF 1FMWA 1BBZA 3N5BB 2QTXA 2D6FA 3QYHB 5CKFA 1NEGA 3OBWA 4GLKA 5CAIA 2DF6A 1BI1A 2E41A 2DERA 1N8RR 3VUBA 4M78E 2CGHA 2GFUA 4M77D 1VQ7T 1KC8C 1KQSP 1VQ8A 3HRSA 4JZ4A 5I2MA 3OYYA 4C8QB 5IT9E 1K9MC 3RKYA 2RHYA 2IG0A 1WQWA 1T0HA 4DBRA 3P8DA 3GNFB 2JZ2A 4FYXB 2JXBA 4M7AA 3ME9A 3QHSA 1M2VB 4GBQA 1KQSS 1SSFA 1KQSA 1ZLMA 3M55A 1RAIB 4ZGDB 4A4EA 3A8LB 1ZSZA 4KH0B 5CKEA 5HY6A 3SWNC 3SFMA 2GNCA 1WXTA 3SD4A 2FEIA 3CBMA 3HSBA 2QK0A 1VQOA 5IXBA 4CC3A 3CCST 3CCEA 3E9GA 3GPLA 4KRTA 1K4US 3JCMb 5CR2A 4E7JA 1Z9ZA 5GMKe 1E6GA 2OX7A 1TTHB 3ZBDA 3TVTA 4NL3A 2EKHA 1QCNA 1K0XA 1ZHIA 2C0OA 1KJWA 2R57A 2B86A 1LPLA 4RTVA 4O6JA 2DJQA 3OYKA 3P8HA 2DXCA 5M9OA 3M54A 1YWOA 4M7DA 3BDUA 2CZ7B 2EBPA 5CQXA 1FYNA 4AFUC 2DIGA 2DYBA 3S6WA 2XICA 1X6OA 3SWNA 4M7AF 3VV0A 3M9QA 1PD1A 1OZ2A 4JS5A 2P4RA 2OTLA 5GAMg 1K76A 2JOYA 1NM7A 1OU8A 3OYDA 1Q7YU 4RKUE 4QT7A 2CYZB 1K1ZA 1Q81C 3PVQA 4J7FA 2PVGB 3G4SA 2HKQB 4FYWB 1C0MA 2DE0X 4E7SA 4M7AB 2ROLA 3QWYA 1YJ9Q 4JLIA 2GBQA 2LRQA 4EMKC 1K73U 2HBWA 4OMQA 2X35A 2X51A 4J9BA 3QDFA 1ZSZB 1VQOT 1K8AU 3CC4A 3JCMJ 1WNLA 2AZSA 5GANf 2YHTA 5LJ5f 3CCET 3EFOB 4JRIA 3EHQA 1MUZA 3J81E 3MPUB 3QXEB 2K3XA 4M7DF 1QCFA 1NJIC 3L2ZA 3M0SA 2RD1A 1VQ4A 3HRTA 2KK4A 1VYTA 2YUPA 3LWIA 2QA4Q 1B34A 3C94A 2Y4XA 4L6V5 3V7RA 2OTJA 2L3RA 4KT0E 2K5FA 2ABLA 3VYHB 2DM1A 1YJNQ 1RLQC 3L1AA 2DXTA 3L2UA 1TWBA 3HFNA 1Q82U 2FRYA 4JJDA 1YIJQ 2L0AA 3UATA 4M7DB 1M27C 3LX7A 4J6XA 1VQKA 3JB9F 2YLCA 2E10A 1YN8A 1OPKA 2OTLT 1MV0B 2CSQA 3EFRA 4Z88A 1WIEA 1AZEA 2ZZDA 1V29B 1I1JA 1GBRA 1YJWQ 2FPFA 1KG1A 4PK4A 4ZN3A 4L59A 1W70A 2COWA 2Z0WA 3PIOA 3QJYA 2X4YA 4J9DA 4ESRA 5AT1B 1VQ5A 2VKNA 2LC4A 3G4ST 1JJ2P 4JPBW 1ZA1B 2HQXA 4E47A 3AHUA 2ZGWA 3LLRA 3JCMd 2LCSA 5GAOr 3JV3A 2KGTA 2RN8A 1AZGB 3CC4T 2YUNA 5KYXA 3MJXA 2WSFE 1WX6A 1MNEA 2HEQA 2K6DA 2KT8A 4C92A 1JJ2A 3V7SA 2XD0A 3M53A 3VRZA 1WDXA 4D8KA 4I1KA 4DEYA 4J6WA 2V26A 1TXQA 3QJ6A 2RJEA 3FB9A 1VQ4T 3JCMW 2JMAA 4HT8A 1VYUA 2OTJT 1ZUKA 4IIMA 2PQWA 3VS7A 3G1JA 1M30A 2EQJA 4FT2A 1IRXA 1VQ9A 4KUIA 3I35A 5KYWA 4CI0C 1YNZA 4ZN1A 3VS2A 3NPFA 2RHXA 3X28B 4PLIA 1VQKT 1QWFA 3OYJA 1X6BA 2E12A 3G7ZA 4M75B 5KCOA 2E70A 1PRLC 1WA7A 4JRKA 4PJNA 5J3BA 3CMAT 1RAAB 1M1KR 1Y96B 2Y4YA 2H3JA 5EG2A 1RL2A 2DILA 2VUBA 1RI9A 3PTAA 4DBQA 3CC7Q 2MPXC 3A98A 2PVOB 3E19A 1ZUYA 2LP5A 5LJ3g 3H8ZA 5GANh 1VQ5T 5LJ5h 3CC2Q 1TSFA 2LX7A 1LOJA 1G5VA 3FRNA 4RG2A 2RPNA 4C92F 1G8XA 3VS0A 2DZCA 2DTOA 1UECA 1ARKA 4EMHA 1AHJB 5CKHA 1X6GA 2LCCA 4C0DC 2F2WA 2DVJA 1UHFA 5GAN4 2M16A 2COZA 4E7HA 4F04B 2CDTA 4MZPA 1BK2A 1BKBA 2RNAA 1Q7YR 5KYYB 3VKIA 3QPHA 2M02A 4KGXB 5I21A 9ATCB 5IN1A 3G6EQ 3EGXB 3PE0A 2NUTA 1S1NA 4LN2A 2LJ0A 3RKXA 4HA8A 4Y28E 5J26A 1WHLA 2RJCA 1VA7A 1K73R 2EAYA 4F14A 4E2FB 5HK0A 2GCXA 2KROA 3CCUT 1VQ9T 2CZ6B 1Y7XA 1K8AR 1OOTA 4PJMA 2FPEA 5GMKj
chains in the Genus database with same CATH topology
1WJQA 1N27A 4JRPA 1M1KU 2R5MA 1U1SA 2X4XA 2EWNA 5FU7B 5GAOq 2RHUA 2VGMA 3HP9A 3M56A 1O75A 2PVDB 4M77A 4OB1B 5GAMh 5CO7A 2RO0A 2DTIA 3Q1JA 3C95A 1JJ2S 4QVDA 3S3MA 3GP8A 2DVEA 4E7IA 2QQSA 5GANd 2MWOA 4C8QG 2L5QA 4M75D 3VYGA 2DXUA 2K4YA 3GF5A 5DLOA 4M75F 1ZBXA 3J80E 2I2LA 2MMPA 1JB0E 4FM4B 1UB4A 3WVDB 1TH7A 2XKOC 1VQNT 3QUIA 3UPUA 2XU8A 3C12A 3CCJA 3OS1A 4HCBA 1ZQ1A 3I55T 1M1GA 3OA6A 4BY6C 3JB9H 4FL6A 4XQ3A 5A0GA 3V8KA 2XDDA 3QO3A 4A4GA 1QVFS 4LDXA 2EJFA 2PU9B 3TU4K 4PJOG 4MZMA 2LVMA 3F70A 4M78G 1HXDA 4OB2B 2X4JA 1VQMA 4L5GA 4N0AC 1PSFA 2KAFA 2GFAA 3MEWA 3E9FA 1FXXA 2HBPA 4PKCC 1NE8A 4EDUA 3H6ZA 2VV5A 4XTXA 2K57A 4OGCA 3ZEHA 3DKMA 4C8QE 4E7KA 5LJ3f 1JBMA 4BY6B 4QQGA 2KY9A 4XU2A 4EMGA 1BI3A 2YRVA 4IUTA 3BFMA 4C8QF 4J83A 5CCAA 1GXIE 3OYBA 2LNVA 3A8MB 1XTDA 3N5BB 3GIBA 2QTXA 2DKGA 4BE1A 3O8VA 3QYHB 3JCMf 2D6FA 2ZPIB 5A0DA 2R5AA 2JUFA 5GAMe 5CKFA 3OBWA 5GAOl 4GLKA 3M58A 1QVPA 2GQVA 4FIBA 3JSCA 1BI1A 2M9UA 5A0LA 5CAIA 3OS2A 4WF2A 3OYAA 2E6NA 1M8VA 2E41A 4C8QC 1BIBA 3VUBA 1MGQA 4M78E 1JRIA 2CGHA 2DD4A 2GFUA 2K5IA 4M77D 1VQ7T 2MWPA 3X24B 1KC8C 3JB9F 4BUGA 1VQ8A 3HPWA 3HRSA 3X25B 2RI5A 5I2MA 1IZ6A 3CCMA 1U1TA 3URGA 1HK9A 2BIVA 2MAMA 1PSEA 4C92D 2YLBA 3OYYA 3MP8A 5IAYA 3VJPA 3L2QA 4C8QB 5GMKh 4EMKB 3INZA 3TREA 5IT9E 2EQKA 5GAMd 3RKYA 1K9MC 3CCLA 2PUOB 4M78C 2RHYA 3WXMB 3L2VA 4EPCA 2IG0A 2KSSA 1WQWA 2LCLA 4N4IA 3OYIA 3R6OA 3P8DA 3JB9J 3JB9I 1H3ZA 4BI4A 2QQAA 5CKDA 3GNFB 4OVAA 3OY9A 5GAN8 3QDRB 3CD6A 2JZ2A 5I2SA 2ZCFB 4E7LA 2DPPB 4M7AA 5CQYA 3ME9A 3QHSA 1M90U 4HCCA 1KQSS 1SSFA 1KQSA 3M55A 1YJ9A 4GY5A 4PJOB 5GANg 4M78B 4ZGDB 5LJ5g 4BD3A 4A4EA 1G3SA 4A4KA 2FVUA 3A8LB 1O9SA 4XK8E 5KCHA 3EFSA 5CKEA 5HY6A 3SWNC 3SFMA 1WGSA 3JCMQ 3MP6A 1Y71A 4LDWA 3I56A 2K2VA 2QEXA 3SD4A 2VXEA 2O4XB 2E6ZA 3CCJT 4C5HA 3CBMA 3NTHA 5CVIA 3HSBA 2EQUA 4C8QA 4EMKA 2C06A 3RKWA 1VQOA 3BDLA 1VIEA 2DIQA 1KC8U 3HQFA 4J6YA 1QW1A 5LJ3j 3T9NA 3CCST 3CCEA 2MI6A 3E9GA 3GPLA 2RHIA 1U8RA 3SWNB 3DB4A 4KUDK 3HFOA 1VQMT 3JCMb 3CMAA 1OI1A 5CR2A 2XK0A 4E7JA 4RCBA 5GMKm 5GMKe 3X26B 1Q7YC 1K9MU 1KHCA 2ZPFB 3OSVA 3ZBDA 2JN0A 3MEUA 2QA4A 1YITT 4OB0B 4X34A 3VU3C 4NL3A 4PJOA 5GMKi 4M78A 4II1A 1BYMA 1UGPB 1ZHIA 2QQ9A 1NPPA 2R57A 2KDSA 4XTZA 2NLUA 5AYFA 5GAOn 1YJNA 4O6JA 3M57A 2A3LA 3OMGA 3P8HA 3OYKA 2AHJB 2DXCA 3M54A 1XNIA 3CPFA 4IURA 3FEOA 4ELYC 5M9OA 2O4XA 3DLLA 5GANj 1YIJA 4M7DA 3BDUA 5LJ5j 2HQEA 2CZ7B 2RI3A 2WACA 4BE0A 5FRMA 4O5VA 3QBYA 5CQXA 3V8JA 2B8AA 1K73C 1Q86C 2DIGA 3GLXA 4JRQA 1IREB 3S6WA 2QQRA 2ZPEB 4XU1A 4M7AE 3FIFA 2F69A 1K8AC 2RI2A 2ZPHB 2XICA 1X6OA 3SWNA 1VUBA 4M7AF 3LYIA 3OYHA 3V7CA 3VV0A 3CCMT 3M9QA 2IVWA 4OB3B 4YTLA 5CK9A 2MF2A 1OZ2A 4JS5A 4PNOA 3CCVA 1YJWA 3RIRA 2OTLA 5GAMg 5GAOp 4A4HA 3CMEA 5D6XA 3M59A 3CCLT 1P92A 2JOYA 3TCJA 1YHQA 3OSSC 4RG8A 2RA2A 4QQDA 3JAME 4M7AC 3OYDA 4BI8B 3CD6T 2DEQA 1Q7YU 4RKUE 1H641 2P0KA 4FU6A 2CYZB 4C8QD 3CCRA 4IUPA 4CRIA 4M7DG 1Q81C 2F5KA 4LDVA 4V2SA 4LD6A 4BI3A 5GAN3 3META 4C5IA 4J7FA 2PVGB 2FYKA 4A4FA 2HNIA 3TEEA 4A54A 3L2WA 3G4SA 4ATOA 4N4HA 2DXBA 3OB9A 3RUXA 1EIFA 4MZTA 4M7AB 2V8IA 4JS4A 3CCUA 1Q82C 3CXCA 5GAN6 4JLIA 1B34B 2LRQA 3I56T 4EMKC 4RMOA 1M4ZA 1UGSB 1Y07A 3M4GA 4FT4A 4RCCA 2QEXT 4PJOE 3NFCA 1K73U 4C92G 2X35A 4IUVA 3PFSA 5LJ3h 3MEVA 5L8RE 1Q86U 2JVVA 3NTKA 4PJOF 1QVGA 3OS0A 4M78F 2VYTA 3OMCA 4NOYA 3PMTA 1VQOT 1K8AU 3CC4A 3CEYA 4XTWA 3JCMJ 5HKCA 1WNLA 4JDSA 5GANf 1X75C 2M1HA 2YHTA 3JCMh 3NTIA 4Y91A 2LT1A 2EFIA 5LJ5f 3PNWC 3CCET 4JRIA 5GAOm 2RJDA 4M7DE 2VXFA 1I4K1 3J81E 1G3YA 1WPYA 2RM4A 3JB9G 3BY7A 4PJOC 3QXEB 4XU3A 2K3XA 4M7DF 1VQ6A 4JUVA 4OGEA 2QA4T 1NJIC 3L2ZA 2RD1A 3HL8A 3WVEB 3LW5E 2CKKA 4QQ6A 3X20B 3HRTA 4P5NA 1VQ4A 2KK4A 3LWIA 3MCAB 1W2BA 3EAEA 1N8RC 4XTVA 2KMTA 4ELZC 1YJNT 1QP3A 4OMFB 4M7DC 1B34A 1Q81U 2JTFA 2Y4XA 3C94A 4L6V5 3V7RA 5J39A 2OTJA 2L3RA 4KT0E 4F7UG 3G71A 2EJ9A 2D9TA 1WQ7A 2K5FA 2BUDA 3CBOA 4XTYA 3ASKA 5D6YA 4XAXB 4A53A 1YIJT 3VYHB 1BIAA 2DJZA 3KBGA 5CKBA 3CCQA 1YELA 3E1SA 5GAN7 3QSUA 1M5Q1 2XIDA 2DXTA 3L1AA 3L2UA 3HFNA 1Q82U 4BB7A 3QG1A 3SDZA 4M7DB 3SB2A 1N6AA 3LX7A 4J6XA 2WSCE 2PUKB 3LH0A 5LJ3e 2YLCA 1KD1C 1VQKA 4DQ2A 5DLQE 2E10A 3QYGB 2GF7A 1YJWT 3CCVT 2OTLT 1UGQB 3JCMe 1YHQT 2ZPBB 4B9XA 3LWHA 3EFRA 3CC7A 3OW2A 3M5AA 4C0ZA 2ZZDA 3RESA 1VQLA 1NA6A 1V29B 4JJNK 2XHCA 3OYLA 2G3RA 4F7UE 1W4SA 1KG1A 4C92B 4ZN3A 2DD5A 4L59A 4C0GA 3CCRT 2D0QB 3PIOA 1YI2A 3CC2A 1MHNA 3S3OA 2FL7A 2E5QA 3QJYA 4KBMB 2X4YA 2E64A 2EJGA 2DZ9A 1OYXA 2RHZA 2XI9A 3OYNA 1VQ7A 4D6WA 4FSXA 1XOVA 2BKDN 4M75G 2LT4A 5GAMf 2LC4A 3G4ST 1N8RU 5LJ3d 1S72A 1VQ5A 3FLGA 1WJRA 2O01E 5GANe 5C0MA 2QI2A 5LJ5e 5GAN2 2HQXA 4E47A 3JCMX 2JNGA 1I5LA 2JTMA 3AHUA 2ZGWA 3LLRA 4XU0A 4BDZA 2K5LA 3HRUA 3QIIA 4N4GA 4R55A 3JCMd 2P0QA 5KH6A 2HD0A 5GAOr 4X9CA 3RMQA 4R56A 5C6SA 2KVQG 2P4TA 5KE2A 4M7AD 2FHDA 2R58A 3M4YA 4BDYA 3CC4T 1VQ8T 5A2QE 4LDYA 1YBYA 4JLGA 4QW2A 2WSFE 3OYCA 3OYGA 3GOXA 3KXTA 3OBYA 2OAUA 4Q5WA 2RH2A 4C5GA 4DOVA 4F7UB 5DM7R 3G6EA 1KD1U 1M1FA 4C92A 1G3WA 1DJ7B 2WSEE 3A5ZB 4J8OA 1JJ2A 1N9RA 3V7SA 3GNGA 2XD0A 2E65A 2CZ0B 3M53A 4M75E 1VQ6T 5LJ5d 3JCMc 4I1KA 3BW1A 4J6WA 2A7YA 4BE2A 2X4WA 4PLLA 1NZ9A 3A8GB 3QJ6A 2RJEA 3FB9A 1VQ4T 2XG8D 1BI0A 2DK3A 4NL2A 4ZGEB 3JCMW 4ME7A 4OP0A 4HT8A 4IUQA 2OTJT 3PMIA 4J7IA 1YJ9T 3V8LA 3G71T 1D3BB 1RI0A 2VGNA 4M75C 3CCSA 1QVFA 4PL6A 3PGGA 2PQWA 3CCQT 2XDPA 3CXCS 2EQJA 3L42A 4FT2A 3LGFA 4M77G 4BACA 1VQ9A 4MDWA 4NS5A 4KUIA 4ZGJB 1WJSA 4MMLA 5LL6S 4HCZA 4CI0C 1VQPA 5GAN5 4PJOD 2V8KA 4M78D 4F7UA 4ZN1A 2CZ1B 2RHXA 2EQMA 3X28B 3PIPA 4PLIA 1YITA 1QVGS 1VQKT 3OYJA 3FDRA 1M90C 3RERA 1KHIA 2LQKA 5DY9A 2E12A 3FJPA 3G7ZA 4M75B 5KCOA 4DOWA 3L2RA 5FRNA 2E70A 2RK1A 5FLXE 4HKEA 5KE3A 3PT9A 3MHXA 4JRKA 2XDBA 3CC7T 1R8OB 1NPRA 5J3BA 4M7DD 2P0PA 3CMAT 4XTUA 4UC4A 1VQLT 1Y96B 2FB7A 2LX9A 3MP1A 2EKOA 2Y4YA 4C0FA 4C5EA 1FX7A 2H3JA 1G3TA 5EG2A 5GAMj 1RL2A 2VUBA 4ZTFA 4HT9A 3PTAA 2QQBA 1YCYA 1YI2T 3CC2T 2QXFA 1D3BA 2DO3A 2V8JA 1VIFA 1WIDA 4M77E 2PVOB 4TVRA 3E19A 2CS7A 4J5YA 1W2BS 1VQNA 4KULA 5LJ3g 3H8ZA 4M77F 4OF1A 5GANh 1VQ5T 4C92E 5LJ5h 3I55A 1S72T 4MDXA 1LOJA 1N9SA 1G5VA 2M0OA 2RK2A 3FRNA 3JRZA 2LTOA 1M9SA 4RG2A 5FU6C 4DA4A 4C92F 1I8FA 3JCMg 2DZCA 2DTOA 2L8DA 3DB3A 4QVCA 3QZ9B 4LDUA 4EMHA 1AHJB 3KUFA 5CKHA 1I81A 3OS5A 2LCCA 3HHTB 4M75A 2ZPGB 3MEAA 4M77C 4C0DC 1KQ1A 5FROA 1M1KC 4ZTJA 3JB9D 3HKSA 2L89A 4N0AA 2M16A 1UEBA 5GAN4 4LD9K 4C92C 4E7HA 1QP2A 1Y96A 3ZFJA 2F5TX 5FU6B 4B9WA 4MZPA 3G6ET 2LDMA 1BKBA 4MMKA 3OYEA 3CMET 3OW2S 1BI2A 3RMSA 3VKIA 2KQWA 5CIUA 3QPHA 3CBPA 3JCMV 5I21A 4M77B 4C0DB 5IN1A 1X01A 3CPWS 3CPWA 1LNXA 1XQHA 4Z02A 1LJOA 3LGLA 2QDYB 5GMKl 4VUBA 4F7UF 3QKJA 4IUUA 1FWZA 3OYFA 1NJIU 3RKXA 3UDCA 2RJFA 2EYQA 4HA8A 4QVZA 4Y28E 3UWNA 2HAXA 3VUZA 4X9DA 5J26A 1UGRB 3FC3A 3JCMP 1KQ2A 5HK3A 2DTHA 2LQ8A 2RJCA 5FU7C 3C4SA 4IKFA 3QZ5B 3OQ5A 2EAYA 2K3YA 5HK0A 2GCXA 3J7AF 3CCUT 2E1HA 3ER0A 4M7AG 3A8OB 1VQ9T 2CZ6B 1Y7XA 2VC8A 3A8HB 3UT1A 5D6WA 1VQPT 3OYMA 3P8BB 3MO8A 2RB6A 2DAQA 2EIFA 3DLMA 1OZ3A 5GMKj 3S3NA 2Y90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1K A;  1NA6 A;  4LDY A;  4LDW A;  4LDV A;  1WID A;  1YEL A;  4LDX A;  3HQF A;  4LDU A; 
#chains in the Genus database with same CATH topology
 1N27 A;  4JRP A;  2R5M A;  1JQQ A;  1WI7 A;  3HP9 A;  2VGM A;  1UFF A;  8AT1 B;  1VQP Q;  1YIT Q;  2LQW A;  2LJ1 A;  4PFZ A;  1SKU B;  2DVE A;  2L5Q A;  1PRM C;  1RLP C;  5DLO A;  3M0P A;  1UB4 A;  4FM4 B;  2XKO C;  5KYU B;  1RAF B;  1UUE A;  3C12 A;  3OA6 A;  1Q82 R;  2CT4 A;  2LVM A;  1WHJ A;  1AT1 B;  2X4J A;  4L5G A;  1PSF A;  1R0C B;  3VS4 A;  2HBP A;  1WHK A;  1UE9 A;  4XTX A;  4AFQ C;  4OGC A;  3DKM A;  4E7K A;  3HTR A;  2F2V A;  2V1Q A;  4BE1 A;  2BZY A;  1SHF A;  1MV3 A;  5GAO l;  3M58 A;  2GQV A;  3OS2 A;  1M8V A;  3OYA A;  2DFU A;  3REA B;  4C8Q C;  2K5I A;  2QEX Q;  1WXB A;  1HK9 A;  2JT4 A;  2YLB A;  3VJP A;  1QWE A;  2KE9 A;  5GMK h;  2XDB A;  2O88 A;  3INZ A;  2EQK A;  5GAM d;  2E5K A;  2KSS A;  3OYI A;  2LCL A;  1RUW A;  4BI4 A;  2QQA A;  2CRE A;  4OVA A;  3OY9 A;  2OAW A;  3QDR B;  4HVW A;  2EGA A;  2ZCF B;  1H92 A;  2DPP B;  1M90 U;  3I5R A;  2YRC A;  1YJ9 A;  1UGV A;  4PJO B;  4M78 B;  3NMZ C;  2E3H A;  4BD3 A;  4A4K A;  1O9S A;  3EFS A;  3M0R A;  1NBE B;  4FCY A;  4OMN A;  1Y71 A;  2K2V A;  2IPO B;  2E6Z A;  4EIK A;  5CVI A;  2EVR A;  4C8Q A;  1GL5 A;  2EGC A;  3RKW A;  1RAC B;  1KC8 U;  2KEA A;  1QW1 A;  2K79 A;  2RQV A;  3EG1 A;  3CCJ Q;  1AWJ A;  3RNJ A;  2XK0 A;  4RCB A;  3X26 B;  1K9M U;  1KHC A;  1M2V A;  2QGF B;  2ZPF B;  3OSV A;  1SRL A;  3MEU A;  2QA4 A;  1U06 A;  4X34 A;  3TSW A;  1WHG A;  1VQM Q;  5GMK i;  2DET A;  1ABQ A;  2QQ9 A;  4M4Z A;  4XTZ A;  1YJN A;  2A3L A;  2AHJ B;  1SPK A;  1XNI A;  3CPF A;  3FEO A;  4FYV B;  1ZSG A;  5IH2 A;  2A28 A;  3DLL A;  2SRC A;  1YIJ A;  2J6K A;  2CP3 A;  2WAC A;  2L3Q A;  1PKT A;  2ZPE B;  5HCK A;  2F69 A;  4OML A;  1VUB A;  4LXC A;  1RAH B;  2DYI A;  4YTL A;  2DBK A;  1YJW A;  4PNO A;  3RIR A;  2CT3 A;  1FMK A;  3A1P A;  3JAM E;  4M7A C;  1QVG P;  1TUC A;  3CCL Q;  1JO8 A;  4C8Q D;  1V76 A;  2L3S A;  1X2K A;  2F5K A;  4LDV A;  4LD6 A;  3CD6 Q;  4C5I A;  1ZSZ C;  2DMO A;  4A54 A;  1T0J A;  2DXB A;  2O2O A;  4CC2 A;  2EQI A;  2ED1 A;  1M4Z A;  4PJO E;  4RCC A;  2NUP B;  1PNJ A;  3NFC A;  2D8J A;  4IUV A;  3PFS A;  3MEV A;  5L8R E;  1QVG A;  2VYT A;  3OMC A;  3CEY A;  3NTI A;  2ENM A;  2VXF A;  1I4K 1;  2VWF A;  3BY7 A;  4JUV A;  2QA4 T;  1KD1 R;  3HL8 A;  4P5N A;  2MK5 A;  1YJN T;  4M7D C;  1Q81 U;  2JTF A;  3OW2 P;  4F7U G;  2D9T A;  3CBO A;  4XTY A;  2BUD A;  4XAX B;  1YIJ T;  5GAN 7;  3QSU A;  1ACM B;  1LVK A;  3EFO A;  1WLP B;  2GTJ A;  2PUK B;  3QWX X;  1YJW T;  2COY A;  3JCM e;  3OW2 A;  4B9X A;  3ULR B;  3CC7 A;  4C0Z A;  1KIK A;  4RTW A;  4JJN K;  4KGV B;  2M0Y A;  4F7U E;  1W4S A;  3CME Q;  3CC2 A;  3S3O A;  2FL7 A;  3NGP A;  3OYN A;  2RHZ A;  2D8H A;  5LJ3 d;  1PCX A;  2JNG A;  4BDZ A;  2K5L A;  3HRU A;  4N4G A;  1X27 A;  2P0Q A;  2HD0 A;  1OX9 A;  4X9C A;  1PWT A;  5C6S A;  2KVQ G;  2HZY A;  2L3P A;  5KE2 A;  2FHD A;  2R58 A;  4M7A D;  1VQ8 T;  4LDY A;  1I0C A;  1SG5 A;  3OBY A;  2OAU A;  2GQI A;  2RH2 A;  4Q5W A;  4C5G A;  4DOV A;  3G6E A;  1YP5 A;  2WSE E;  1BCM A;  1N9R A;  5LJ5 d;  1IB8 A;  1M90 R;  2A7Y A;  1B3Q A;  2I0N A;  1RAD B;  1X43 A;  3A8G B;  1BI0 A;  2DK3 A;  2XMF A;  4ME7 A;  1VQ6 Q;  3SEM A;  4IUQ A;  4J7I A;  4Z89 A;  1D3B B;  1D1A A;  2VGN A;  4M75 C;  2KRM A;  4PL6 A;  2E4H A;  1WXU A;  3LGF A;  4M77 G;  4BAC A;  4MDW A;  4ZGJ B;  4MML A;  5LL6 S;  4HCZ A;  1VQP A;  5GAN 5;  2V8K A;  2EQM A;  3PIP A;  1YIT A;  1WID A;  1K9M R;  2RK1 A;  4HKE A;  3CQT A;  3CC7 T;  2HSP A;  1NPR A;  4M7D D;  3MKD A;  4HT9 A;  3CC2 T;  1VQL Q;  1VIF A;  4M77 E;  1EFN A;  1NLO C;  2K7A A;  4OF1 A;  2CP6 A;  1N9S A;  1PG5 B;  3JRZ A;  1SHG A;  2QDL A;  1VQ7 Q;  3DB3 A;  4QVC A;  1MMG A;  4LDU A;  4M75 A;  1PM3 A;  4IIO A;  1M1K C;  3JB9 D;  4LD9 K;  4N0A A;  2YT6 A;  4C92 C;  4FSS A;  1QP2 A;  1Y96 A;  3ZFJ A;  2BE7 D;  4PFO A;  3G6E T;  2LDM A;  1D09 B;  2BTT A;  4LE9 A;  4DBH A;  3OYE A;  2A08 A;  4Z02 A;  2F2X A;  1LJO A;  5GMK l;  2JS2 A;  2FZK B;  2MOX A;  4IUU A;  1FWZ A;  1N5Z A;  2EYQ A;  1I5O B;  1OUL A;  3VUZ A;  4X9D A;  4GLM A;  3FC3 A;  2IIM A;  1KQ2 A;  4IKF A;  2K3Y A;  5ECA A;  3ER0 A;  4M7A G;  1KSW A;  3CCS Q;  1VQP T;  3P8B B;  5IHI A;  3S3N A;  1SEM A;  1WJQ A;  2YWW A;  1U1S A;  5KYY A;  2EWN A;  3M56 A;  1O75 A;  4Z8A A;  3EGX A;  2RO0 A;  1BB9 A;  1AWW A;  1CSK A;  1JJ2 S;  2K3B A;  3GP8 A;  2QQS A;  1M3A A;  4M75 D;  2ROT A;  4M75 F;  2D0N A;  1Q81 R;  2MMP A;  3WVD B;  3VRY A;  2X3X D;  3CCJ A;  1UTI A;  1D1C A;  2ECZ A;  1X69 A;  2FG0 A;  2XDD A;  3QO3 A;  4A4G A;  1VQN Q;  2EJF A;  2JM8 A;  4MZM A;  4PJJ A;  5D7U A;  1C1A A;  1HXD A;  6AT1 B;  3I55 Q;  1VQM A;  1G83 A;  1RAB B;  2KAF A;  1FXX A;  1VYV A;  4EDU A;  3H6Z A;  1KK7 A;  4BY6 B;  4J83 A;  3OYB A;  1XTD A;  3GIB A;  2DKG A;  1I07 A;  3JCM f;  2ZPI B;  5GAM e;  3EG0 A;  1U5S A;  2YUQ A;  2JTE A;  3JSC A;  5KYU A;  2M9U A;  2AKL A;  4WF2 A;  2E6N A;  1MMA A;  1BIB A;  2DEU A;  1JRI A;  1M2O A;  3X24 B;  1Z9Q A;  3HPW A;  3X25 B;  2RI5 A;  1FMV A;  1U1T A;  4C92 D;  2BIV A;  2MAM A;  5IAY A;  2A37 A;  3L2Q A;  4EMK B;  3TRE A;  1EZZ B;  3CCL A;  1JXO A;  4M78 C;  3WXM B;  3L2V A;  4EPC A;  3IQL A;  1EX4 A;  4N4I A;  3R6O A;  1NG2 A;  3JB9 J;  3JB9 I;  1IHV A;  4KH1 B;  3CD6 A;  5I2S A;  2LZ6 B;  4E7L A;  1YCS B;  5CQY A;  1E6H A;  2QAZ A;  4HCC A;  5GAN g;  5LJ5 g;  1Q95 G;  2AZV A;  1SSH A;  1WFW A;  2X3W D;  4XK8 E;  5KCH A;  1WGS A;  2VAS A;  3MP6 A;  4LDW A;  2VXE A;  2O4X B;  3CCJ T;  2KYB A;  4C5H A;  4J9F A;  1MMD A;  3BDL A;  1VIE A;  2DIQ A;  2JM9 A;  1BU1 A;  4J6Y A;  2MIO A;  3HQF A;  2MCN A;  2RHI A;  1U8R A;  4KUD K;  3HFO A;  1VQM T;  2YSQ A;  3VU3 C;  4PJO A;  4M78 A;  3E2U A;  4FYY B;  1BYM A;  1GFD A;  1NPP A;  2NLU A;  4A63 B;  5FWC A;  4IUR A;  1OU9 A;  2HQE A;  2QGG A;  2RI3 A;  4BE0 A;  5FRM A;  3QBY A;  1TUD A;  1RAE B;  2B8A A;  3EG9 B;  1Q86 C;  4JJB A;  4JRQ A;  1WYX A;  3FIF A;  3THK A;  4JZ3 A;  2RI2 A;  2ZPH B;  3AT1 B;  1GCP A;  4RTX A;  1IO6 A;  3V7C A;  3UA6 A;  5CK9 A;  2JMC A;  1JEG A;  2P84 A;  5GAO p;  4ANJ A;  4A4H A;  1M3C A;  3CME A;  3CCL T;  1P92 A;  3CCM Q;  4RG8 A;  3VS6 A;  2HQH A;  3CD6 T;  1H64 1;  1PC0 A;  1YFN A;  4V2S A;  4LNP A;  2J05 A;  5GAN 3;  3MET A;  4FW1 A;  4A4F A;  3L2W A;  2FYK A;  3TEE A;  2K9G A;  3VS5 A;  4ATO A;  3OB9 A;  3RUX A;  2L2P A;  1EIF A;  2DNU A;  4MZT A;  4E6R A;  2BZ8 A;  3CXC A;  5EC7 A;  4FT4 A;  1UGS B;  4C92 G;  2JVV A;  4PJO F;  2PTK A;  1PKS A;  4M78 F;  4NOY A;  3OS0 A;  3I56 Q;  5HKC A;  3R6N A;  2NUZ A;  4JDS A;  1X75 C;  1G2B A;  2M1H A;  3JCM h;  2LT1 A;  2EFI A;  4WCI A;  5GAO m;  2HL3 A;  4XU3 A;  1VQ6 A;  2ZAE A;  2X9H A;  2HL5 C;  4R0K A;  3CMA Q;  2FO0 A;  3LW5 E;  1D0Z A;  1H3H A;  1W2B A;  1B07 A;  1N8R C;  1QP3 A;  1Y57 A;  5J39 A;  2KR3 A;  2EJ9 A;  2NUP A;  3FJ5 A;  4A53 A;  4CC4 B;  1BIA A;  2DJZ A;  1YEL A;  3E1S A;  1M5Q 1;  2XID A;  2YUO A;  2O9S A;  4BB7 A;  4OMM A;  3QG1 A;  3SDZ A;  1N6A A;  5LJ3 e;  3LH0 A;  1KD1 C;  4DQ2 A;  5DLQ E;  2O31 A;  2GF7 A;  3M0Q A;  2ZPB B;  3LWH A;  1QQJ A;  1VQL A;  1NA6 A;  3OYL A;  5I11 A;  3CCV Q;  1YHQ Q;  4C0G A;  2D0Q B;  1MHN A;  4KBM B;  1PHT A;  4QKU A;  2E64 A;  2EJG A;  1VQ7 A;  4AG2 C;  3U23 A;  2JW4 A;  2BKD N;  2O9V A;  1D0X A;  2LT4 A;  5GAM f;  3CCR Q;  1WJR A;  2O01 E;  5GAN e;  2QI2 A;  5LJ5 e;  3JCM X;  4PFP A;  1I5L A;  4J9H A;  2JTM A;  2QTV A;  2PNI A;  1BCO A;  3TQ7 P;  1MMN A;  4R56 A;  1WHM A;  3CCU Q;  3M4Y A;  4BDY A;  3OYG A;  3OYC A;  3GOX A;  3KXT A;  1QVF P;  4F7U B;  5DM7 R;  1M1F A;  2C0I A;  1DJ7 B;  3A5Z B;  3GNG A;  4RTT A;  2E65 A;  2CZ0 B;  1RAG B;  2AIR B;  1VQ6 T;  3JCM c;  3BW1 A;  4BE2 A;  2J6O A;  1NZ9 A;  4K11 A;  1UJY A;  4ZGE B;  4NL2 A;  2C0T A;  4OP0 A;  4AFZ C;  4HVU A;  3PMI A;  1YJ9 T;  3V8L A;  3EGD B;  1K9A A;  3CCS A;  1QVF A;  3PGG A;  2LQN A;  4LUD A;  2J06 A;  2XDP A;  3L42 A;  2J6F A;  3G71 Q;  1HYO A;  2KYM A;  5FW9 A;  1QMC A;  1W6X A;  4RUG A;  3CCQ Q;  2RF0 A;  1QVG S;  3FDR A;  1M90 C;  3RER A;  2LQK A;  5DY9 A;  3L2R A;  2KRS A;  5FRN A;  2DL8 A;  5FLX E;  5KE3 A;  3MHX A;  2P0P A;  1VQL T;  4UC4 A;  4C0F A;  1NEB A;  4C5E A;  5GAM j;  4E7Z A;  1H8K A;  1M3B A;  1D3B A;  2DO3 A;  1HD3 A;  1NYG A;  2CH4 A;  2CS7 A;  4J5Y A;  1VQN A;  4M77 F;  1YI2 Q;  3I55 A;  2RK2 A;  3EHR A;  3CPW P;  1GBQ A;  1I8F A;  2L8D A;  3QZ9 B;  2RQU A;  1S72 Q;  3OS5 A;  2EPD A;  3HKS A;  2OI3 A;  5FU6 B;  4B9W A;  1LCK A;  2RQR A;  2FZC B;  2CUB A;  1IXD A;  3OW2 S;  3RMS A;  2BZX A;  5CIU A;  3CBP A;  3JCM V;  4M77 B;  3CPW S;  3CPW A;  1QLY A;  3M0T A;  2RQW A;  1NJI U;  3O5Z A;  2RJF A;  4QVZ A;  2LNH B;  1CKB A;  1TS9 A;  2DTH A;  2LQ8 A;  3OQ5 A;  2ED0 A;  8ATC B;  1R0B G;  2VC8 A;  3OYM A;  1ZX6 A;  2RB6 A;  2DAQ A;  1OZ3 A;  1M1K U;  2QAS A;  2X4X A;  5FU7 B;  2PVD B;  4OB1 B;  5GAM h;  1K0S A;  2LMJ A;  2DTI A;  3Q1J A;  4RTZ A;  3C95 A;  5IHK A;  3I9Q A;  3S3M A;  5GAN d;  4C8Q G;  2DXU A;  2K4Y A;  3GF5 A;  1ZBX A;  3EH2 A;  3J80 E;  1JB0 E;  1TH7 A;  2KNB B;  1VQN T;  3C0C A;  1N0E A;  1AOJ A;  3OS1 A;  4HCB A;  1ZQ1 A;  2DX1 A;  3I55 T;  4BY6 C;  1UHC A;  4XQ3 A;  5A0G A;  1AWX A;  3V8K A;  1WHH A;  4LDX A;  4HXJ A;  3TU4 K;  4B6M A;  4OMO A;  1NYF A;  4N0A C;  2DL3 A;  2GFA A;  2KXD A;  4PKC C;  3SHW A;  2VV5 A;  1KC8 R;  2CUD A;  2F1L A;  2K57 A;  4F17 A;  3ZEH A;  3EG3 A;  4C8Q E;  5LJ3 f;  2KY9 A;  4XU2 A;  2YRV A;  4IUT A;  4DEX A;  3BFM A;  5CCA A;  1GXI E;  2LNV A;  3A8M B;  5L23 A;  3O8V A;  1HJD A;  5A0D A;  2R5A A;  2JUF A;  2BE9 B;  1JU5 C;  1QVP A;  4FIB A;  2NYS A;  5A0L A;  3VS3 A;  4FW2 A;  2VB6 A;  2MYS A;  2CP0 A;  1MGQ A;  2DD4 A;  1X2Q A;  2MWP A;  3KFV A;  4BUG A;  1IZ6 A;  3CCM A;  3URG A;  1F1B B;  1PSE A;  4J9C A;  3MP8 A;  2G6F X;  2DA9 A;  3REB B;  2PUO B;  7AT1 B;  1WZO A;  1H3Z A;  2KXC A;  5CKD A;  5GAN 8;  3NHN A;  1IHW A;  2QG9 B;  4ZNX A;  5IXF A;  2KI7 A;  4GY5 A;  1G3S A;  2FVU A;  1AD5 A;  3JCM Q;  3I56 A;  2QEX A;  2ESW A;  2PZ1 A;  1D1B A;  2DL4 A;  2CP2 A;  3NTH A;  2EQU A;  4EMK A;  2C06 A;  2LJ3 A;  2ATC B;  5LJ3 j;  3T9N A;  2MI6 A;  3H0I A;  2JS0 A;  3SWN B;  3UF4 A;  3DB4 A;  3CMA A;  1OI1 A;  3M0U A;  5GMK m;  1D0Y A;  4RTU A;  1CKA A;  1Q7Y C;  2JN0 A;  1YIT T;  4OB0 B;  2D1X A;  4II1 A;  2EYX A;  1UGP B;  2AKK A;  2KDS A;  5AYF A;  5GAO n;  3M57 A;  3OMG A;  4ELY C;  2W0Z A;  2O4X A;  1B7T A;  5GAN j;  2HCK A;  5LJ5 j;  4O5V A;  3V8J A;  1K73 C;  3GLX A;  1IRE B;  2QQR A;  4XU1 A;  4M7A E;  4F16 A;  1K8A C;  1GFC A;  3H0H A;  1N0G A;  2RQT A;  1E7O A;  3LYI A;  3OYH A;  3CCM T;  4X1V A;  2K2M A;  2IVW A;  4OB3 B;  2MF2 A;  3CCV A;  2M51 A;  1VQ8 Q;  5D6X A;  3M59 A;  1YHQ A;  3TCJ A;  1TOV A;  3OSS C;  2RA2 A;  3H0F A;  4QQD A;  1IGU A;  3UA7 A;  2QYZ A;  2EYW A;  4BI8 B;  2EW3 A;  2DEQ A;  3TSZ A;  2P0K A;  4FU6 A;  3CCR A;  4IUP A;  4CRI A;  4M7D G;  1GCQ C;  4RTY A;  4BI3 A;  2HNI A;  3EG9 A;  4N4H A;  1NJI R;  2V8I A;  4HVV A;  4JS4 A;  3CCU A;  1Q82 C;  5GAN 6;  1B34 B;  3I56 T;  4RMO A;  1UG1 A;  1T3L A;  4AMC A;  2QEX T;  1Y07 A;  3M4G A;  1JXM A;  1V1C A;  5LJ3 h;  1Q86 U;  3NTK A;  3RR6 A;  3PVL A;  3PMT A;  1OQK A;  4XTW A;  4Y92 A;  4D8D A;  4Y91 A;  3PNW C;  1YWP A;  2RJD A;  1UJ0 A;  4M7D E;  1VQO Q;  1G3Y A;  1WPY A;  1ZUU A;  2RM4 A;  3JB9 G;  4PJO C;  2CP5 A;  3CCE Q;  4OGE A;  1XJW B;  3WVE B;  3X20 B;  2CKK A;  1NLP C;  4QQ6 A;  5GJW B;  3MCA B;  3EAE A;  4XTV A;  2KMT A;  4ELZ C;  4OMF B;  2OJ2 A;  2YXY A;  3G71 A;  1WQ7 A;  3ASK A;  5D6Y A;  1Y0M A;  1GCQ A;  3KBG A;  5CKB A;  3CCQ A;  2CH4 W;  4AG1 C;  1GRI A;  2CP7 A;  5I22 A;  1ABO A;  1OEB A;  3SB2 A;  2WSC E;  4HCK A;  2FRW A;  3QYG B;  1W1F A;  1UDL A;  3I5S A;  3CCV T;  2HMA A;  1UGQ B;  1AVZ C;  2AK5 A;  1YHQ T;  2AT1 B;  2DLP A;  3M5A A;  5KYX B;  3RES A;  1QKW A;  2XHC A;  2G3R A;  2OTL Q;  2EGE A;  4C92 B;  2DD5 A;  2YRD A;  3CCR T;  1YI2 A;  3GBQ A;  1N0F A;  2E5Q A;  2XI9 A;  2DZ9 A;  1OYX A;  2HDA A;  4D6W A;  4FSX A;  1OV3 A;  1XOV A;  2KT1 A;  3EGU A;  4M75 G;  1N8R U;  3ZI5 A;  1S72 A;  3FLG A;  5GAN 2;  5C0M A;  4PJL A;  1C6V X;  2CSI A;  4XU0 A;  3QII A;  3H9N A;  1T3S A;  4R55 A;  3G4S Q;  3VS1 A;  5KH6 A;  3EG2 A;  3RMQ A;  2P4T A;  1QCO A;  5A2Q E;  1YBY A;  4JLG A;  4QW2 A;  5KYW B;  1KD1 U;  1G3W A;  4J8O A;  3CXC P;  3CC4 Q;  4LUE A;  4M75 E;  2YDL A;  1VOM A;  3RDV A;  2X4W A;  4PLL A;  2HKN A;  2EYY A;  2XG8 D;  4J9G A;  3G71 T;  1VQ4 Q;  3D7S B;  1RI0 A;  1SF9 A;  3CCQ T;  1HSQ A;  3CXC S;  2OTJ Q;  1OPL A;  2V1R A;  4NS5 A;  1WJS A;  2DL5 A;  4PJO D;  4F7U A;  4M78 D;  2CZ1 B;  1W2B P;  1KHI A;  5FWB A;  5IHN A;  3FJP A;  4DOW A;  2DRK A;  4J9E A;  3PT9 A;  3H41 A;  1VQK Q;  1R8O B;  4XTU A;  2FB7 A;  2GGR A;  2LX9 A;  3MP1 A;  2EKO A;  1FX7 A;  1G3T A;  4ZTF A;  2QQB A;  1YCY A;  1YI2 T;  2QXF A;  2A0F B;  2V8J A;  3LH5 A;  3EGD A;  4TVR A;  4JJC A;  1W2B S;  1ZA2 B;  4KUL A;  1J3T A;  1KFZ A;  1TU0 B;  4C92 E;  1S72 T;  2DBM A;  4MDX A;  1R77 A;  2NUT B;  2M0O A;  1TUG B;  1AEY A;  2GTO A;  2LTO A;  1M9S A;  5FU6 C;  4AFS C;  4DA4 A;  1ZBJ A;  3JCM g;  1AWO A;  1VQ5 Q;  3KUF A;  1I81 A;  3HHT B;  2ZPG B;  3MEA A;  4M77 C;  1KQ1 A;  4DBF A;  5FRO A;  4ZTJ A;  4ORZ A;  2L89 A;  1A0N B;  1UEB A;  2KBT A;  2F5T X;  1U3O A;  4MMK A;  2SEM A;  2HSE B;  3CME T;  1BI2 A;  2KQW A;  4C0D B;  1X01 A;  2KRN A;  1LNX A;  1XQH A;  3LGL A;  2VVK A;  2QDY B;  4J9I A;  2E3I A;  4VUB A;  4F7U F;  3QKJ A;  3OYF A;  2DRM A;  3UDC A;  2HAX A;  3UWN A;  3EH1 A;  3BE3 A;  1UGR B;  3JCM P;  5HK3 A;  5FU7 C;  3C4S A;  3ZL7 C;  3QZ5 B;  1SRM A;  1Q86 R;  3J7A F;  2E1H A;  3A8O B;  2A36 A;  4KGZ B;  3A8H B;  3UT1 A;  5D6W A;  2W10 A;  3MO8 A;  2EIF A;  3DLM A;  4WTO B;  3RBB B;  2Y90 A;  2RMO A;  1VQ9 Q;  5GAO q;  2RHU A;  2DL7 A;  4M77 A;  5CO7 A;  4AT1 B;  2H8H A;  1OX8 A;  4QVD A;  5KYN A;  2JJ9 A;  4E7I A;  2MWO A;  5GJV B;  2H3E B;  3VYG A;  2I2L A;  3QUI A;  4OMP A;  3UPU A;  2XU8 A;  4CC7 A;  2EYZ A;  1M1G A;  1PD0 A;  3JB9 H;  4FL6 A;  2NWM A;  1QVF S;  1TG0 A;  2PU9 B;  2FPD A;  4PJO G;  1QKX A;  3F70 A;  4M78 G;  4OB2 B;  1MND A;  1IGQ A;  3MEW A;  3E9F A;  1M8M A;  1NE8 A;  2FZG B;  2J7I A;  1JBM A;  4QQG A;  4EMG A;  2C1L A;  1BI3 A;  4C8Q F;  1FMW A;  1BBZ A;  3N5B B;  2QTX A;  2D6F A;  3QYH B;  5CKF A;  1NEG A;  3OBW A;  4GLK A;  5CAI A;  2DF6 A;  1BI1 A;  2E41 A;  2DER A;  1N8R R;  3VUB A;  4M78 E;  2CGH A;  2GFU A;  4M77 D;  1VQ7 T;  1KC8 C;  1KQS P;  1VQ8 A;  3HRS A;  4JZ4 A;  5I2M A;  3OYY A;  4C8Q B;  5IT9 E;  1K9M C;  3RKY A;  2RHY A;  2IG0 A;  1WQW A;  1T0H A;  4DBR A;  3P8D A;  3GNF B;  2JZ2 A;  4FYX B;  2JXB A;  4M7A A;  3ME9 A;  3QHS A;  1M2V B;  4GBQ A;  1KQS S;  1SSF A;  1KQS A;  1ZLM A;  3M55 A;  1RAI B;  4ZGD B;  4A4E A;  3A8L B;  1ZSZ A;  4KH0 B;  5CKE A;  5HY6 A;  3SWN C;  3SFM A;  2GNC A;  1WXT A;  3SD4 A;  2FEI A;  3CBM A;  3HSB A;  2QK0 A;  1VQO A;  5IXB A;  4CC3 A;  3CCS T;  3CCE A;  3E9G A;  3GPL A;  4KRT A;  1K4U S;  3JCM b;  5CR2 A;  4E7J A;  1Z9Z A;  5GMK e;  1E6G A;  2OX7 A;  1TTH B;  3ZBD A;  3TVT A;  4NL3 A;  2EKH A;  1QCN A;  1K0X A;  1ZHI A;  2C0O A;  1KJW A;  2R57 A;  2B86 A;  1LPL A;  4RTV A;  4O6J A;  2DJQ A;  3OYK A;  3P8H A;  2DXC A;  5M9O A;  3M54 A;  1YWO A;  4M7D A;  3BDU A;  2CZ7 B;  2EBP A;  5CQX A;  1FYN A;  4AFU C;  2DIG A;  2DYB A;  3S6W A;  2XIC A;  1X6O A;  3SWN A;  4M7A F;  3VV0 A;  3M9Q A;  1PD1 A;  1OZ2 A;  4JS5 A;  2P4R A;  2OTL A;  5GAM g;  1K76 A;  2JOY A;  1NM7 A;  1OU8 A;  3OYD A;  1Q7Y U;  4RKU E;  4QT7 A;  2CYZ B;  1K1Z A;  1Q81 C;  3PVQ A;  4J7F A;  2PVG B;  3G4S A;  2HKQ B;  4FYW B;  1C0M A;  2DE0 X;  4E7S A;  4M7A B;  2ROL A;  3QWY A;  1YJ9 Q;  4JLI A;  2GBQ A;  2LRQ A;  4EMK C;  1K73 U;  2HBW A;  4OMQ A;  2X35 A;  2X51 A;  4J9B A;  3QDF A;  1ZSZ B;  1VQO T;  1K8A U;  3CC4 A;  3JCM J;  1WNL A;  2AZS A;  5GAN f;  2YHT A;  5LJ5 f;  3CCE T;  3EFO B;  4JRI A;  3EHQ A;  1MUZ A;  3J81 E;  3MPU B;  3QXE B;  2K3X A;  4M7D F;  1QCF A;  1NJI C;  3L2Z A;  3M0S A;  2RD1 A;  1VQ4 A;  3HRT A;  2KK4 A;  1VYT A;  2YUP A;  3LWI A;  2QA4 Q;  1B34 A;  3C94 A;  2Y4X A;  4L6V 5;  3V7R A;  2OTJ A;  2L3R A;  4KT0 E;  2K5F A;  2ABL A;  3VYH B;  2DM1 A;  1YJN Q;  1RLQ C;  3L1A A;  2DXT A;  3L2U A;  1TWB A;  3HFN A;  1Q82 U;  2FRY A;  4JJD A;  1YIJ Q;  2L0A A;  3UAT A;  4M7D B;  1M27 C;  3LX7 A;  4J6X A;  1VQK A;  3JB9 F;  2YLC A;  2E10 A;  1YN8 A;  1OPK A;  2OTL T;  1MV0 B;  2CSQ A;  3EFR A;  4Z88 A;  1WIE A;  1AZE A;  2ZZD A;  1V29 B;  1I1J A;  1GBR A;  1YJW Q;  2FPF A;  1KG1 A;  4PK4 A;  4ZN3 A;  4L59 A;  1W70 A;  2COW A;  2Z0W A;  3PIO A;  3QJY A;  2X4Y A;  4J9D A;  4ESR A;  5AT1 B;  1VQ5 A;  2VKN A;  2LC4 A;  3G4S T;  1JJ2 P;  4JPB W;  1ZA1 B;  2HQX A;  4E47 A;  3AHU A;  2ZGW A;  3LLR A;  3JCM d;  2LCS A;  5GAO r;  3JV3 A;  2KGT A;  2RN8 A;  1AZG B;  3CC4 T;  2YUN A;  5KYX A;  3MJX A;  2WSF E;  1WX6 A;  1MNE A;  2HEQ A;  2K6D A;  2KT8 A;  4C92 A;  1JJ2 A;  3V7S A;  2XD0 A;  3M53 A;  3VRZ A;  1WDX A;  4D8K A;  4I1K A;  4DEY A;  4J6W A;  2V26 A;  1TXQ A;  3QJ6 A;  2RJE A;  3FB9 A;  1VQ4 T;  3JCM W;  2JMA A;  4HT8 A;  1VYU A;  2OTJ T;  1ZUK A;  4IIM A;  2PQW A;  3VS7 A;  3G1J A;  1M30 A;  2EQJ A;  4FT2 A;  1IRX A;  1VQ9 A;  4KUI A;  3I35 A;  5KYW A;  4CI0 C;  1YNZ A;  4ZN1 A;  3VS2 A;  3NPF A;  2RHX A;  3X28 B;  4PLI A;  1VQK T;  1QWF A;  3OYJ A;  1X6B A;  2E12 A;  3G7Z A;  4M75 B;  5KCO A;  2E70 A;  1PRL C;  1WA7 A;  4JRK A;  4PJN A;  5J3B A;  3CMA T;  1RAA B;  1M1K R;  1Y96 B;  2Y4Y A;  2H3J A;  5EG2 A;  1RL2 A;  2DIL A;  2VUB A;  1RI9 A;  3PTA A;  4DBQ A;  3CC7 Q;  2MPX C;  3A98 A;  2PVO B;  3E19 A;  1ZUY A;  2LP5 A;  5LJ3 g;  3H8Z A;  5GAN h;  1VQ5 T;  5LJ5 h;  3CC2 Q;  1TSF A;  2LX7 A;  1LOJ A;  1G5V A;  3FRN A;  4RG2 A;  2RPN A;  4C92 F;  1G8X A;  3VS0 A;  2DZC A;  2DTO A;  1UEC A;  1ARK A;  4EMH A;  1AHJ B;  5CKH A;  1X6G A;  2LCC A;  4C0D C;  2F2W A;  2DVJ A;  1UHF A;  5GAN 4;  2M16 A;  2COZ A;  4E7H A;  4F04 B;  2CDT A;  4MZP A;  1BK2 A;  1BKB A;  2RNA A;  1Q7Y R;  5KYY B;  3VKI A;  3QPH A;  2M02 A;  4KGX B;  5I21 A;  9ATC B;  5IN1 A;  3G6E Q;  3EGX B;  3PE0 A;  2NUT A;  1S1N A;  4LN2 A;  2LJ0 A;  3RKX A;  4HA8 A;  4Y28 E;  5J26 A;  1WHL A;  2RJC A;  1VA7 A;  1K73 R;  2EAY A;  4F14 A;  4E2F B;  5HK0 A;  2GCX A;  2KRO A;  3CCU T;  1VQ9 T;  2CZ6 B;  1Y7X A;  1K8A R;  1OOT A;  4PJM A;  2FPE A;  5GMK j; 
#chains in the Genus database with same CATH homology
 1WJQ A;  1N27 A;  4JRP A;  1M1K U;  2R5M A;  1U1S A;  2X4X A;  2EWN A;  5FU7 B;  5GAO q;  2RHU A;  2VGM A;  3HP9 A;  3M56 A;  1O75 A;  2PVD B;  4M77 A;  4OB1 B;  5GAM h;  5CO7 A;  2RO0 A;  2DTI A;  3Q1J A;  3C95 A;  1JJ2 S;  4QVD A;  3S3M A;  3GP8 A;  2DVE A;  4E7I A;  2QQS A;  5GAN d;  2MWO A;  4C8Q G;  2L5Q A;  4M75 D;  3VYG A;  2DXU A;  2K4Y A;  3GF5 A;  5DLO A;  4M75 F;  1ZBX A;  3J80 E;  2I2L A;  2MMP A;  1JB0 E;  4FM4 B;  1UB4 A;  3WVD B;  1TH7 A;  2XKO C;  1VQN T;  3QUI A;  3UPU A;  2XU8 A;  3C12 A;  3CCJ A;  3OS1 A;  4HCB A;  1ZQ1 A;  3I55 T;  1M1G A;  3OA6 A;  4BY6 C;  3JB9 H;  4FL6 A;  4XQ3 A;  5A0G A;  3V8K A;  2XDD A;  3QO3 A;  4A4G A;  1QVF S;  4LDX A;  2EJF A;  2PU9 B;  3TU4 K;  4PJO G;  4MZM A;  2LVM A;  3F70 A;  4M78 G;  1HXD A;  4OB2 B;  2X4J A;  1VQM A;  4L5G A;  4N0A C;  1PSF A;  2KAF A;  2GFA A;  3MEW A;  3E9F A;  1FXX A;  2HBP A;  4PKC C;  1NE8 A;  4EDU A;  3H6Z A;  2VV5 A;  4XTX A;  2K57 A;  4OGC A;  3ZEH A;  3DKM A;  4C8Q E;  4E7K A;  5LJ3 f;  1JBM A;  4BY6 B;  4QQG A;  2KY9 A;  4XU2 A;  4EMG A;  1BI3 A;  2YRV A;  4IUT A;  3BFM A;  4C8Q F;  4J83 A;  5CCA A;  1GXI E;  3OYB A;  2LNV A;  3A8M B;  1XTD A;  3N5B B;  3GIB A;  2QTX A;  2DKG A;  4BE1 A;  3O8V A;  3QYH B;  3JCM f;  2D6F A;  2ZPI B;  5A0D A;  2R5A A;  2JUF A;  5GAM e;  5CKF A;  3OBW A;  5GAO l;  4GLK A;  3M58 A;  1QVP A;  2GQV A;  4FIB A;  3JSC A;  1BI1 A;  2M9U A;  5A0L A;  5CAI A;  3OS2 A;  4WF2 A;  3OYA A;  2E6N A;  1M8V A;  2E41 A;  4C8Q C;  1BIB A;  3VUB A;  1MGQ A;  4M78 E;  1JRI A;  2CGH A;  2DD4 A;  2GFU A;  2K5I A;  4M77 D;  1VQ7 T;  2MWP A;  3X24 B;  1KC8 C;  3JB9 F;  4BUG A;  1VQ8 A;  3HPW A;  3HRS A;  3X25 B;  2RI5 A;  5I2M A;  1IZ6 A;  3CCM A;  1U1T A;  3URG A;  1HK9 A;  2BIV A;  2MAM A;  1PSE A;  4C92 D;  2YLB A;  3OYY A;  3MP8 A;  5IAY A;  3VJP A;  3L2Q A;  4C8Q B;  5GMK h;  4EMK B;  3INZ A;  3TRE A;  5IT9 E;  2EQK A;  5GAM d;  3RKY A;  1K9M C;  3CCL A;  2PUO B;  4M78 C;  2RHY A;  3WXM B;  3L2V A;  4EPC A;  2IG0 A;  2KSS A;  1WQW A;  2LCL A;  4N4I A;  3OYI A;  3R6O A;  3P8D A;  3JB9 J;  3JB9 I;  1H3Z A;  4BI4 A;  2QQA A;  5CKD A;  3GNF B;  4OVA A;  3OY9 A;  5GAN 8;  3QDR B;  3CD6 A;  2JZ2 A;  5I2S A;  2ZCF B;  4E7L A;  2DPP B;  4M7A A;  5CQY A;  3ME9 A;  3QHS A;  1M90 U;  4HCC A;  1KQS S;  1SSF A;  1KQS A;  3M55 A;  1YJ9 A;  4GY5 A;  4PJO B;  5GAN g;  4M78 B;  4ZGD B;  5LJ5 g;  4BD3 A;  4A4E A;  1G3S A;  4A4K A;  2FVU A;  3A8L B;  1O9S A;  4XK8 E;  5KCH A;  3EFS A;  5CKE A;  5HY6 A;  3SWN C;  3SFM A;  1WGS A;  3JCM Q;  3MP6 A;  1Y71 A;  4LDW A;  3I56 A;  2K2V A;  2QEX A;  3SD4 A;  2VXE A;  2O4X B;  2E6Z A;  3CCJ T;  4C5H A;  3CBM A;  3NTH A;  5CVI A;  3HSB A;  2EQU A;  4C8Q A;  4EMK A;  2C06 A;  3RKW A;  1VQO A;  3BDL A;  1VIE A;  2DIQ A;  1KC8 U;  3HQF A;  4J6Y A;  1QW1 A;  5LJ3 j;  3T9N A;  3CCS T;  3CCE A;  2MI6 A;  3E9G A;  3GPL A;  2RHI A;  1U8R A;  3SWN B;  3DB4 A;  4KUD K;  3HFO A;  1VQM T;  3JCM b;  3CMA A;  1OI1 A;  5CR2 A;  2XK0 A;  4E7J A;  4RCB A;  5GMK m;  5GMK e;  3X26 B;  1Q7Y C;  1K9M U;  1KHC A;  2ZPF B;  3OSV A;  3ZBD A;  2JN0 A;  3MEU A;  2QA4 A;  1YIT T;  4OB0 B;  4X34 A;  3VU3 C;  4NL3 A;  4PJO A;  5GMK i;  4M78 A;  4II1 A;  1BYM A;  1UGP B;  1ZHI A;  2QQ9 A;  1NPP A;  2R57 A;  2KDS A;  4XTZ A;  2NLU A;  5AYF A;  5GAO n;  1YJN A;  4O6J A;  3M57 A;  2A3L A;  3OMG A;  3P8H A;  3OYK A;  2AHJ B;  2DXC A;  3M54 A;  1XNI A;  3CPF A;  4IUR A;  3FEO A;  4ELY C;  5M9O A;  2O4X A;  3DLL A;  5GAN j;  1YIJ A;  4M7D A;  3BDU A;  5LJ5 j;  2HQE A;  2CZ7 B;  2RI3 A;  2WAC A;  4BE0 A;  5FRM A;  4O5V A;  3QBY A;  5CQX A;  3V8J A;  2B8A A;  1K73 C;  1Q86 C;  2DIG A;  3GLX A;  4JRQ A;  1IRE B;  3S6W A;  2QQR A;  2ZPE B;  4XU1 A;  4M7A E;  3FIF A;  2F69 A;  1K8A C;  2RI2 A;  2ZPH B;  2XIC A;  1X6O A;  3SWN A;  1VUB A;  4M7A F;  3LYI A;  3OYH A;  3V7C A;  3VV0 A;  3CCM T;  3M9Q A;  2IVW A;  4OB3 B;  4YTL A;  5CK9 A;  2MF2 A;  1OZ2 A;  4JS5 A;  4PNO A;  3CCV A;  1YJW A;  3RIR A;  2OTL A;  5GAM g;  5GAO p;  4A4H A;  3CME A;  5D6X A;  3M59 A;  3CCL T;  1P92 A;  2JOY A;  3TCJ A;  1YHQ A;  3OSS C;  4RG8 A;  2RA2 A;  4QQD A;  3JAM E;  4M7A C;  3OYD A;  4BI8 B;  3CD6 T;  2DEQ A;  1Q7Y U;  4RKU E;  1H64 1;  2P0K A;  4FU6 A;  2CYZ B;  4C8Q D;  3CCR A;  4IUP A;  4CRI A;  4M7D G;  1Q81 C;  2F5K A;  4LDV A;  4V2S A;  4LD6 A;  4BI3 A;  5GAN 3;  3MET A;  4C5I A;  4J7F A;  2PVG B;  2FYK A;  4A4F A;  2HNI A;  3TEE A;  4A54 A;  3L2W A;  3G4S A;  4ATO A;  4N4H A;  2DXB A;  3OB9 A;  3RUX A;  1EIF A;  4MZT A;  4M7A B;  2V8I A;  4JS4 A;  3CCU A;  1Q82 C;  3CXC A;  5GAN 6;  4JLI A;  1B34 B;  2LRQ A;  3I56 T;  4EMK C;  4RMO A;  1M4Z A;  1UGS B;  1Y07 A;  3M4G A;  4FT4 A;  4RCC A;  2QEX T;  4PJO E;  3NFC A;  1K73 U;  4C92 G;  2X35 A;  4IUV A;  3PFS A;  5LJ3 h;  3MEV A;  5L8R E;  1Q86 U;  2JVV A;  3NTK A;  4PJO F;  1QVG A;  3OS0 A;  4M78 F;  2VYT A;  3OMC A;  4NOY A;  3PMT A;  1VQO T;  1K8A U;  3CC4 A;  3CEY A;  4XTW A;  3JCM J;  5HKC A;  1WNL A;  4JDS A;  5GAN f;  1X75 C;  2M1H A;  2YHT A;  3JCM h;  3NTI A;  4Y91 A;  2LT1 A;  2EFI A;  5LJ5 f;  3PNW C;  3CCE T;  4JRI A;  5GAO m;  2RJD A;  4M7D E;  2VXF A;  1I4K 1;  3J81 E;  1G3Y A;  1WPY A;  2RM4 A;  3JB9 G;  3BY7 A;  4PJO C;  3QXE B;  4XU3 A;  2K3X A;  4M7D F;  1VQ6 A;  4JUV A;  4OGE A;  2QA4 T;  1NJI C;  3L2Z A;  2RD1 A;  3HL8 A;  3WVE B;  3LW5 E;  2CKK A;  4QQ6 A;  3X20 B;  3HRT A;  4P5N A;  1VQ4 A;  2KK4 A;  3LWI A;  3MCA B;  1W2B A;  3EAE A;  1N8R C;  4XTV A;  2KMT A;  4ELZ C;  1YJN T;  1QP3 A;  4OMF B;  4M7D C;  1B34 A;  1Q81 U;  2JTF A;  2Y4X A;  3C94 A;  4L6V 5;  3V7R A;  5J39 A;  2OTJ A;  2L3R A;  4KT0 E;  4F7U G;  3G71 A;  2EJ9 A;  2D9T A;  1WQ7 A;  2K5F A;  2BUD A;  3CBO A;  4XTY A;  3ASK A;  5D6Y A;  4XAX B;  4A53 A;  1YIJ T;  3VYH B;  1BIA A;  2DJZ A;  3KBG A;  5CKB A;  3CCQ A;  1YEL A;  3E1S A;  5GAN 7;  3QSU A;  1M5Q 1;  2XID A;  2DXT A;  3L1A A;  3L2U A;  3HFN A;  1Q82 U;  4BB7 A;  3QG1 A;  3SDZ A;  4M7D B;  3SB2 A;  1N6A A;  3LX7 A;  4J6X A;  2WSC E;  2PUK B;  3LH0 A;  5LJ3 e;  2YLC A;  1KD1 C;  1VQK A;  4DQ2 A;  5DLQ E;  2E10 A;  3QYG B;  2GF7 A;  1YJW T;  3CCV T;  2OTL T;  1UGQ B;  3JCM e;  1YHQ T;  2ZPB B;  4B9X A;  3LWH A;  3EFR A;  3CC7 A;  3OW2 A;  3M5A A;  4C0Z A;  2ZZD A;  3RES A;  1VQL A;  1NA6 A;  1V29 B;  4JJN K;  2XHC A;  3OYL A;  2G3R A;  4F7U E;  1W4S A;  1KG1 A;  4C92 B;  4ZN3 A;  2DD5 A;  4L59 A;  4C0G A;  3CCR T;  2D0Q B;  3PIO A;  1YI2 A;  3CC2 A;  1MHN A;  3S3O A;  2FL7 A;  2E5Q A;  3QJY A;  4KBM B;  2X4Y A;  2E64 A;  2EJG A;  2DZ9 A;  1OYX A;  2RHZ A;  2XI9 A;  3OYN A;  1VQ7 A;  4D6W A;  4FSX A;  1XOV A;  2BKD N;  4M75 G;  2LT4 A;  5GAM f;  2LC4 A;  3G4S T;  1N8R U;  5LJ3 d;  1S72 A;  1VQ5 A;  3FLG A;  1WJR A;  2O01 E;  5GAN e;  5C0M A;  2QI2 A;  5LJ5 e;  5GAN 2;  2HQX A;  4E47 A;  3JCM X;  2JNG A;  1I5L A;  2JTM A;  3AHU A;  2ZGW A;  3LLR A;  4XU0 A;  4BDZ A;  2K5L A;  3HRU A;  3QII A;  4N4G A;  4R55 A;  3JCM d;  2P0Q A;  5KH6 A;  2HD0 A;  5GAO r;  4X9C A;  3RMQ A;  4R56 A;  5C6S A;  2KVQ G;  2P4T A;  5KE2 A;  4M7A D;  2FHD A;  2R58 A;  3M4Y A;  4BDY A;  3CC4 T;  1VQ8 T;  5A2Q E;  4LDY A;  1YBY A;  4JLG A;  4QW2 A;  2WSF E;  3OYC A;  3OYG A;  3GOX A;  3KXT A;  3OBY A;  2OAU A;  4Q5W A;  2RH2 A;  4C5G A;  4DOV A;  4F7U B;  5DM7 R;  3G6E A;  1KD1 U;  1M1F A;  4C92 A;  1G3W A;  1DJ7 B;  2WSE E;  3A5Z B;  4J8O A;  1JJ2 A;  1N9R A;  3V7S A;  3GNG A;  2XD0 A;  2E65 A;  2CZ0 B;  3M53 A;  4M75 E;  1VQ6 T;  5LJ5 d;  3JCM c;  4I1K A;  3BW1 A;  4J6W A;  2A7Y A;  4BE2 A;  2X4W A;  4PLL A;  1NZ9 A;  3A8G B;  3QJ6 A;  2RJE A;  3FB9 A;  1VQ4 T;  2XG8 D;  1BI0 A;  2DK3 A;  4NL2 A;  4ZGE B;  3JCM W;  4ME7 A;  4OP0 A;  4HT8 A;  4IUQ A;  2OTJ T;  3PMI A;  4J7I A;  1YJ9 T;  3V8L A;  3G71 T;  1D3B B;  1RI0 A;  2VGN A;  4M75 C;  3CCS A;  1QVF A;  4PL6 A;  3PGG A;  2PQW A;  3CCQ T;  2XDP A;  3CXC S;  2EQJ A;  3L42 A;  4FT2 A;  3LGF A;  4M77 G;  4BAC A;  1VQ9 A;  4MDW A;  4NS5 A;  4KUI A;  4ZGJ B;  1WJS A;  4MML A;  5LL6 S;  4HCZ A;  4CI0 C;  1VQP A;  5GAN 5;  4PJO D;  2V8K A;  4M78 D;  4F7U A;  4ZN1 A;  2CZ1 B;  2RHX A;  2EQM A;  3X28 B;  3PIP A;  4PLI A;  1YIT A;  1QVG S;  1VQK T;  3OYJ A;  3FDR A;  1M90 C;  3RER A;  1KHI A;  2LQK A;  5DY9 A;  2E12 A;  3FJP A;  3G7Z A;  4M75 B;  5KCO A;  4DOW A;  3L2R A;  5FRN A;  2E70 A;  2RK1 A;  5FLX E;  4HKE A;  5KE3 A;  3PT9 A;  3MHX A;  4JRK A;  2XDB A;  3CC7 T;  1R8O B;  1NPR A;  5J3B A;  4M7D D;  2P0P A;  3CMA T;  4XTU A;  4UC4 A;  1VQL T;  1Y96 B;  2FB7 A;  2LX9 A;  3MP1 A;  2EKO A;  2Y4Y A;  4C0F A;  4C5E A;  1FX7 A;  2H3J A;  1G3T A;  5EG2 A;  5GAM j;  1RL2 A;  2VUB A;  4ZTF A;  4HT9 A;  3PTA A;  2QQB A;  1YCY A;  1YI2 T;  3CC2 T;  2QXF A;  1D3B A;  2DO3 A;  2V8J A;  1VIF A;  1WID A;  4M77 E;  2PVO B;  4TVR A;  3E19 A;  2CS7 A;  4J5Y A;  1W2B S;  1VQN A;  4KUL A;  5LJ3 g;  3H8Z A;  4M77 F;  4OF1 A;  5GAN h;  1VQ5 T;  4C92 E;  5LJ5 h;  3I55 A;  1S72 T;  4MDX A;  1LOJ A;  1N9S A;  1G5V A;  2M0O A;  2RK2 A;  3FRN A;  3JRZ A;  2LTO A;  1M9S A;  4RG2 A;  5FU6 C;  4DA4 A;  4C92 F;  1I8F A;  3JCM g;  2DZC A;  2DTO A;  2L8D A;  3DB3 A;  4QVC A;  3QZ9 B;  4LDU A;  4EMH A;  1AHJ B;  3KUF A;  5CKH A;  1I81 A;  3OS5 A;  2LCC A;  3HHT B;  4M75 A;  2ZPG B;  3MEA A;  4M77 C;  4C0D C;  1KQ1 A;  5FRO A;  1M1K C;  4ZTJ A;  3JB9 D;  3HKS A;  2L89 A;  4N0A A;  2M16 A;  1UEB A;  5GAN 4;  4LD9 K;  4C92 C;  4E7H A;  1QP2 A;  1Y96 A;  3ZFJ A;  2F5T X;  5FU6 B;  4B9W A;  4MZP A;  3G6E T;  2LDM A;  1BKB A;  4MMK A;  3OYE A;  3CME T;  3OW2 S;  1BI2 A;  3RMS A;  3VKI A;  2KQW A;  5CIU A;  3QPH A;  3CBP A;  3JCM V;  5I21 A;  4M77 B;  4C0D B;  5IN1 A;  1X01 A;  3CPW S;  3CPW A;  1LNX A;  1XQH A;  4Z02 A;  1LJO A;  3LGL A;  2QDY B;  5GMK l;  4VUB A;  4F7U F;  3QKJ A;  4IUU A;  1FWZ A;  3OYF A;  1NJI U;  3RKX A;  3UDC A;  2RJF A;  2EYQ A;  4HA8 A;  4QVZ A;  4Y28 E;  3UWN A;  2HAX A;  3VUZ A;  4X9D A;  5J26 A;  1UGR B;  3FC3 A;  3JCM P;  1KQ2 A;  5HK3 A;  2DTH A;  2LQ8 A;  2RJC A;  5FU7 C;  3C4S A;  4IKF A;  3QZ5 B;  3OQ5 A;  2EAY A;  2K3Y A;  5HK0 A;  2GCX A;  3J7A F;  3CCU T;  2E1H A;  3ER0 A;  4M7A G;  3A8O B;  1VQ9 T;  2CZ6 B;  1Y7X A;  2VC8 A;  3A8H B;  3UT1 A;  5D6W A;  1VQP T;  3OYM A;  3P8B B;  3MO8 A;  2RB6 A;  2DAQ A;  2EIF A;  3DLM A;  1OZ3 A;  5GMK j;  3S3N A;  2Y90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...