4LDVA

Crystal structure of the dna binding domain of a. thailana auxin response factor 1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
341
structure length
322
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAETDEVYAQITLLPELDQSEPTSPDAPVQETVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Auxin response factor 1
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 88
structure length 322
sequence length 341
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldvA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldvA02
4LDUA 4LDVA 4LDWA 1NA6A 4I1KA 3HQFA 1YELA 4LDYA 1WIDA 4LDXA
chains in the Genus database with same CATH superfamily
2DBKA 1RADB 3CCQQ 4O5VA 3QZ5B 4EMKB 3EFRA 4HCBA 3JCMh 3PVLA 4C0DB 4KH1B 2E6NA 2QDYB 4BI8B 2HSPA 1YWOA 1NPRA 4NS5A 2O88A 2JVVA 3JCMQ 2BUDA 2K6DA 2QAZA 2CSQA 1MNDA 4C0ZA 1TTHB 2D9TA 3V8JA 5IXBA 1XJWB 3CD6T 4KUDK 1VYVA 1WJRA 1YJWA 4Z02A 1SSFA 4JRQA 1Q7YU 1QMCA 1G5VA 1Q7YC 3RKYA 1N9RA 2GQIA 4CC2A 3OYAA 2PU9B 1UGRB 4M78E 1KD1U 4FYWB 1TH7A 4KUIA 2M0YA 3EGXA 4X9DA 1TWBA 1U5SA 1PCXA 3UF4A 1QW1A 1PRLC 4V2SA 3NGPA 1KD1C 2HKNA 2LT1A 5GAMj 1XTDA 3CCLA 4JZ3A 1Y57A 1VQLT 3JB9I 4C92G 2AIRB 3E1SA 3CPFA 4M78F 1J3TA 4J6WA 4J9DA 2C0TA 2B86A 2X4WA 1YHQQ 2PVDB 2CH4W 1K76A 2LCLA 1KQSP 2FZGB 3PTAA 3CC2Q 2RHZA 4Y91A 2LT4A 2F2VA 4LDYA 1NEGA 3M9QA 3QG1A 3UT1A 3EGDA 4E7LA 1ZSZA 3S6WA 4F7UG 3SFMA 1YITQ 5L23A 3FJPA 1I5LA 1GBQA 4BE1A 3JCMV 3MP8A 3OYKA 1X43A 1X2QA 4ZNXA 1RAHB 1R0BG 2PTKA 4OMMA 2AHJB 2EW3A 5GAMe 2G6FX 4DEXA 3CCUA 4OMQA 5C0MA 2BE7D 1WZOA 3SWNC 1W1FA 3QBYA 1N0EA 4A63B 4RTVA 5KCHA 1AWOA 2DNUA 2PVOB 2NLUA 5J26A 4R55A 4L5GA 4PFZA 1MMGA 2RQTA 3OYEA 1D1BA 2OJ2A 1OX8A 4C5IA 1I4K1 2RJDA 4BDYA 2JS0A 2O9SA 1UGQB 3ZI5A 4M78B 4M75F 1M2VB 2KXDA 4M7AA 1VQPA 3BE3A 2HL3A 2YRVA 2GTOA 3PIOA 4HVUA 2H3JA 1YFNA 5HCKA 2DXBA 2J05A 1UFFA 2YUOA 4OGCA 2EIFA 1D1CA 3JB9G 4N4GA 4MZPA 4CC4B 1EFNA 2O31A 4HCZA 3JB9J 2FPDA 2RHYA 3TVTA 2EAYA 1C0MA 3FRNA 2FO0A 4XAXB 4PFOA 3OW2A 4M77D 2X4YA 2L3SA 4GLKA 1DJ7B 3QHSA 1YJWT 3A98A 2EYZA 2FZKB 5CKHA 1FX7A 4X34A 2QQBA 3L42A 2M51A 1FXXA 2DXTA 1XNIA 5A0GA 1OI1A 2V1RA 5ECAA 2LCSA 1M9SA 1ZA2B 3VS1A 3VUBA 1K8AR 3A8GB 1RAFB 2I2LA 3EGXB 4E7IA 1TG0A 2EQUA 4ZN1A 1FMWA 4JJCA 2QTVA 1UHFA 2A08A 3CCLT 2RF0A 2FG0A 2RM4A 3A8HB 1W2BA 5FU7C 2BZXA 1PSFA 5LJ5h 4M7AF 4E7KA 1QVGA 3HRSA 1UGPB 2J6OA 5KE2A 1AT1B 4OVAA 3JCMe 1QWEA 4CC7A 4PJOA 4A4KA 3CEYA 4VUBA 2XDDA 3JCMJ 5CR2A 2OI3A 3HP9A 2LJ1A 2CP5A 3M0QA 4PK4A 1M30A 3EGDB 5A0DA 3LH5A 2G3RA 3CD6Q 2EYQA 2LMJA 2O01E 3CMEQ 2DM1A 4RCBA 5FRNA 1IREB 3H41A 4GLMA 1GBRA 2EJGA 3L2ZA 5GAOr 2VGMA 4LXCA 3CCJA 1JXMA 2LJ0A 4LE9A 3VRYA 4L6V5 4NOYA 3OMCA 1E6GA 2W0ZA 1IZ6A 1K4US 1OZ2A 5FU7B 2KYMA 3X25B 1Z9QA 3G4ST 1NA6A 3CCUT 1NBEB 1AD5A 4QQDA 5GANd 2YUQA 1VQLQ 3MEWA 4XU0A 1NJIU 2FRYA 2RI3A 3OS1A 1NJIC 2HMAA 5IXFA 2KSSA 3DLMA 3M0UA 1JBMA 4DOVA 2CP3A 2RK2A 1KC8R 2JN0A 2AT1B 4PJOE 2M02A 1M27C 3EGUA 3LYIA 1R0CB 2BTTA 5IHKA 1D0ZA 1VQMA 3AT1B 4J9HA 4A4EA 1LVKA 5FWBA 4RTZA 1H641 4A4GA 4BY6C 2ATCB 2DEUA 4EMGA 1AZEA 3OS5A 2O4XB 3F70A 5HK0A 3ME9A 1VQPT 2MPXC 2VYTA 3AHUA 1QVFA 1KQ2A 3GNFB 2EJFA 2VKNA 5CKDA 1QVPA 2C06A 3VRZA 2WACA 5LJ3d 5I2SA 4DOWA 4M7DC 1QVGS 4J5YA 1VOMA 4HT9A 2JM8A 4FW2A 3JB9D 1RUWA 2GFUA 2HQHA 3WVDB 1Q82U 4BY6B 1X6BA 1JJ2S 4RMOA 2Y90A 1Q95G 1VA7A 4PJOC 1C1AA 2RO0A 1Q82C 1EX4A 1PG5B 5IAYA 3HTRA 3FJ5A 1U06A 3MHXA 5GMKj 1WQWA 5FLXE 2R57A 1T3LA 3CBMA 2F2XA 1UB4A 3D7SB 2DZ9A 1PWTA 5D6YA 2WSCE 5CQXA 4PJNA 2M1HA 3UA7A 3H0HA 4YTLA 5EG2A 2EQJA 3G1JA 1W2BP 4J83A 1GXIE 2RI5A 1G3SA 1PSEA 2K7AA 4F14A 4C0GA 1MUZA 2DD4A 2SEMA 4D8DA 2E5KA 3TSZA 4J6XA 3ULRB 2LNVA 1M90R 4PJOB 1X2KA 2LQKA 3SEMA 3HRTA 1AHJB 2W10A 3OYJA 4JS5A 3QIIA 1ZUYA 1PD0A 3U23A 3UPUA 1WX6A 4RKUE 2EGAA 5GMKe 2LNHB 1YJWQ 3OA6A 2JNGA 1SHFA 1MMAA 4JUVA 9ATCB 3CCJT 2X3WD 4C8QC 4JRIA 3CBPA 3E9FA 4BI4A 4Y28E 3E2UA 5KE3A 2QXFA 2DJZA 4OMPA 2DL8A 4KBMB 4F17A 3QWXX 3CCLQ 1D09B 3M54A 4GBQA 2LVMA 3C94A 3T9NA 3G6EA 4L59A 2C0IA 4MZMA 5KYYA 5GAN4 4QT7A 1VQ6A 1BIAA 2KRSA 1GRIA 4IUQA 2VASA 3LWIA 1G2BA 4QVCA 1ZX6A 2MYSA 3CCVA 2YXYA 4JRKA 2YWWA 4XU3A 4XK8E 2DJQA 4ZGDB 2EYYA 3CMAT 3CXCP 2RB6A 5C6SA 5LJ5g 1VQMT 3TEEA 2L89A 1VQ8A 1QWFA 3V7CA 2CZ0B 4CRIA 3L2WA 3OY9A 1SHGA 2A3LA 1QP2A 3QYHB 1N8RU 2K3YA 3VS6A 2KK4A 4FIBA 2COWA 4M7DD 2WSEE 4C0DC 1H3ZA 1HSQA 4JJBA 2JW4A 4IUPA 4WTOB 3CCUQ 4J7IA 3CCSA 1QVFP 5GANh 1K73R 4LUEA 5KYXA 2ESWA 1NEBA 4RTWA 3M0SA 5AYFA 4PLLA 3EHQA 2DL7A 1NLPC 1U1TA 1MMDA 1KHCA 4XTUA 4AFQC 1PNJA 2JXBA 3OBYA 1HXDA 3X26B 1GL5A 1OOTA 4AG2C 2JZ2A 2ENMA 2KAFA 1PKSA 2L3RA 2RQVA 1ZBJA 3OSSC 2KBTA 3J81E 4ZTJA 3JCMX 1K0SA 1LJOA 5A0LA 4C92A 3OYGA 1Q86U 4PJMA 1D3BA 5FU6C 4M77G 3MEVA 1Q86C 5FROA 4K11A 1U8RA 3EG0A 4XU2A 3OS2A 2ED0A 2AK5A 4OF1A 1VQPQ 2QYZA 3CC7T 2JTMA 2ABLA 2JJ9A 5IHIA 2XICA 4FU6A 2QDLA 2IPOB 4EMHA 3E19A 2EQMA 2VUBA 2GF7A 2H3EB 4F7UA 3CPWA 3QDFA 4FCYA 4XTXA 4IIOA 1VQNT 1QP3A 3SB2A 1SEMA 3TQ7P 3OBWA 3LGLA 5GAN3 3HFNA 2PUOB 1S72A 2AKLA 5LJ3h 2KDSA 1I0CA 4C8QD 3UATA 2YUNA 4Z89A 1M8MA 5FU6B 4OMLA 1YCSB 4E2FB 5CCAA 2FL7A 4EPCA 2RHIA 5IHNA 2DA9A 3OYMA 4C92E 2NWMA 1M2OA 5CKEA 4ORZA 2JOYA 3OQ5A 1G3YA 2QG9B 1VIFA 2NUTA 3CC4A 5IT9E 4DEYA 4FT4A 3THKA 2QQAA 4LN2A 2D1XA 1TUDA 3VS2A 2ZZDA 4C92F 3V7SA 1PD1A 4KRTA 1PC0A 1Y71A 3RDVA 4M75A 4F7UE 4BE0A 3G6ET 4DBRA 4O6JA 5KYYB 3M57A 5KH6A 1VQ6T 3M56A 1Q7YR 3A5ZB 3M59A 4JJNK 4F7UF 1IRXA 1YI2A 4PFPA 3OYCA 3CCVT 7AT1B 1ARKA 3QDRB 2RQWA 3G4SA 4OMFB 4PNOA 2F1LA 1RAGB 4M78C 2VB6A 3M0RA 2E3HA 3OYHA 4E7ZA 1LCKA 1VQ8T 5GAMg 2E6ZA 1WNLA 3CCJQ 1TXQA 2D8HA 4Q5WA 1RI0A 1RAIB 2LP5A 2EWNA 2RPNA 4QW2A 5CQYA 1YJNA 1B7TA 5GAOm 3EG1A 2MI6A 4IIMA 3HQFA 4ESRA 1N27A 3CCST 4IUTA 1KQ1A 4ZGEB 5KYXB 4M75E 1VQ9A 3UWNA 3CPWS 3GIBA 4LDXA 1SRMA 4JRPA 2DIGA 1WLPB 2YRDA 1VQOA 1KIKA 3RIRA 3GF5A 1ZA1B 1PKTA 5GANj 2GTJA 2NUPA 2RQRA 3H9NA 3PMTA 5GAOl 4BDZA 3CCRA 5GAOp 2QGGA 1RL2A 5KYNA 3FEOA 2DERA 1G3TA 3LX7A 1VQMQ 5DLQE 1WIDA 4C92B 4NL3A 2LX9A 3KBGA 1BU1A 3HL8A 2K3XA 1K8AU 5CKBA 1M1GA 3GLXA 1K8AC 1OV3A 4HCKA 3CBOA 5GMKh 2DAQA 2XDBA 3H6ZA 3JB9F 4IUVA 1R77A 2Y4XA 4OB1B 3QSUA 4F7UB 3LLRA 2A28A 3X24B 3JAME 4XQ3A 5GANe 1R8OB 2KRMA 3UDCA 2YLCA 4RTYA 1KHIA 3V8LA 1ZSZC 1TUGB 2ROLA 1VUBA 4M75C 1S72T 2CGHA 1W6XA 1UJ0A 1N0GA 2KROA 5I22A 1K9MU 5GANg 1W4SA 2CYZB 2CZ7B 4PLIA 3ZL7C 3GP8A 4M7AE 2HZYA 2XD0A 3BW1A 5GAN2 1K9MC 1UGVA 5LJ3j 2E70A 2HD0A 5LJ5f 2LJ3A 1ZUUA 3TREA 4XTZA 2MCNA 1AWXA 3CC4T 2NUTB 4EDUA 3OS0A 2DYBA 4EIKA 2DFUA 2X35A 1JJ2A 2ZPGB 1OU9A 2JS2A 1B07A 1OPKA 1X01A 3OMGA 4IKFA 1WJQA 4FYXB 4BB7A 1AWWA 1S1NA 4J6YA 4M78D 1ZSZB 2FPFA 4M75B 3JCMg 1BIBA 5CK9A 3PVQA 4BI3A 5GAN6 2HL5C 2I0NA 2B8AA 1ACMB 2XK0A 2HBWA 3JB9H 4Z88A 1KC8U 2FRWA 6AT1B 2OX7A 1KC8C 3BFMA 2KGTA 4I1KA 3SHWA 1YI2T 2VVKA 5LJ3e 2FEIA 2XMFA 3EG2A 3QJ6A 2CT4A 2QQ9A 2KXCA 5GAN8 4TVRA 4OMOA 1WHGA 5KYWA 2DBMA 2K5LA 4M7AC 3JCMb 1VQ7A 1YJ9A 2LQWA 4DBQA 3TCJA 1MV0B 3PFSA 2MWPA 2DTHA 4HXJA 1SG5A 4FYVB 4JLIA 2EYWA 2RN8A 3PE0A 1WFWA 3LH0A 1YJNT 2DPPB 3I56A 2A0FB 1OU8A 3L2QA 2JMAA 1RAEB 3CMAA 3GPLA 4M7DG 2HCKA 3G6EQ 1OZ3A 1WA7A 4HVWA 4E6RA 1VQ9T 4RG8A 1VQ6Q 2HKQB 4OB0B 1VQOT 3VKIA 3REBB 2VC8A 5D6WA 4PJOG 2NUPB 2ZPFB 3EG3A 4DBHA 2E65A 5CKFA 3CCVQ 4J9GA 5IN1A 4M7AB 2CUBA 5DLOA 3CCRT 1M3CA 5LL6S 1FWZA 2VXEA 2KY9A 1V29B 3QUIA 3OB9A 5I11A 5GMKm 3QKJA 4A4FA 1VQ8Q 2KQWA 2ZAEA 2CSIA 1NJIR 1OQKA 1AOJA 1NYFA 1O9SA 1SKUB 4A4HA 1B3QA 3WXMB 3L1AA 4X1VA 1Y07A 1BCOA 4HKEA 1D1AA 2KMTA 2RHXA 3M4GA 3MEUA 2RMOA 4E7HA 3OW2P 1WDXA 3CCSQ 5GMKl 2DRKA 3EG9A 1N0FA 1EZZB 2YDLA 5D7UA 2DX1A 3A8LB 2RH2A 4MMLA 3V7RA 2FYKA 2O9VA 1N6AA 1M90U 2E41A 1WXUA 3EH2A 4LDWA 5J3BA 2K2MA 2L5QA 1M90C 2SRCA 2OAWA 3CC7A 3QJYA 2DTIA 2LX7A 3MKDA 2K9GA 1M1KR 3A1PA 3SDZA 3CQTA 3I9QA 1FMKA 5AT1B 3S3MA 1YIJA 4C8QG 3QWYA 2A36A 4QVZA 2ROTA 2F5TX 2X4XA 1VQNA 2EQIA 3VS0A 4PJJA 2D6FA 4MDWA 5GAMf 1QVGP 1Y0MA 3X28B 2P84A 1SPKA 4OB3B 1M8VA 1K9AA 3V8KA 4B9XA 4E7JA 1JJ2P 1WHHA 1YWPA 1UE9A 1PHTA 4E47A 4P5NA 2E1HA 2ECZA 5CVIA 3G71A 1MHNA 2HNIA 4M7AD 4KGZB 2LRQA 4KULA 3J7AF 5EC7A 1IXDA 4AMCA 1S72Q 2DXUA 2HSEB 2QA4A 3HRUA 4R56A 1VQ5A 1WHJA 2KI7A 4DA4A 5HKCA 2DLPA 1TS9A 4D8KA 1BKBA 4ME7A 2V8KA 2LTOA 3JSCA 1T0HA 1MMNA 3CXCS 4X9CA 2KNBB 5A2QE 4Z8AA 3MP1A 1ZBXA 1VQ7T 1YJ9T 2MF2A 5FW9A 3CC4Q 3VV0A 4J9BA 2L2PA 3HKSA 1RAAB 4B9WA 3O8VA 1UECA 4KT0E 1T3SA 4C5HA 1K73U 1H92A 3I56T 3A8OB 3BDUA 2J7IA 3BDLA 2X3XD 2CKKA 1K73C 3JCMc 4JDSA 4M4ZA 1HK9A 1JU5C 1D0XA 2CREA 1I5OB 2XI9A 5D6XA 1KSWA 2DF6A 1Q81U 4FL6A 1D0YA 2LCCA 3VUZA 4M77A 2EKOA 2QEXA 3M53A 4J7FA 1Q81C 4RTUA 1NPPA 2ZPBB 1NG2A 1OYXA 3R6OA 1YI2Q 5J39A 1WHLA 2PQWA 5GANf 2GNCA 1CKBA 1SSHA 1QLYA 3G4SQ 2OTJA 1VQ4A 3NHNA 2HAXA 4PJOD 1MGQA 2DKGA 1UUEA 3VS3A 4F16A 1YELA 4HT8A 4C5EA 4JLGA 1MNEA 1YJNQ 5L8RE 3C12A 2JMCA 1NM7A 3WVEB 2XU8A 3NTKA 4Y92A 2IIMA 1WHKA 2YLBA 3EG9B 1QCFA 1ZQ1A 3META 1I81A 3JCMf 2CP7A 3RBBB 1VQ9Q 1WPYA 2DO3A 2CP0A 2MWOA 3ZBDA 4M77E 1VQOQ 2PNIA 3I5RA 3OYFA 4FT2A 4HCCA 3SWNA 2MMPA 3P8DA 1IGQA 2P0KA 2O2OA 3EFSA 1N8RR 1NYGA 4RTTA 2YHTA 4RUGA 3OYIA 3CCRQ 4DBFA 1KG1A 2GGRA 1YP5A 2DZCA 3G7ZA 1YIJT 2K3BA 4M77F 2BZYA 1N5ZA 2COZA 2MOXA 1WXTA 3C95A 1F1BB 3QXEB 2OTLA 5LJ5d 2MAMA 5LJ3f 5GJWB 1U1SA 2DL5A 4ZTFA 2EGCA 4ELYC 1KQSS 2JT4A 2CS7A 2HDAA 1P92A 2XG8D 1GCQA 2GQVA 1JEGA 1G8XA 4FW1A 2PVGB 3CMET 3M58A 3RERA 3G71T 2KT8A 2EFIA 4ANJA 3VS4A 2X9HA 2ZCFB 2DRMA 1Q86R 3DB3A 3ER0A 4FYYB 4M78G 1M5Q1 1M3BA 1ABOA 3EHRA 2QA4T 5M9OA 1BYMA 4M77C 3HPWA 2NYSA 1VYTA 1VQ5T 2R5AA 4NL2A 1JB0E 5I21A 4BUGA 3H8ZA 3NPFA 1BB9A 1BCMA 1GCPA 1Z9ZA 2RA2A 2COYA 2P0QA 4MMKA 1OEBA 1NE8A 1QKXA 3QZ9B 4QQGA 4ZN3A 2P4RA 4D6WA 4N4IA 1BI1A 3CCMA 5GAOn 4KH0B 2L3QA 3P8HA 2QK0A 3H0FA 1ZHIA 2A37A 5HK3A 4J8OA 1KD1R 2J6KA 3MP6A 4DQ2A 1VYUA 4XTYA 2DE0X 4A53A 1M1FA 4C0FA 1IB8A 8AT1B 4M77B 2QEXT 1HYOA 1PRMC 5FRMA 1ZSGA 1VQKA 1UG1A 3I55A 5CAIA 4N4HA 4C92C 1IHWA 1OPLA 3L2RA 2CZ1B 4J9CA 2L8DA 2DMOA 1UHCA 2K57A 2OTJT 2V1QA 1BBZA 1VQ4T 1UTIA 4F04B 3CCEA 3MCAB 4LD9K 2KVQG 1VQ7Q 1YJ9Q 4LDVA 2J6FA 2K4YA 1AVZC 3KFVA 1JRIA 3FLGA 1M3AA 1TOVA 2L3PA 4LD6A 1JO8A 2Z0WA 3UA6A 3I56Q 2V26A 4A54A 1LOJA 1A0NB 2DYIA 4M75G 2FZCB 2KR3A 3VS7A 3Q1JA 3BY7A 3CMAQ 3CCQA 2LC4A 1BI3A 2QTXA 3S3NA 3RUXA 1LPLA 3PT9A 5KCOA 2LDMA 2HBPA 2O4XA 1GCQC 4IUUA 1D3BB 2K5IA 2NUZA 3INZA 2M9UA 4II1A 1X75C 5IH2A 4ATOA 3VU3C 3SWNB 2VWFA 2K5FA 4J9IA 1C6VX 2FVUA 3QO3A 4CI0C 1I1JA 3LWHA 3CPWP 1JXOA 2GFAA 3RMSA 3GBQA 1WI7A 4FSXA 2RD1A 1WYXA 1YN8A 2OTLT 2E4HA 2HQXA 1GFCA 1SF9A 4ZGJB 2E12A 4OMNA 2QGFB 5GAMd 2A7YA 2YT6A 2GCXA 1FMVA 2DD5A 2M16A 1ZUKA 1TU0B 1BI2A 4KGVB 2JUFA 1WHMA 2LZ6B 1TSFA 2CDTA 2BIVA 1G83A 2E10A 1YHQA 3X20B 2Y4YA 3OYDA 3EFOA 4B6MA 1CSKA 3CC2A 4RG2A 4M7AG 3KXTA 3EH1A 3PGGA 3NMZC 5DM7R 3CC7Q 1K0XA 1K1ZA 2QASA 3FB9A 1YIJQ 4AFZC 3L2VA 1YITA 4N0AA 4E7SA 4M7DA 1VQNQ 1ZLMA 3FC3A 2HQEA 2L0AA 1HJDA 4MDXA 2ED1A 2RQUA 3CCMT 3GNGA 1WQ7A 2XKOC 5I2MA 3S3OA 4C92D 1MV3A 2QQRA 1UGSB 2EPDA 3M55A 2DL4A 3URGA 1I8FA 4HA8A 1X6GA 1M4ZA 1K9MR 2JM9A 1WGSA 4HVVA 2ZPIB 1SRLA 2KE9A 3M0PA 1IGUA 3OYNA 1H3HA 3G71Q 1GFDA 1O75A 2F2WA 2PUKB 1UJYA 3J80E 1WXBA 4XU1A 4WCIA 5LJ3g 2JTFA 4KGXB 1OULA 2QA4Q 1VQKT 2D8JA 1RLPC 3I55T 3E9GA 1RABB 2IVWA 1VQ5Q 4LDUA 2WSFE 1EIFA 1ABQA 1V76A 2RJFA 1B34A 2MK5A 1QCOA 1V1CA 3CCET 4M7DE 1AZGB 3RR6A 3VYGA 2DETA 3EAEA 1BI0A 4UC4A 1AWJA 4JJDA 3TSWA 3N5BB 2RHUA 1X6OA 3SD4A 2P4TA 2DK3A 4M7DF 2CUDA 1OX9A 2AZSA 2RI2A 3OW2S 2X51A 4C8QA 3CXCA 1XOVA 2DXCA 3NTIA 3CCQT 5KYUA 3RESA 4PJOF 2KT1A 1CKAA 3RMQA 3JCMd 4JS4A 2QEXQ 5GAOq 4WF2A 1E6HA 2CH4A 2VV5A 4M75D 3RNJA 3JCMP 1M1KU 1KK7A 4C5GA 1Y7XA 2AZVA 4PKCC 2P0PA 3MPUB 4J9FA 1M1KC 3OYBA 3GOXA 2OTJQ 4FSSA 2QQSA 2RJEA 1VQ4Q 2VXFA 2LQNA 4IURA 2E5QA 2KEAA 4ELZC 4JZ4A 1VIEA 3A8MB 1W2BS 3OYYA 3ZEHA 2PZ1A 1Y96A 2BZ8A 4N0AC 3C0CA 3O5ZA 2X4JA 1WJSA 3DLLA 3LGFA 3FDRA 1E7OA 2ZGWA 4OB2B 2YUPA 4QQ6A 2BKDN 3JV3A 4AT1B 3NFCA 1NLOC 3RKXA 3TU4K 1FYNA 4EMKA 4OP0A 2EKHA 1RACB 2J06A 3I5SA 5CO7A 4C8QE 3KUFA 2IG0A 2V8JA 1X69A 4AG1C 3PNWC 2E64A 1I07A 2EBPA 2K79A 1YHQT 2EVRA 2FPEA 4LUDA 3EFOB 2M0OA 3CC2T 3MEAA 4C8QF 2DTOA 3IQLA 1N9SA 4AFSC 2GBQA 1QCNA 3MJXA 2ZPHB 3R6NA 4J9EA 2XHCA 2YRCA 1YITT 3CD6A 1UEBA 2RJCA 1LNXA 5DY9A 4M7DB 1H8KA 4RCCA 3CMEA 1Q82R 3ZFJA 1IHVA 2OTLQ 4BD3A 3PIPA 5GAMh 2AKKA 5HY6A 2KYBA 2OAUA 3OYLA 4R0KA 2F69A 1RI9A 2BE9B 2D0NA 1T0JA 1KJWA 4MZTA 5LJ5j 3ASKA 4XTWA 4QKUA 1WIEA 1YCYA 2DILA 2KRNA 3JRZA 1VQLA 2FB7A 2C0OA 5GJVB 2K2VA 4JPBW 5KYWB 2DEQA 2VGNA 2HEQA 3QPHA 3JCMW 1KQSA 2QI2A 4FM4B 5FWCA 2XIDA 1W70A 1HD3A 3M0TA 4AFUC 2RNAA 1U3OA 1B34B 1QQJA 1TUCA 2DL3A 1IO6A 1QVFS 2DVEA 3HFOA 2CZ6B 1XQHA 3M5AA 3FIFA 1KFZA 3I35A 1G3WA 8ATCB 1QKWA 5LJ5e 3CCMQ 2R5MA 2D0QB 3HSBA 2RK1A 3REAB 2C1LA 3RKWA 1X27A 1AEYA 1YBYA 3QYGB 3VJPA 2FHDA 4C8QB 3HHTB 5KYUB 2EYXA 5GAN5 2DIQA 3MO8A 1JQQA 2H8HA 4CC3A 4EMKC 4RTXA 4BACA 1VQKQ 3M4YA 1N8RC 3I55Q 3OSVA 3P8BB 4PL6A 2F5KA 2E3IA 1RLQC 2EJ9A 2ZPEB 3NTHA 2MIOA 2CP2A 2LQ8A 2DVJA 2EQKA 1UDLA 3LW5E 2JTEA 5GMKi 3CCEQ 1BK2A 2CT3A 4OGEA 3L2UA 4GY5A 3PMIA 1Q81R 2YSQA 4PJLA 3DB4A 2CP6A 1PM3A 1Y96B 4M78A 4XTVA 1M2VA 3VS5A 2XDPA 4QVDA 3C4SA 2EGEA 5GAN7 2V8IA 3VYHB 1NZ9A 2R58A 3H0IA 5CIUA 4LNPA 4BE2A 1YNZA 3DKMA
chains in the Genus database with same CATH topology
4LDVA 2DD4A 3QJ6A 2K4YA 1JRIA 2QQ9A 3FLGA 4O5VA 5GAN8 3QZ5B 4EMKB 3EFRA 4J6XA 2LNVA 4TVRA 4PJOB 4HCBA 3JCMh 2K5LA 4C0DB 4M7AC 4LD6A 2LQKA 3JCMb 1VQ7A 4A54A 3HRTA 1YJ9A 1LOJA 1AHJB 2E6NA 4M75G 2QDYB 3TCJA 3OYJA 3PFSA 2MWPA 4BI8B 4JS5A 3QIIA 2DTHA 3BY7A 3Q1JA 3CCQA 1NPRA 3UPUA 2LC4A 4NS5A 1BI3A 5GMKe 4RKUE 2QTXA 3S3NA 4JLIA 2JVVA 3RUXA 2JNGA 3JCMQ 3OA6A 2BUDA 3LH0A 1YJNT 2DPPB 3PT9A 3I56A 5KCOA 2LDMA 2HBPA 4JUVA 2O4XA 4IUUA 4C0ZA 1D3BB 2D9TA 3L2QA 2K5IA 3V8JA 3INZA 2M9UA 3CCJT 4II1A 1X75C 3CMAA 4ATOA 3GPLA 4M7DG 4C8QC 3CD6T 3VU3C 4KUDK 1WJRA 3CBPA 4JRIA 3SWNB 1YJWA 3E9FA 1OZ3A 2K5FA 4Z02A 4Y28E 4BI4A 1SSFA 1VQ9T 2FVUA 4JRQA 1Q7YU 5KE3A 2QXFA 2DJZA 4RG8A 3QO3A 4KBMB 4OB0B 4CI0C 1VQOT 3VKIA 1G5VA 1Q7YC 2VC8A 5D6WA 4PJOG 1N9RA 3RKYA 3LWHA 3M54A 2GFAA 3OYAA 3RMSA 2LVMA 2PU9B 1UGRB 4M78E 3C94A 3T9NA 3G6EA 4FSXA 1TH7A 2RD1A 4KUIA 4L59A 2ZPFB 1KD1U 4X9DA 2E65A 4MZMA 5CKFA 5GAN4 2OTLT 5IN1A 1QW1A 4V2SA 2HQXA 4M7AB 1KD1C 4ZGJB 1VQ6A 2E12A 5DLOA 3CCRT 1BIAA 2LT1A 5GAMd 2A7YA 5GAMj 1XTDA 1VQLT 5LL6S 3CCLA 2GCXA 1FWZA 4IUQA 2VXEA 2KY9A 1V29B 2DD5A 2M16A 3OB9A 3QUIA 3JB9I 4C92G 1BI2A 3LWIA 2JUFA 5GMKm 3QKJA 4A4FA 4M78F 2KQWA 3CPFA 3E1SA 4QVCA 4J6WA 3CCVA 2X4WA 1O9SA 4JRKA 2PVDB 2BIVA 4XU3A 4XK8E 4ZGDB 3CMAT 4A4HA 3WXMB 2LCLA 3L1AA 2RB6A 5C6SA 3PTAA 1Y07A 5LJ5g 2RHZA 4Y91A 1VQMT 4HKEA 3TEEA 2L89A 1VQ8A 2E10A 2LT4A 2KMTA 2RHXA 4LDYA 3M4GA 3M9QA 3V7CA 2CZ0B 3QG1A 3MEUA 4CRIA 3UT1A 3OY9A 3L2WA 4E7HA 4E7LA 1YHQA 3X20B 2A3LA 1QP2A 2Y4YA 3QYHB 3S6WA 4F7UG 1N8RU 3SFMA 3OYDA 2K3YA 5GMKl 2KK4A 3CC2A 4FIBA 4M7DD 3A8LB 4RG2A 4M7AG 2WSEE 4C0DC 3KXTA 3PGGA 2RH2A 3FJPA 4MMLA 5DM7R 1H3ZA 3V7RA 2FYKA 1I5LA 4IUPA 4BE1A 1N6AA 3FB9A 4J7IA 1M90U 2E41A 3CCSA 3L2VA 3JCMV 5GANh 1YITA 4LDWA 3MP8A 4N0AA 3OYKA 5J3BA 4M7DA 1M90C 2L5QA 2AHJB 5GAMe 3CC7A 3QJYA 3FC3A 2DTIA 2HQEA 5AYFA 3CCUA 3SDZA 4PLLA 1YIJA 3S3MA 5C0MA 4C8QG 1U1TA 4MDXA 4QVZA 2F5TX 2X4XA 3SWNC 3CCMT 4XTUA 1KHCA 1WQ7A 3GNGA 2XKOC 5I2MA 3S3OA 3QBYA 1VQNA 3OBYA 4C92D 1HXDA 2QQRA 3X26B 1UGSB 3M55A 2D6FA 5KCHA 4MDWA 3URGA 5GAMf 2JZ2A 1I8FA 2NLUA 2KAFA 2PVOB 2L3RA 4HA8A 1M4ZA 3X28B 1WGSA 2ZPIB 3OSSC 3J81E 4OB3B 4ZTJA 1M8VA 3JCMX 3OYNA 1LJOA 5A0LA 3V8KA 4C92A 5J26A 3OYGA 4R55A 4L5GA 1Q86U 1O75A 4B9XA 4E7JA 2PUKB 1D3BA 5FU6C 4M77G 3OYEA 3J80E 4XU1A 3MEVA 1Q86C 5FROA 5LJ3g 4E47A 1U8RA 4P5NA 4C5IA 2JTFA 1I4K1 4XU2A 2E1HA 3OS2A 1VQKT 2RJDA 5CVIA 3I55T 3G71A 1MHNA 3E9GA 4OF1A 2HNIA 3CC7T 4BDYA 2JTMA 2IVWA 4M7AD 2LRQA 2XICA 4FU6A 4KULA 4LDUA 2WSFE 3J7AF 1EIFA 4EMHA 3E19A 2EQMA 2VUBA 2GF7A 4F7UA 2DXUA 1B34A 2RJFA 3CPWA 4XTXA 1UGQB 2QA4A 4M78B 4M75F 1VQNT 1QP3A 4M7AA 3HRUA 3SB2A 1VQPA 3CCET 4M7DE 4R56A 3VYGA 3EAEA 1BI0A 3OBWA 4UC4A 2YRVA 1VQ5A 3LGLA 5GAN3 3HFNA 5HKCA 4DA4A 2PUOB 3PIOA 1S72A 1BKBA 2H3JA 2KDSA 4ME7A 5LJ3h 3N5BB 2DXBA 2RHUA 4C8QD 2V8KA 1X6OA 4OGCA 2LTOA 3JSCA 3SD4A 2EIFA 3CXCS 2P4TA 3JB9G 4X9CA 2DK3A 4N4GA 4MZPA 4M7DF 5A2QE 3MP1A 5FU6B 1ZBXA 1VQ7T 1YJ9T 5CCAA 2MF2A 2RI2A 4HCZA 3VV0A 3JB9J 3OW2S 2FL7A 4C8QA 3CXCA 4EPCA 1XOVA 2DXCA 3HKSA 3NTIA 3CCQT 2RHYA 4B9WA 2RHIA 3O8VA 3RESA 2EAYA 4KT0E 3FRNA 4PJOF 4C5HA 3OYMA 1K73U 3RMQA 3JCMd 4JS4A 4C92E 4XAXB 3I56T 5CKEA 3A8OB 2JOYA 2X4YA 3BDUA 3OQ5A 4M77D 1G3YA 5GAOq 3BDLA 4GLKA 4WF2A 1VIFA 2CKKA 1DJ7B 3JCMc 4JDSA 1K73C 3CC4A 3QHSA 2VV5A 5IT9E 1HK9A 4M75D 3JCMP 1M1KU 1YJWT 2XI9A 5D6XA 4FT4A 4C5GA 1Y7XA 5CKHA 4FL6A 1Q81U 1FX7A 2QQAA 4PKCC 2P0PA 2QQBA 3L42A 4X34A 2LCCA 3VUZA 4M77A 1FXXA 1M1KC 2DXTA 2EKOA 2ZZDA 3OYBA 3M53A 4C92F 4J7FA 2QEXA 3V7SA 1Q81C 1Y71A 1XNIA 3GOXA 1NPPA 2ZPBB 5A0GA 2QQSA 2RJEA 1OYXA 1OI1A 4M75A 1M9SA 2VXFA 4F7UE 4BE0A 4IURA 3R6OA 3G6ET 2E5QA 3VUBA 3OW2A 5J39A 3A8GB 2PQWA 2I2LA 4ELZC 1VIEA 3A8MB 4O6JA 1W2BS 3OYYA 4E7IA 3M57A 3ZEHA 2EQUA 4ZN1A 5KH6A 5GANf 1VQ6T 1Y96A 2OTJA 3M56A 4N0AC 1VQ4A 3CCLT 2HAXA 2X4JA 1WJSA 2RM4A 3A5ZB 3A8HB 3M59A 1W2BA 3DLLA 4JJNK 4F7UF 4PJOD 1MGQA 3LGFA 2DKGA 3FDRA 5FU7C 1YI2A 2ZGWA 1PSFA 4OB2B 5LJ5h 3OYCA 3CCVT 4QQ6A 1YELA 2BKDN 4M7AF 4E7KA 1QVGA 3HRSA 3QDRB 1UGPB 3G4SA 3NFCA 4HT8A 3RKXA 4C5EA 5KE2A 3TU4K 4OMFB 4PNOA 4EMKA 4OP0A 4OVAA 4JLGA 3JCMe 4M78C 4PJOA 4A4KA 5CO7A 4C8QE 3KUFA 3OYHA 2IG0A 2V8JA 3CEYA 3C12A 3PNWC 2E64A 4VUBA 5L8RE 2XDDA 5GAMg 1VQ8T 2E6ZA 3JCMJ 5CR2A 3HP9A 1YHQT 1WNLA 5A0DA 3WVEB 2G3RA 4Q5WA 1RI0A 2XU8A 3NTKA 2EYQA 2EWNA 2M0OA 2YLBA 4QW2A 2O01E 1ZQ1A 3CC2T 3META 1I81A 3JCMf 3MEAA 4RCBA 5CQYA 4C8QF 1YJNA 1IREB 5FRNA 1WPYA 2DO3A 2DTOA 2EJGA 1N9SA 3L2ZA 2MWOA 5GAOr 2VGMA 3ZBDA 4M77E 5GAOm 2MI6A 2ZPHB 3OYFA 4FT2A 3CCJA 1N27A 3CCST 3HQFA 2XHCA 1YITT 4IUTA 4HCCA 3SWNA 2MMPA 3P8DA 1UEBA 3CD6A 2P0KA 2RJCA 1KQ1A 4L6V5 1LNXA 3EFSA 4ZGEB 4M75E 4NOYA 5DY9A 4RCCA 3OMCA 3CMEA 4M7DB 3ZFJA 1VQ9A 3UWNA 3CPWS 2YHTA 1IZ6A 4BD3A 3GIBA 4LDXA 1OZ2A 5FU7B 3X25B 3OYIA 3PIPA 4JRPA 2DIGA 5GAMh 5HY6A 3G4ST 1KG1A 1NA6A 1VQOA 3CCUT 2DZCA 3G7ZA 1YIJT 4M77F 3RIRA 3GF5A 4QQDA 5GANd 2OAUA 3OYLA 5GANj 2F69A 3MEWA 4XU0A 1NJIU 3OS1A 2RI3A 3C95A 3QXEB 2OTLA 4BDZA 3PMTA 2MAMA 5LJ5d 5GAOl 4MZTA 5LJ5j 3ASKA 4XTWA 1NJIC 3CCRA 5LJ3f 5GAOp 1RL2A 1U1SA 2KSSA 3DLMA 3FEOA 1JBMA 1G3TA 1YCYA 3JRZA 1VQLA 3LX7A 2FB7A 4DOVA 4ZTFA 5DLQE 2RK2A 1WIDA 2JN0A 4C92B 4ELYC 1KQSS 4PJOE 2K2VA 4NL3A 2LX9A 3KBGA 2CS7A 3LYIA 1P92A 2DEQA 2XG8D 3HL8A 2GQVA 2K3XA 1K8AU 2VGNA 5CKBA 1M1GA 3QPHA 2PVGB 3JCMW 1VQMA 3CMET 3M58A 1KQSA 2QI2A 3RERA 3GLXA 4FM4B 3G71T 1K8AC 4A4EA 2EFIA 2XIDA 1H641 3CBOA 4A4GA 4BY6C 2ZCFB 5GMKh 2DAQA 2XDBA 3H6ZA 3DB3A 4EMGA 3ER0A 3JB9F 4M78G 3OS5A 2Y4XA 4IUVA 2O4XB 4OB1B 3QSUA 1M5Q1 4F7UB 3LLRA 1B34B 3F70A 2QA4T 3X24B 3JAME 5HK0A 1QVFS 3ME9A 5M9OA 2DVEA 1VQPT 1BYMA 4XQ3A 3HFOA 4M77C 3HPWA 2CZ6B 1XQHA 5GANe 1VQ5T 1R8OB 3M5AA 2R5AA 3FIFA 4NL2A 1JB0E 2YLCA 3UDCA 3H8ZA 4BUGA 1KHIA 3V8LA 5I21A 1G3WA 1VUBA 2VYTA 4M75C 1S72T 1QVFA 3AHUA 2CGHA 5LJ5e 1KQ2A 3GNFB 2R5MA 2EJFA 5CKDA 2RA2A 1QVPA 2P0QA 2D0QB 4MMKA 2C06A 3HSBA 2RK1A 1NE8A 3QZ9B 1K9MU 5GANg 1W4SA 2CYZB 4QQGA 4D6WA 4N4IA 4ZN3A 2CZ7B 4PLIA 3GP8A 3RKWA 4M7AE 2WACA 2XD0A 3BW1A 5GAN2 1K9MC 1YBYA 3QYGB 1BI1A 5LJ3d 3VJPA 5I2SA 3CCMA 2FHDA 5LJ3j 2E70A 4C8QB 2HD0A 4DOWA 5GAOn 4M7DC 1QVGS 3P8HA 3HHTB 4J5YA 1ZHIA 5LJ5f 5HK3A 5GAN5 2DIQA 4HT9A 3TREA 3MO8A 4J8OA 4XTZA 3JB9D 2GFUA 3WVDB 1Q82U 4BY6B 1JJ2S 4EMKC 4RMOA 3CC4T 3MP6A 4BACA 4DQ2A 2Y90A 4XTYA 3M4YA 1N8RC 4PJOC 4EDUA 2RO0A 3OSVA 1Q82C 4A53A 3OS0A 5IAYA 3P8BB 1M1FA 2X35A 4PL6A 2F5KA 3MHXA 4C0FA 1JJ2A 2ZPGB 5GMKj 1WQWA 2EJ9A 2ZPEB 3NTHA 4M77B 5FLXE 2QEXT 2R57A 1X01A 2LQ8A 3CBMA 3OMGA 4IKFA 2EQKA 1WJQA 4BB7A 5FRMA 1UB4A 1VQKA 3LW5E 2DZ9A 4J6YA 4M78D 4M75B 3I55A 3JCMg 1BIBA 5CK9A 5CAIA 5GMKi 4N4HA 5D6YA 4BI3A 4C92C 5GAN6 2WSCE 4OGEA 5CQXA 2M1HA 3L2UA 2B8AA 4GY5A 3L2RA 2XK0A 4YTLA 2CZ1B 3PMIA 3JB9H 5EG2A 2L8DA 3DB4A 1KC8U 2K57A 2OTJT 1Y96B 4XTVA 4M78A 2EQJA 1VQ4T 2XDPA 4J83A 4QVDA 3C4SA 1KC8C 3BFMA 5GAN7 3CCEA 1GXIE 2V8IA 3MCAB 3VYHB 1NZ9A 2R58A 2RI5A 4I1KA 1G3SA 1PSEA 1YI2T 5CIUA 4BE2A 4LD9K 2KVQG 5LJ3e 3DKMA 4C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDU A;  4LDV A;  4LDW A;  1NA6 A;  4I1K A;  3HQF A;  1YEL A;  4LDY A;  1WID A;  4LDX A; 
#chains in the Genus database with same CATH topology
 2DBK A;  1RAD B;  3CCQ Q;  4O5V A;  3QZ5 B;  4EMK B;  3EFR A;  4HCB A;  3JCM h;  3PVL A;  4C0D B;  4KH1 B;  2E6N A;  2QDY B;  4BI8 B;  2HSP A;  1YWO A;  1NPR A;  4NS5 A;  2O88 A;  2JVV A;  3JCM Q;  2BUD A;  2K6D A;  2QAZ A;  2CSQ A;  1MND A;  4C0Z A;  1TTH B;  2D9T A;  3V8J A;  5IXB A;  1XJW B;  3CD6 T;  4KUD K;  1VYV A;  1WJR A;  1YJW A;  4Z02 A;  1SSF A;  4JRQ A;  1Q7Y U;  1QMC A;  1G5V A;  1Q7Y C;  3RKY A;  1N9R A;  2GQI A;  4CC2 A;  3OYA A;  2PU9 B;  1UGR B;  4M78 E;  1KD1 U;  4FYW B;  1TH7 A;  4KUI A;  2M0Y A;  3EGX A;  4X9D A;  1TWB A;  1U5S A;  1PCX A;  3UF4 A;  1QW1 A;  1PRL C;  4V2S A;  3NGP A;  1KD1 C;  2HKN A;  2LT1 A;  5GAM j;  1XTD A;  3CCL A;  4JZ3 A;  1Y57 A;  1VQL T;  3JB9 I;  4C92 G;  2AIR B;  3E1S A;  3CPF A;  4M78 F;  1J3T A;  4J6W A;  4J9D A;  2C0T A;  2B86 A;  2X4W A;  1YHQ Q;  2PVD B;  2CH4 W;  1K76 A;  2LCL A;  1KQS P;  2FZG B;  3PTA A;  3CC2 Q;  2RHZ A;  4Y91 A;  2LT4 A;  2F2V A;  4LDY A;  1NEG A;  3M9Q A;  3QG1 A;  3UT1 A;  3EGD A;  4E7L A;  1ZSZ A;  3S6W A;  4F7U G;  3SFM A;  1YIT Q;  5L23 A;  3FJP A;  1I5L A;  1GBQ A;  4BE1 A;  3JCM V;  3MP8 A;  3OYK A;  1X43 A;  1X2Q A;  4ZNX A;  1RAH B;  1R0B G;  2PTK A;  4OMM A;  2AHJ B;  2EW3 A;  5GAM e;  2G6F X;  4DEX A;  3CCU A;  4OMQ A;  5C0M A;  2BE7 D;  1WZO A;  3SWN C;  1W1F A;  3QBY A;  1N0E A;  4A63 B;  4RTV A;  5KCH A;  1AWO A;  2DNU A;  2PVO B;  2NLU A;  5J26 A;  4R55 A;  4L5G A;  4PFZ A;  1MMG A;  2RQT A;  3OYE A;  1D1B A;  2OJ2 A;  1OX8 A;  4C5I A;  1I4K 1;  2RJD A;  4BDY A;  2JS0 A;  2O9S A;  1UGQ B;  3ZI5 A;  4M78 B;  4M75 F;  1M2V B;  2KXD A;  4M7A A;  1VQP A;  3BE3 A;  2HL3 A;  2YRV A;  2GTO A;  3PIO A;  4HVU A;  2H3J A;  1YFN A;  5HCK A;  2DXB A;  2J05 A;  1UFF A;  2YUO A;  4OGC A;  2EIF A;  1D1C A;  3JB9 G;  4N4G A;  4MZP A;  4CC4 B;  1EFN A;  2O31 A;  4HCZ A;  3JB9 J;  2FPD A;  2RHY A;  3TVT A;  2EAY A;  1C0M A;  3FRN A;  2FO0 A;  4XAX B;  4PFO A;  3OW2 A;  4M77 D;  2X4Y A;  2L3S A;  4GLK A;  1DJ7 B;  3QHS A;  1YJW T;  3A98 A;  2EYZ A;  2FZK B;  5CKH A;  1FX7 A;  4X34 A;  2QQB A;  3L42 A;  2M51 A;  1FXX A;  2DXT A;  1XNI A;  5A0G A;  1OI1 A;  2V1R A;  5ECA A;  2LCS A;  1M9S A;  1ZA2 B;  3VS1 A;  3VUB A;  1K8A R;  3A8G B;  1RAF B;  2I2L A;  3EGX B;  4E7I A;  1TG0 A;  2EQU A;  4ZN1 A;  1FMW A;  4JJC A;  2QTV A;  1UHF A;  2A08 A;  3CCL T;  2RF0 A;  2FG0 A;  2RM4 A;  3A8H B;  1W2B A;  5FU7 C;  2BZX A;  1PSF A;  5LJ5 h;  4M7A F;  4E7K A;  1QVG A;  3HRS A;  1UGP B;  2J6O A;  5KE2 A;  1AT1 B;  4OVA A;  3JCM e;  1QWE A;  4CC7 A;  4PJO A;  4A4K A;  3CEY A;  4VUB A;  2XDD A;  3JCM J;  5CR2 A;  2OI3 A;  3HP9 A;  2LJ1 A;  2CP5 A;  3M0Q A;  4PK4 A;  1M30 A;  3EGD B;  5A0D A;  3LH5 A;  2G3R A;  3CD6 Q;  2EYQ A;  2LMJ A;  2O01 E;  3CME Q;  2DM1 A;  4RCB A;  5FRN A;  1IRE B;  3H41 A;  4GLM A;  1GBR A;  2EJG A;  3L2Z A;  5GAO r;  2VGM A;  4LXC A;  3CCJ A;  1JXM A;  2LJ0 A;  4LE9 A;  3VRY A;  4L6V 5;  4NOY A;  3OMC A;  1E6G A;  2W0Z A;  1IZ6 A;  1K4U S;  1OZ2 A;  5FU7 B;  2KYM A;  3X25 B;  1Z9Q A;  3G4S T;  1NA6 A;  3CCU T;  1NBE B;  1AD5 A;  4QQD A;  5GAN d;  2YUQ A;  1VQL Q;  3MEW A;  4XU0 A;  1NJI U;  2FRY A;  2RI3 A;  3OS1 A;  1NJI C;  2HMA A;  5IXF A;  2KSS A;  3DLM A;  3M0U A;  1JBM A;  4DOV A;  2CP3 A;  2RK2 A;  1KC8 R;  2JN0 A;  2AT1 B;  4PJO E;  2M02 A;  1M27 C;  3EGU A;  3LYI A;  1R0C B;  2BTT A;  5IHK A;  1D0Z A;  1VQM A;  3AT1 B;  4J9H A;  4A4E A;  1LVK A;  5FWB A;  4RTZ A;  1H64 1;  4A4G A;  4BY6 C;  2ATC B;  2DEU A;  4EMG A;  1AZE A;  3OS5 A;  2O4X B;  3F70 A;  5HK0 A;  3ME9 A;  1VQP T;  2MPX C;  2VYT A;  3AHU A;  1QVF A;  1KQ2 A;  3GNF B;  2EJF A;  2VKN A;  5CKD A;  1QVP A;  2C06 A;  3VRZ A;  2WAC A;  5LJ3 d;  5I2S A;  4DOW A;  4M7D C;  1QVG S;  4J5Y A;  1VOM A;  4HT9 A;  2JM8 A;  4FW2 A;  3JB9 D;  1RUW A;  2GFU A;  2HQH A;  3WVD B;  1Q82 U;  4BY6 B;  1X6B A;  1JJ2 S;  4RMO A;  2Y90 A;  1Q95 G;  1VA7 A;  4PJO C;  1C1A A;  2RO0 A;  1Q82 C;  1EX4 A;  1PG5 B;  5IAY A;  3HTR A;  3FJ5 A;  1U06 A;  3MHX A;  5GMK j;  1WQW A;  5FLX E;  2R57 A;  1T3L A;  3CBM A;  2F2X A;  1UB4 A;  3D7S B;  2DZ9 A;  1PWT A;  5D6Y A;  2WSC E;  5CQX A;  4PJN A;  2M1H A;  3UA7 A;  3H0H A;  4YTL A;  5EG2 A;  2EQJ A;  3G1J A;  1W2B P;  4J83 A;  1GXI E;  2RI5 A;  1G3S A;  1PSE A;  2K7A A;  4F14 A;  4C0G A;  1MUZ A;  2DD4 A;  2SEM A;  4D8D A;  2E5K A;  3TSZ A;  4J6X A;  3ULR B;  2LNV A;  1M90 R;  4PJO B;  1X2K A;  2LQK A;  3SEM A;  3HRT A;  1AHJ B;  2W10 A;  3OYJ A;  4JS5 A;  3QII A;  1ZUY A;  1PD0 A;  3U23 A;  3UPU A;  1WX6 A;  4RKU E;  2EGA A;  5GMK e;  2LNH B;  1YJW Q;  3OA6 A;  2JNG A;  1SHF A;  1MMA A;  4JUV A;  9ATC B;  3CCJ T;  2X3W D;  4C8Q C;  4JRI A;  3CBP A;  3E9F A;  4BI4 A;  4Y28 E;  3E2U A;  5KE3 A;  2QXF A;  2DJZ A;  4OMP A;  2DL8 A;  4KBM B;  4F17 A;  3QWX X;  3CCL Q;  1D09 B;  3M54 A;  4GBQ A;  2LVM A;  3C94 A;  3T9N A;  3G6E A;  4L59 A;  2C0I A;  4MZM A;  5KYY A;  5GAN 4;  4QT7 A;  1VQ6 A;  1BIA A;  2KRS A;  1GRI A;  4IUQ A;  2VAS A;  3LWI A;  1G2B A;  4QVC A;  1ZX6 A;  2MYS A;  3CCV A;  2YXY A;  4JRK A;  2YWW A;  4XU3 A;  4XK8 E;  2DJQ A;  4ZGD B;  2EYY A;  3CMA T;  3CXC P;  2RB6 A;  5C6S A;  5LJ5 g;  1VQM T;  3TEE A;  2L89 A;  1VQ8 A;  1QWF A;  3V7C A;  2CZ0 B;  4CRI A;  3L2W A;  3OY9 A;  1SHG A;  2A3L A;  1QP2 A;  3QYH B;  1N8R U;  2K3Y A;  3VS6 A;  2KK4 A;  4FIB A;  2COW A;  4M7D D;  2WSE E;  4C0D C;  1H3Z A;  1HSQ A;  4JJB A;  2JW4 A;  4IUP A;  4WTO B;  3CCU Q;  4J7I A;  3CCS A;  1QVF P;  5GAN h;  1K73 R;  4LUE A;  5KYX A;  2ESW A;  1NEB A;  4RTW A;  3M0S A;  5AYF A;  4PLL A;  3EHQ A;  2DL7 A;  1NLP C;  1U1T A;  1MMD A;  1KHC A;  4XTU A;  4AFQ C;  1PNJ A;  2JXB A;  3OBY A;  1HXD A;  3X26 B;  1GL5 A;  1OOT A;  4AG2 C;  2JZ2 A;  2ENM A;  2KAF A;  1PKS A;  2L3R A;  2RQV A;  1ZBJ A;  3OSS C;  2KBT A;  3J81 E;  4ZTJ A;  3JCM X;  1K0S A;  1LJO A;  5A0L A;  4C92 A;  3OYG A;  1Q86 U;  4PJM A;  1D3B A;  5FU6 C;  4M77 G;  3MEV A;  1Q86 C;  5FRO A;  4K11 A;  1U8R A;  3EG0 A;  4XU2 A;  3OS2 A;  2ED0 A;  2AK5 A;  4OF1 A;  1VQP Q;  2QYZ A;  3CC7 T;  2JTM A;  2ABL A;  2JJ9 A;  5IHI A;  2XIC A;  4FU6 A;  2QDL A;  2IPO B;  4EMH A;  3E19 A;  2EQM A;  2VUB A;  2GF7 A;  2H3E B;  4F7U A;  3CPW A;  3QDF A;  4FCY A;  4XTX A;  4IIO A;  1VQN T;  1QP3 A;  3SB2 A;  1SEM A;  3TQ7 P;  3OBW A;  3LGL A;  5GAN 3;  3HFN A;  2PUO B;  1S72 A;  2AKL A;  5LJ3 h;  2KDS A;  1I0C A;  4C8Q D;  3UAT A;  2YUN A;  4Z89 A;  1M8M A;  5FU6 B;  4OML A;  1YCS B;  4E2F B;  5CCA A;  2FL7 A;  4EPC A;  2RHI A;  5IHN A;  2DA9 A;  3OYM A;  4C92 E;  2NWM A;  1M2O A;  5CKE A;  4ORZ A;  2JOY A;  3OQ5 A;  1G3Y A;  2QG9 B;  1VIF A;  2NUT A;  3CC4 A;  5IT9 E;  4DEY A;  4FT4 A;  3THK A;  2QQA A;  4LN2 A;  2D1X A;  1TUD A;  3VS2 A;  2ZZD A;  4C92 F;  3V7S A;  1PD1 A;  4KRT A;  1PC0 A;  1Y71 A;  3RDV A;  4M75 A;  4F7U E;  4BE0 A;  3G6E T;  4DBR A;  4O6J A;  5KYY B;  3M57 A;  5KH6 A;  1VQ6 T;  3M56 A;  1Q7Y R;  3A5Z B;  3M59 A;  4JJN K;  4F7U F;  1IRX A;  1YI2 A;  4PFP A;  3OYC A;  3CCV T;  7AT1 B;  1ARK A;  3QDR B;  2RQW A;  3G4S A;  4OMF B;  4PNO A;  2F1L A;  1RAG B;  4M78 C;  2VB6 A;  3M0R A;  2E3H A;  3OYH A;  4E7Z A;  1LCK A;  1VQ8 T;  5GAM g;  2E6Z A;  1WNL A;  3CCJ Q;  1TXQ A;  2D8H A;  4Q5W A;  1RI0 A;  1RAI B;  2LP5 A;  2EWN A;  2RPN A;  4QW2 A;  5CQY A;  1YJN A;  1B7T A;  5GAO m;  3EG1 A;  2MI6 A;  4IIM A;  3HQF A;  4ESR A;  1N27 A;  3CCS T;  4IUT A;  1KQ1 A;  4ZGE B;  5KYX B;  4M75 E;  1VQ9 A;  3UWN A;  3CPW S;  3GIB A;  4LDX A;  1SRM A;  4JRP A;  2DIG A;  1WLP B;  2YRD A;  1VQO A;  1KIK A;  3RIR A;  3GF5 A;  1ZA1 B;  1PKT A;  5GAN j;  2GTJ A;  2NUP A;  2RQR A;  3H9N A;  3PMT A;  5GAO l;  4BDZ A;  3CCR A;  5GAO p;  2QGG A;  1RL2 A;  5KYN A;  3FEO A;  2DER A;  1G3T A;  3LX7 A;  1VQM Q;  5DLQ E;  1WID A;  4C92 B;  4NL3 A;  2LX9 A;  3KBG A;  1BU1 A;  3HL8 A;  2K3X A;  1K8A U;  5CKB A;  1M1G A;  3GLX A;  1K8A C;  1OV3 A;  4HCK A;  3CBO A;  5GMK h;  2DAQ A;  2XDB A;  3H6Z A;  3JB9 F;  4IUV A;  1R77 A;  2Y4X A;  4OB1 B;  3QSU A;  4F7U B;  3LLR A;  2A28 A;  3X24 B;  3JAM E;  4XQ3 A;  5GAN e;  1R8O B;  2KRM A;  3UDC A;  2YLC A;  4RTY A;  1KHI A;  3V8L A;  1ZSZ C;  1TUG B;  2ROL A;  1VUB A;  4M75 C;  1S72 T;  2CGH A;  1W6X A;  1UJ0 A;  1N0G A;  2KRO A;  5I22 A;  1K9M U;  5GAN g;  1W4S A;  2CYZ B;  2CZ7 B;  4PLI A;  3ZL7 C;  3GP8 A;  4M7A E;  2HZY A;  2XD0 A;  3BW1 A;  5GAN 2;  1K9M C;  1UGV A;  5LJ3 j;  2E70 A;  2HD0 A;  5LJ5 f;  2LJ3 A;  1ZUU A;  3TRE A;  4XTZ A;  2MCN A;  1AWX A;  3CC4 T;  2NUT B;  4EDU A;  3OS0 A;  2DYB A;  4EIK A;  2DFU A;  2X35 A;  1JJ2 A;  2ZPG B;  1OU9 A;  2JS2 A;  1B07 A;  1OPK A;  1X01 A;  3OMG A;  4IKF A;  1WJQ A;  4FYX B;  4BB7 A;  1AWW A;  1S1N A;  4J6Y A;  4M78 D;  1ZSZ B;  2FPF A;  4M75 B;  3JCM g;  1BIB A;  5CK9 A;  3PVQ A;  4BI3 A;  5GAN 6;  2HL5 C;  2I0N A;  2B8A A;  1ACM B;  2XK0 A;  2HBW A;  3JB9 H;  4Z88 A;  1KC8 U;  2FRW A;  6AT1 B;  2OX7 A;  1KC8 C;  3BFM A;  2KGT A;  4I1K A;  3SHW A;  1YI2 T;  2VVK A;  5LJ3 e;  2FEI A;  2XMF A;  3EG2 A;  3QJ6 A;  2CT4 A;  2QQ9 A;  2KXC A;  5GAN 8;  4TVR A;  4OMO A;  1WHG A;  5KYW A;  2DBM A;  2K5L A;  4M7A C;  3JCM b;  1VQ7 A;  1YJ9 A;  2LQW A;  4DBQ A;  3TCJ A;  1MV0 B;  3PFS A;  2MWP A;  2DTH A;  4HXJ A;  1SG5 A;  4FYV B;  4JLI A;  2EYW A;  2RN8 A;  3PE0 A;  1WFW A;  3LH0 A;  1YJN T;  2DPP B;  3I56 A;  2A0F B;  1OU8 A;  3L2Q A;  2JMA A;  1RAE B;  3CMA A;  3GPL A;  4M7D G;  2HCK A;  3G6E Q;  1OZ3 A;  1WA7 A;  4HVW A;  4E6R A;  1VQ9 T;  4RG8 A;  1VQ6 Q;  2HKQ B;  4OB0 B;  1VQO T;  3VKI A;  3REB B;  2VC8 A;  5D6W A;  4PJO G;  2NUP B;  2ZPF B;  3EG3 A;  4DBH A;  2E65 A;  5CKF A;  3CCV Q;  4J9G A;  5IN1 A;  4M7A B;  2CUB A;  5DLO A;  3CCR T;  1M3C A;  5LL6 S;  1FWZ A;  2VXE A;  2KY9 A;  1V29 B;  3QUI A;  3OB9 A;  5I11 A;  5GMK m;  3QKJ A;  4A4F A;  1VQ8 Q;  2KQW A;  2ZAE A;  2CSI A;  1NJI R;  1OQK A;  1AOJ A;  1NYF A;  1O9S A;  1SKU B;  4A4H A;  1B3Q A;  3WXM B;  3L1A A;  4X1V A;  1Y07 A;  1BCO A;  4HKE A;  1D1A A;  2KMT A;  2RHX A;  3M4G A;  3MEU A;  2RMO A;  4E7H A;  3OW2 P;  1WDX A;  3CCS Q;  5GMK l;  2DRK A;  3EG9 A;  1N0F A;  1EZZ B;  2YDL A;  5D7U A;  2DX1 A;  3A8L B;  2RH2 A;  4MML A;  3V7R A;  2FYK A;  2O9V A;  1N6A A;  1M90 U;  2E41 A;  1WXU A;  3EH2 A;  4LDW A;  5J3B A;  2K2M A;  2L5Q A;  1M90 C;  2SRC A;  2OAW A;  3CC7 A;  3QJY A;  2DTI A;  2LX7 A;  3MKD A;  2K9G A;  1M1K R;  3A1P A;  3SDZ A;  3CQT A;  3I9Q A;  1FMK A;  5AT1 B;  3S3M A;  1YIJ A;  4C8Q G;  3QWY A;  2A36 A;  4QVZ A;  2ROT A;  2F5T X;  2X4X A;  1VQN A;  2EQI A;  3VS0 A;  4PJJ A;  2D6F A;  4MDW A;  5GAM f;  1QVG P;  1Y0M A;  3X28 B;  2P84 A;  1SPK A;  4OB3 B;  1M8V A;  1K9A A;  3V8K A;  4B9X A;  4E7J A;  1JJ2 P;  1WHH A;  1YWP A;  1UE9 A;  1PHT A;  4E47 A;  4P5N A;  2E1H A;  2ECZ A;  5CVI A;  3G71 A;  1MHN A;  2HNI A;  4M7A D;  4KGZ B;  2LRQ A;  4KUL A;  3J7A F;  5EC7 A;  1IXD A;  4AMC A;  1S72 Q;  2DXU A;  2HSE B;  2QA4 A;  3HRU A;  4R56 A;  1VQ5 A;  1WHJ A;  2KI7 A;  4DA4 A;  5HKC A;  2DLP A;  1TS9 A;  4D8K A;  1BKB A;  4ME7 A;  2V8K A;  2LTO A;  3JSC A;  1T0H A;  1MMN A;  3CXC S;  4X9C A;  2KNB B;  5A2Q E;  4Z8A A;  3MP1 A;  1ZBX A;  1VQ7 T;  1YJ9 T;  2MF2 A;  5FW9 A;  3CC4 Q;  3VV0 A;  4J9B A;  2L2P A;  3HKS A;  1RAA B;  4B9W A;  3O8V A;  1UEC A;  4KT0 E;  1T3S A;  4C5H A;  1K73 U;  1H92 A;  3I56 T;  3A8O B;  3BDU A;  2J7I A;  3BDL A;  2X3X D;  2CKK A;  1K73 C;  3JCM c;  4JDS A;  4M4Z A;  1HK9 A;  1JU5 C;  1D0X A;  2CRE A;  1I5O B;  2XI9 A;  5D6X A;  1KSW A;  2DF6 A;  1Q81 U;  4FL6 A;  1D0Y A;  2LCC A;  3VUZ A;  4M77 A;  2EKO A;  2QEX A;  3M53 A;  4J7F A;  1Q81 C;  4RTU A;  1NPP A;  2ZPB B;  1NG2 A;  1OYX A;  3R6O A;  1YI2 Q;  5J39 A;  1WHL A;  2PQW A;  5GAN f;  2GNC A;  1CKB A;  1SSH A;  1QLY A;  3G4S Q;  2OTJ A;  1VQ4 A;  3NHN A;  2HAX A;  4PJO D;  1MGQ A;  2DKG A;  1UUE A;  3VS3 A;  4F16 A;  1YEL A;  4HT8 A;  4C5E A;  4JLG A;  1MNE A;  1YJN Q;  5L8R E;  3C12 A;  2JMC A;  1NM7 A;  3WVE B;  2XU8 A;  3NTK A;  4Y92 A;  2IIM A;  1WHK A;  2YLB A;  3EG9 B;  1QCF A;  1ZQ1 A;  3MET A;  1I81 A;  3JCM f;  2CP7 A;  3RBB B;  1VQ9 Q;  1WPY A;  2DO3 A;  2CP0 A;  2MWO A;  3ZBD A;  4M77 E;  1VQO Q;  2PNI A;  3I5R A;  3OYF A;  4FT2 A;  4HCC A;  3SWN A;  2MMP A;  3P8D A;  1IGQ A;  2P0K A;  2O2O A;  3EFS A;  1N8R R;  1NYG A;  4RTT A;  2YHT A;  4RUG A;  3OYI A;  3CCR Q;  4DBF A;  1KG1 A;  2GGR A;  1YP5 A;  2DZC A;  3G7Z A;  1YIJ T;  2K3B A;  4M77 F;  2BZY A;  1N5Z A;  2COZ A;  2MOX A;  1WXT A;  3C95 A;  1F1B B;  3QXE B;  2OTL A;  5LJ5 d;  2MAM A;  5LJ3 f;  5GJW B;  1U1S A;  2DL5 A;  4ZTF A;  2EGC A;  4ELY C;  1KQS S;  2JT4 A;  2CS7 A;  2HDA A;  1P92 A;  2XG8 D;  1GCQ A;  2GQV A;  1JEG A;  1G8X A;  4FW1 A;  2PVG B;  3CME T;  3M58 A;  3RER A;  3G71 T;  2KT8 A;  2EFI A;  4ANJ A;  3VS4 A;  2X9H A;  2ZCF B;  2DRM A;  1Q86 R;  3DB3 A;  3ER0 A;  4FYY B;  4M78 G;  1M5Q 1;  1M3B A;  1ABO A;  3EHR A;  2QA4 T;  5M9O A;  1BYM A;  4M77 C;  3HPW A;  2NYS A;  1VYT A;  1VQ5 T;  2R5A A;  4NL2 A;  1JB0 E;  5I21 A;  4BUG A;  3H8Z A;  3NPF A;  1BB9 A;  1BCM A;  1GCP A;  1Z9Z A;  2RA2 A;  2COY A;  2P0Q A;  4MMK A;  1OEB A;  1NE8 A;  1QKX A;  3QZ9 B;  4QQG A;  4ZN3 A;  2P4R A;  4D6W A;  4N4I A;  1BI1 A;  3CCM A;  5GAO n;  4KH0 B;  2L3Q A;  3P8H A;  2QK0 A;  3H0F A;  1ZHI A;  2A37 A;  5HK3 A;  4J8O A;  1KD1 R;  2J6K A;  3MP6 A;  4DQ2 A;  1VYU A;  4XTY A;  2DE0 X;  4A53 A;  1M1F A;  4C0F A;  1IB8 A;  8AT1 B;  4M77 B;  2QEX T;  1HYO A;  1PRM C;  5FRM A;  1ZSG A;  1VQK A;  1UG1 A;  3I55 A;  5CAI A;  4N4H A;  4C92 C;  1IHW A;  1OPL A;  3L2R A;  2CZ1 B;  4J9C A;  2L8D A;  2DMO A;  1UHC A;  2K57 A;  2OTJ T;  2V1Q A;  1BBZ A;  1VQ4 T;  1UTI A;  4F04 B;  3CCE A;  3MCA B;  4LD9 K;  2KVQ G;  1VQ7 Q;  1YJ9 Q;  4LDV A;  2J6F A;  2K4Y A;  1AVZ C;  3KFV A;  1JRI A;  3FLG A;  1M3A A;  1TOV A;  2L3P A;  4LD6 A;  1JO8 A;  2Z0W A;  3UA6 A;  3I56 Q;  2V26 A;  4A54 A;  1LOJ A;  1A0N B;  2DYI A;  4M75 G;  2FZC B;  2KR3 A;  3VS7 A;  3Q1J A;  3BY7 A;  3CMA Q;  3CCQ A;  2LC4 A;  1BI3 A;  2QTX A;  3S3N A;  3RUX A;  1LPL A;  3PT9 A;  5KCO A;  2LDM A;  2HBP A;  2O4X A;  1GCQ C;  4IUU A;  1D3B B;  2K5I A;  2NUZ A;  3INZ A;  2M9U A;  4II1 A;  1X75 C;  5IH2 A;  4ATO A;  3VU3 C;  3SWN B;  2VWF A;  2K5F A;  4J9I A;  1C6V X;  2FVU A;  3QO3 A;  4CI0 C;  1I1J A;  3LWH A;  3CPW P;  1JXO A;  2GFA A;  3RMS A;  3GBQ A;  1WI7 A;  4FSX A;  2RD1 A;  1WYX A;  1YN8 A;  2OTL T;  2E4H A;  2HQX A;  1GFC A;  1SF9 A;  4ZGJ B;  2E12 A;  4OMN A;  2QGF B;  5GAM d;  2A7Y A;  2YT6 A;  2GCX A;  1FMV A;  2DD5 A;  2M16 A;  1ZUK A;  1TU0 B;  1BI2 A;  4KGV B;  2JUF A;  1WHM A;  2LZ6 B;  1TSF A;  2CDT A;  2BIV A;  1G83 A;  2E10 A;  1YHQ A;  3X20 B;  2Y4Y A;  3OYD A;  3EFO A;  4B6M A;  1CSK A;  3CC2 A;  4RG2 A;  4M7A G;  3KXT A;  3EH1 A;  3PGG A;  3NMZ C;  5DM7 R;  3CC7 Q;  1K0X A;  1K1Z A;  2QAS A;  3FB9 A;  1YIJ Q;  4AFZ C;  3L2V A;  1YIT A;  4N0A A;  4E7S A;  4M7D A;  1VQN Q;  1ZLM A;  3FC3 A;  2HQE A;  2L0A A;  1HJD A;  4MDX A;  2ED1 A;  2RQU A;  3CCM T;  3GNG A;  1WQ7 A;  2XKO C;  5I2M A;  3S3O A;  4C92 D;  1MV3 A;  2QQR A;  1UGS B;  2EPD A;  3M55 A;  2DL4 A;  3URG A;  1I8F A;  4HA8 A;  1X6G A;  1M4Z A;  1K9M R;  2JM9 A;  1WGS A;  4HVV A;  2ZPI B;  1SRL A;  2KE9 A;  3M0P A;  1IGU A;  3OYN A;  1H3H A;  3G71 Q;  1GFD A;  1O75 A;  2F2W A;  2PUK B;  1UJY A;  3J80 E;  1WXB A;  4XU1 A;  4WCI A;  5LJ3 g;  2JTF A;  4KGX B;  1OUL A;  2QA4 Q;  1VQK T;  2D8J A;  1RLP C;  3I55 T;  3E9G A;  1RAB B;  2IVW A;  1VQ5 Q;  4LDU A;  2WSF E;  1EIF A;  1ABQ A;  1V76 A;  2RJF A;  1B34 A;  2MK5 A;  1QCO A;  1V1C A;  3CCE T;  4M7D E;  1AZG B;  3RR6 A;  3VYG A;  2DET A;  3EAE A;  1BI0 A;  4UC4 A;  1AWJ A;  4JJD A;  3TSW A;  3N5B B;  2RHU A;  1X6O A;  3SD4 A;  2P4T A;  2DK3 A;  4M7D F;  2CUD A;  1OX9 A;  2AZS A;  2RI2 A;  3OW2 S;  2X51 A;  4C8Q A;  3CXC A;  1XOV A;  2DXC A;  3NTI A;  3CCQ T;  5KYU A;  3RES A;  4PJO F;  2KT1 A;  1CKA A;  3RMQ A;  3JCM d;  4JS4 A;  2QEX Q;  5GAO q;  4WF2 A;  1E6H A;  2CH4 A;  2VV5 A;  4M75 D;  3RNJ A;  3JCM P;  1M1K U;  1KK7 A;  4C5G A;  1Y7X A;  2AZV A;  4PKC C;  2P0P A;  3MPU B;  4J9F A;  1M1K C;  3OYB A;  3GOX A;  2OTJ Q;  4FSS A;  2QQS A;  2RJE A;  1VQ4 Q;  2VXF A;  2LQN A;  4IUR A;  2E5Q A;  2KEA A;  4ELZ C;  4JZ4 A;  1VIE A;  3A8M B;  1W2B S;  3OYY A;  3ZEH A;  2PZ1 A;  1Y96 A;  2BZ8 A;  4N0A C;  3C0C A;  3O5Z A;  2X4J A;  1WJS A;  3DLL A;  3LGF A;  3FDR A;  1E7O A;  2ZGW A;  4OB2 B;  2YUP A;  4QQ6 A;  2BKD N;  3JV3 A;  4AT1 B;  3NFC A;  1NLO C;  3RKX A;  3TU4 K;  1FYN A;  4EMK A;  4OP0 A;  2EKH A;  1RAC B;  2J06 A;  3I5S A;  5CO7 A;  4C8Q E;  3KUF A;  2IG0 A;  2V8J A;  1X69 A;  4AG1 C;  3PNW C;  2E64 A;  1I07 A;  2EBP A;  2K79 A;  1YHQ T;  2EVR A;  2FPE A;  4LUD A;  3EFO B;  2M0O A;  3CC2 T;  3MEA A;  4C8Q F;  2DTO A;  3IQL A;  1N9S A;  4AFS C;  2GBQ A;  1QCN A;  3MJX A;  2ZPH B;  3R6N A;  4J9E A;  2XHC A;  2YRC A;  1YIT T;  3CD6 A;  1UEB A;  2RJC A;  1LNX A;  5DY9 A;  4M7D B;  1H8K A;  4RCC A;  3CME A;  1Q82 R;  3ZFJ A;  1IHV A;  2OTL Q;  4BD3 A;  3PIP A;  5GAM h;  2AKK A;  5HY6 A;  2KYB A;  2OAU A;  3OYL A;  4R0K A;  2F69 A;  1RI9 A;  2BE9 B;  2D0N A;  1T0J A;  1KJW A;  4MZT A;  5LJ5 j;  3ASK A;  4XTW A;  4QKU A;  1WIE A;  1YCY A;  2DIL A;  2KRN A;  3JRZ A;  1VQL A;  2FB7 A;  2C0O A;  5GJV B;  2K2V A;  4JPB W;  5KYW B;  2DEQ A;  2VGN A;  2HEQ A;  3QPH A;  3JCM W;  1KQS A;  2QI2 A;  4FM4 B;  5FWC A;  2XID A;  1W70 A;  1HD3 A;  3M0T A;  4AFU C;  2RNA A;  1U3O A;  1B34 B;  1QQJ A;  1TUC A;  2DL3 A;  1IO6 A;  1QVF S;  2DVE A;  3HFO A;  2CZ6 B;  1XQH A;  3M5A A;  3FIF A;  1KFZ A;  3I35 A;  1G3W A;  8ATC B;  1QKW A;  5LJ5 e;  3CCM Q;  2R5M A;  2D0Q B;  3HSB A;  2RK1 A;  3REA B;  2C1L A;  3RKW A;  1X27 A;  1AEY A;  1YBY A;  3QYG B;  3VJP A;  2FHD A;  4C8Q B;  3HHT B;  5KYU B;  2EYX A;  5GAN 5;  2DIQ A;  3MO8 A;  1JQQ A;  2H8H A;  4CC3 A;  4EMK C;  4RTX A;  4BAC A;  1VQK Q;  3M4Y A;  1N8R C;  3I55 Q;  3OSV A;  3P8B B;  4PL6 A;  2F5K A;  2E3I A;  1RLQ C;  2EJ9 A;  2ZPE B;  3NTH A;  2MIO A;  2CP2 A;  2LQ8 A;  2DVJ A;  2EQK A;  1UDL A;  3LW5 E;  2JTE A;  5GMK i;  3CCE Q;  1BK2 A;  2CT3 A;  4OGE A;  3L2U A;  4GY5 A;  3PMI A;  1Q81 R;  2YSQ A;  4PJL A;  3DB4 A;  2CP6 A;  1PM3 A;  1Y96 B;  4M78 A;  4XTV A;  1M2V A;  3VS5 A;  2XDP A;  4QVD A;  3C4S A;  2EGE A;  5GAN 7;  2V8I A;  3VYH B;  1NZ9 A;  2R58 A;  3H0I A;  5CIU A;  4LNP A;  4BE2 A;  1YNZ A;  3DKM A; 
#chains in the Genus database with same CATH homology
 4LDV A;  2DD4 A;  3QJ6 A;  2K4Y A;  1JRI A;  2QQ9 A;  3FLG A;  4O5V A;  5GAN 8;  3QZ5 B;  4EMK B;  3EFR A;  4J6X A;  2LNV A;  4TVR A;  4PJO B;  4HCB A;  3JCM h;  2K5L A;  4C0D B;  4M7A C;  4LD6 A;  2LQK A;  3JCM b;  1VQ7 A;  4A54 A;  3HRT A;  1YJ9 A;  1LOJ A;  1AHJ B;  2E6N A;  4M75 G;  2QDY B;  3TCJ A;  3OYJ A;  3PFS A;  2MWP A;  4BI8 B;  4JS5 A;  3QII A;  2DTH A;  3BY7 A;  3Q1J A;  3CCQ A;  1NPR A;  3UPU A;  2LC4 A;  4NS5 A;  1BI3 A;  5GMK e;  4RKU E;  2QTX A;  3S3N A;  4JLI A;  2JVV A;  3RUX A;  2JNG A;  3JCM Q;  3OA6 A;  2BUD A;  3LH0 A;  1YJN T;  2DPP B;  3PT9 A;  3I56 A;  5KCO A;  2LDM A;  2HBP A;  4JUV A;  2O4X A;  4IUU A;  4C0Z A;  1D3B B;  2D9T A;  3L2Q A;  2K5I A;  3V8J A;  3INZ A;  2M9U A;  3CCJ T;  4II1 A;  1X75 C;  3CMA A;  4ATO A;  3GPL A;  4M7D G;  4C8Q C;  3CD6 T;  3VU3 C;  4KUD K;  1WJR A;  3CBP A;  4JRI A;  3SWN B;  1YJW A;  3E9F A;  1OZ3 A;  2K5F A;  4Z02 A;  4Y28 E;  4BI4 A;  1SSF A;  1VQ9 T;  2FVU A;  4JRQ A;  1Q7Y U;  5KE3 A;  2QXF A;  2DJZ A;  4RG8 A;  3QO3 A;  4KBM B;  4OB0 B;  4CI0 C;  1VQO T;  3VKI A;  1G5V A;  1Q7Y C;  2VC8 A;  5D6W A;  4PJO G;  1N9R A;  3RKY A;  3LWH A;  3M54 A;  2GFA A;  3OYA A;  3RMS A;  2LVM A;  2PU9 B;  1UGR B;  4M78 E;  3C94 A;  3T9N A;  3G6E A;  4FSX A;  1TH7 A;  2RD1 A;  4KUI A;  4L59 A;  2ZPF B;  1KD1 U;  4X9D A;  2E65 A;  4MZM A;  5CKF A;  5GAN 4;  2OTL T;  5IN1 A;  1QW1 A;  4V2S A;  2HQX A;  4M7A B;  1KD1 C;  4ZGJ B;  1VQ6 A;  2E12 A;  5DLO A;  3CCR T;  1BIA A;  2LT1 A;  5GAM d;  2A7Y A;  5GAM j;  1XTD A;  1VQL T;  5LL6 S;  3CCL A;  2GCX A;  1FWZ A;  4IUQ A;  2VXE A;  2KY9 A;  1V29 B;  2DD5 A;  2M16 A;  3OB9 A;  3QUI A;  3JB9 I;  4C92 G;  1BI2 A;  3LWI A;  2JUF A;  5GMK m;  3QKJ A;  4A4F A;  4M78 F;  2KQW A;  3CPF A;  3E1S A;  4QVC A;  4J6W A;  3CCV A;  2X4W A;  1O9S A;  4JRK A;  2PVD B;  2BIV A;  4XU3 A;  4XK8 E;  4ZGD B;  3CMA T;  4A4H A;  3WXM B;  2LCL A;  3L1A A;  2RB6 A;  5C6S A;  3PTA A;  1Y07 A;  5LJ5 g;  2RHZ A;  4Y91 A;  1VQM T;  4HKE A;  3TEE A;  2L89 A;  1VQ8 A;  2E10 A;  2LT4 A;  2KMT A;  2RHX A;  4LDY A;  3M4G A;  3M9Q A;  3V7C A;  2CZ0 B;  3QG1 A;  3MEU A;  4CRI A;  3UT1 A;  3OY9 A;  3L2W A;  4E7H A;  4E7L A;  1YHQ A;  3X20 B;  2A3L A;  1QP2 A;  2Y4Y A;  3QYH B;  3S6W A;  4F7U G;  1N8R U;  3SFM A;  3OYD A;  2K3Y A;  5GMK l;  2KK4 A;  3CC2 A;  4FIB A;  4M7D D;  3A8L B;  4RG2 A;  4M7A G;  2WSE E;  4C0D C;  3KXT A;  3PGG A;  2RH2 A;  3FJP A;  4MML A;  5DM7 R;  1H3Z A;  3V7R A;  2FYK A;  1I5L A;  4IUP A;  4BE1 A;  1N6A A;  3FB9 A;  4J7I A;  1M90 U;  2E41 A;  3CCS A;  3L2V A;  3JCM V;  5GAN h;  1YIT A;  4LDW A;  3MP8 A;  4N0A A;  3OYK A;  5J3B A;  4M7D A;  1M90 C;  2L5Q A;  2AHJ B;  5GAM e;  3CC7 A;  3QJY A;  3FC3 A;  2DTI A;  2HQE A;  5AYF A;  3CCU A;  3SDZ A;  4PLL A;  1YIJ A;  3S3M A;  5C0M A;  4C8Q G;  1U1T A;  4MDX A;  4QVZ A;  2F5T X;  2X4X A;  3SWN C;  3CCM T;  4XTU A;  1KHC A;  1WQ7 A;  3GNG A;  2XKO C;  5I2M A;  3S3O A;  3QBY A;  1VQN A;  3OBY A;  4C92 D;  1HXD A;  2QQR A;  3X26 B;  1UGS B;  3M55 A;  2D6F A;  5KCH A;  4MDW A;  3URG A;  5GAM f;  2JZ2 A;  1I8F A;  2NLU A;  2KAF A;  2PVO B;  2L3R A;  4HA8 A;  1M4Z A;  3X28 B;  1WGS A;  2ZPI B;  3OSS C;  3J81 E;  4OB3 B;  4ZTJ A;  1M8V A;  3JCM X;  3OYN A;  1LJO A;  5A0L A;  3V8K A;  4C92 A;  5J26 A;  3OYG A;  4R55 A;  4L5G A;  1Q86 U;  1O75 A;  4B9X A;  4E7J A;  2PUK B;  1D3B A;  5FU6 C;  4M77 G;  3OYE A;  3J80 E;  4XU1 A;  3MEV A;  1Q86 C;  5FRO A;  5LJ3 g;  4E47 A;  1U8R A;  4P5N A;  4C5I A;  2JTF A;  1I4K 1;  4XU2 A;  2E1H A;  3OS2 A;  1VQK T;  2RJD A;  5CVI A;  3I55 T;  3G71 A;  1MHN A;  3E9G A;  4OF1 A;  2HNI A;  3CC7 T;  4BDY A;  2JTM A;  2IVW A;  4M7A D;  2LRQ A;  2XIC A;  4FU6 A;  4KUL A;  4LDU A;  2WSF E;  3J7A F;  1EIF A;  4EMH A;  3E19 A;  2EQM A;  2VUB A;  2GF7 A;  4F7U A;  2DXU A;  1B34 A;  2RJF A;  3CPW A;  4XTX A;  1UGQ B;  2QA4 A;  4M78 B;  4M75 F;  1VQN T;  1QP3 A;  4M7A A;  3HRU A;  3SB2 A;  1VQP A;  3CCE T;  4M7D E;  4R56 A;  3VYG A;  3EAE A;  1BI0 A;  3OBW A;  4UC4 A;  2YRV A;  1VQ5 A;  3LGL A;  5GAN 3;  3HFN A;  5HKC A;  4DA4 A;  2PUO B;  3PIO A;  1S72 A;  1BKB A;  2H3J A;  2KDS A;  4ME7 A;  5LJ3 h;  3N5B B;  2DXB A;  2RHU A;  4C8Q D;  2V8K A;  1X6O A;  4OGC A;  2LTO A;  3JSC A;  3SD4 A;  2EIF A;  3CXC S;  2P4T A;  3JB9 G;  4X9C A;  2DK3 A;  4N4G A;  4MZP A;  4M7D F;  5A2Q E;  3MP1 A;  5FU6 B;  1ZBX A;  1VQ7 T;  1YJ9 T;  5CCA A;  2MF2 A;  2RI2 A;  4HCZ A;  3VV0 A;  3JB9 J;  3OW2 S;  2FL7 A;  4C8Q A;  3CXC A;  4EPC A;  1XOV A;  2DXC A;  3HKS A;  3NTI A;  3CCQ T;  2RHY A;  4B9W A;  2RHI A;  3O8V A;  3RES A;  2EAY A;  4KT0 E;  3FRN A;  4PJO F;  4C5H A;  3OYM A;  1K73 U;  3RMQ A;  3JCM d;  4JS4 A;  4C92 E;  4XAX B;  3I56 T;  5CKE A;  3A8O B;  2JOY A;  2X4Y A;  3BDU A;  3OQ5 A;  4M77 D;  1G3Y A;  5GAO q;  3BDL A;  4GLK A;  4WF2 A;  1VIF A;  2CKK A;  1DJ7 B;  3JCM c;  4JDS A;  1K73 C;  3CC4 A;  3QHS A;  2VV5 A;  5IT9 E;  1HK9 A;  4M75 D;  3JCM P;  1M1K U;  1YJW T;  2XI9 A;  5D6X A;  4FT4 A;  4C5G A;  1Y7X A;  5CKH A;  4FL6 A;  1Q81 U;  1FX7 A;  2QQA A;  4PKC C;  2P0P A;  2QQB A;  3L42 A;  4X34 A;  2LCC A;  3VUZ A;  4M77 A;  1FXX A;  1M1K C;  2DXT A;  2EKO A;  2ZZD A;  3OYB A;  3M53 A;  4C92 F;  4J7F A;  2QEX A;  3V7S A;  1Q81 C;  1Y71 A;  1XNI A;  3GOX A;  1NPP A;  2ZPB B;  5A0G A;  2QQS A;  2RJE A;  1OYX A;  1OI1 A;  4M75 A;  1M9S A;  2VXF A;  4F7U E;  4BE0 A;  4IUR A;  3R6O A;  3G6E T;  2E5Q A;  3VUB A;  3OW2 A;  5J39 A;  3A8G B;  2PQW A;  2I2L A;  4ELZ C;  1VIE A;  3A8M B;  4O6J A;  1W2B S;  3OYY A;  4E7I A;  3M57 A;  3ZEH A;  2EQU A;  4ZN1 A;  5KH6 A;  5GAN f;  1VQ6 T;  1Y96 A;  2OTJ A;  3M56 A;  4N0A C;  1VQ4 A;  3CCL T;  2HAX A;  2X4J A;  1WJS A;  2RM4 A;  3A5Z B;  3A8H B;  3M59 A;  1W2B A;  3DLL A;  4JJN K;  4F7U F;  4PJO D;  1MGQ A;  3LGF A;  2DKG A;  3FDR A;  5FU7 C;  1YI2 A;  2ZGW A;  1PSF A;  4OB2 B;  5LJ5 h;  3OYC A;  3CCV T;  4QQ6 A;  1YEL A;  2BKD N;  4M7A F;  4E7K A;  1QVG A;  3HRS A;  3QDR B;  1UGP B;  3G4S A;  3NFC A;  4HT8 A;  3RKX A;  4C5E A;  5KE2 A;  3TU4 K;  4OMF B;  4PNO A;  4EMK A;  4OP0 A;  4OVA A;  4JLG A;  3JCM e;  4M78 C;  4PJO A;  4A4K A;  5CO7 A;  4C8Q E;  3KUF A;  3OYH A;  2IG0 A;  2V8J A;  3CEY A;  3C12 A;  3PNW C;  2E64 A;  4VUB A;  5L8R E;  2XDD A;  5GAM g;  1VQ8 T;  2E6Z A;  3JCM J;  5CR2 A;  3HP9 A;  1YHQ T;  1WNL A;  5A0D A;  3WVE B;  2G3R A;  4Q5W A;  1RI0 A;  2XU8 A;  3NTK A;  2EYQ A;  2EWN A;  2M0O A;  2YLB A;  4QW2 A;  2O01 E;  1ZQ1 A;  3CC2 T;  3MET A;  1I81 A;  3JCM f;  3MEA A;  4RCB A;  5CQY A;  4C8Q F;  1YJN A;  1IRE B;  5FRN A;  1WPY A;  2DO3 A;  2DTO A;  2EJG A;  1N9S A;  3L2Z A;  2MWO A;  5GAO r;  2VGM A;  3ZBD A;  4M77 E;  5GAO m;  2MI6 A;  2ZPH B;  3OYF A;  4FT2 A;  3CCJ A;  1N27 A;  3CCS T;  3HQF A;  2XHC A;  1YIT T;  4IUT A;  4HCC A;  3SWN A;  2MMP A;  3P8D A;  1UEB A;  3CD6 A;  2P0K A;  2RJC A;  1KQ1 A;  4L6V 5;  1LNX A;  3EFS A;  4ZGE B;  4M75 E;  4NOY A;  5DY9 A;  4RCC A;  3OMC A;  3CME A;  4M7D B;  3ZFJ A;  1VQ9 A;  3UWN A;  3CPW S;  2YHT A;  1IZ6 A;  4BD3 A;  3GIB A;  4LDX A;  1OZ2 A;  5FU7 B;  3X25 B;  3OYI A;  3PIP A;  4JRP A;  2DIG A;  5GAM h;  5HY6 A;  3G4S T;  1KG1 A;  1NA6 A;  1VQO A;  3CCU T;  2DZC A;  3G7Z A;  1YIJ T;  4M77 F;  3RIR A;  3GF5 A;  4QQD A;  5GAN d;  2OAU A;  3OYL A;  5GAN j;  2F69 A;  3MEW A;  4XU0 A;  1NJI U;  3OS1 A;  2RI3 A;  3C95 A;  3QXE B;  2OTL A;  4BDZ A;  3PMT A;  2MAM A;  5LJ5 d;  5GAO l;  4MZT A;  5LJ5 j;  3ASK A;  4XTW A;  1NJI C;  3CCR A;  5LJ3 f;  5GAO p;  1RL2 A;  1U1S A;  2KSS A;  3DLM A;  3FEO A;  1JBM A;  1G3T A;  1YCY A;  3JRZ A;  1VQL A;  3LX7 A;  2FB7 A;  4DOV A;  4ZTF A;  5DLQ E;  2RK2 A;  1WID A;  2JN0 A;  4C92 B;  4ELY C;  1KQS S;  4PJO E;  2K2V A;  4NL3 A;  2LX9 A;  3KBG A;  2CS7 A;  3LYI A;  1P92 A;  2DEQ A;  2XG8 D;  3HL8 A;  2GQV A;  2K3X A;  1K8A U;  2VGN A;  5CKB A;  1M1G A;  3QPH A;  2PVG B;  3JCM W;  1VQM A;  3CME T;  3M58 A;  1KQS A;  2QI2 A;  3RER A;  3GLX A;  4FM4 B;  3G71 T;  1K8A C;  4A4E A;  2EFI A;  2XID A;  1H64 1;  3CBO A;  4A4G A;  4BY6 C;  2ZCF B;  5GMK h;  2DAQ A;  2XDB A;  3H6Z A;  3DB3 A;  4EMG A;  3ER0 A;  3JB9 F;  4M78 G;  3OS5 A;  2Y4X A;  4IUV A;  2O4X B;  4OB1 B;  3QSU A;  1M5Q 1;  4F7U B;  3LLR A;  1B34 B;  3F70 A;  2QA4 T;  3X24 B;  3JAM E;  5HK0 A;  1QVF S;  3ME9 A;  5M9O A;  2DVE A;  1VQP T;  1BYM A;  4XQ3 A;  3HFO A;  4M77 C;  3HPW A;  2CZ6 B;  1XQH A;  5GAN e;  1VQ5 T;  1R8O B;  3M5A A;  2R5A A;  3FIF A;  4NL2 A;  1JB0 E;  2YLC A;  3UDC A;  3H8Z A;  4BUG A;  1KHI A;  3V8L A;  5I21 A;  1G3W A;  1VUB A;  2VYT A;  4M75 C;  1S72 T;  1QVF A;  3AHU A;  2CGH A;  5LJ5 e;  1KQ2 A;  3GNF B;  2R5M A;  2EJF A;  5CKD A;  2RA2 A;  1QVP A;  2P0Q A;  2D0Q B;  4MMK A;  2C06 A;  3HSB A;  2RK1 A;  1NE8 A;  3QZ9 B;  1K9M U;  5GAN g;  1W4S A;  2CYZ B;  4QQG A;  4D6W A;  4N4I A;  4ZN3 A;  2CZ7 B;  4PLI A;  3GP8 A;  3RKW A;  4M7A E;  2WAC A;  2XD0 A;  3BW1 A;  5GAN 2;  1K9M C;  1YBY A;  3QYG B;  1BI1 A;  5LJ3 d;  3VJP A;  5I2S A;  3CCM A;  2FHD A;  5LJ3 j;  2E70 A;  4C8Q B;  2HD0 A;  4DOW A;  5GAO n;  4M7D C;  1QVG S;  3P8H A;  3HHT B;  4J5Y A;  1ZHI A;  5LJ5 f;  5HK3 A;  5GAN 5;  2DIQ A;  4HT9 A;  3TRE A;  3MO8 A;  4J8O A;  4XTZ A;  3JB9 D;  2GFU A;  3WVD B;  1Q82 U;  4BY6 B;  1JJ2 S;  4EMK C;  4RMO A;  3CC4 T;  3MP6 A;  4BAC A;  4DQ2 A;  2Y90 A;  4XTY A;  3M4Y A;  1N8R C;  4PJO C;  4EDU A;  2RO0 A;  3OSV A;  1Q82 C;  4A53 A;  3OS0 A;  5IAY A;  3P8B B;  1M1F A;  2X35 A;  4PL6 A;  2F5K A;  3MHX A;  4C0F A;  1JJ2 A;  2ZPG B;  5GMK j;  1WQW A;  2EJ9 A;  2ZPE B;  3NTH A;  4M77 B;  5FLX E;  2QEX T;  2R57 A;  1X01 A;  2LQ8 A;  3CBM A;  3OMG A;  4IKF A;  2EQK A;  1WJQ A;  4BB7 A;  5FRM A;  1UB4 A;  1VQK A;  3LW5 E;  2DZ9 A;  4J6Y A;  4M78 D;  4M75 B;  3I55 A;  3JCM g;  1BIB A;  5CK9 A;  5CAI A;  5GMK i;  4N4H A;  5D6Y A;  4BI3 A;  4C92 C;  5GAN 6;  2WSC E;  4OGE A;  5CQX A;  2M1H A;  3L2U A;  2B8A A;  4GY5 A;  3L2R A;  2XK0 A;  4YTL A;  2CZ1 B;  3PMI A;  3JB9 H;  5EG2 A;  2L8D A;  3DB4 A;  1KC8 U;  2K57 A;  2OTJ T;  1Y96 B;  4XTV A;  4M78 A;  2EQJ A;  1VQ4 T;  2XDP A;  4J83 A;  4QVD A;  3C4S A;  1KC8 C;  3BFM A;  5GAN 7;  3CCE A;  1GXI E;  2V8I A;  3MCA B;  3VYH B;  1NZ9 A;  2R58 A;  2RI5 A;  4I1K A;  1G3S A;  1PSE A;  1YI2 T;  5CIU A;  4BE2 A;  4LD9 K;  2KVQ G;  5LJ3 e;  3DKM A;  4C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...