4LDYA

Crystal structure of the dna binding domain of the g245a mutant of arabidopsis thaliana auxin reponse factor 1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
341
structure length
319
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEAMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRSMHIAVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Auxin response factor 1
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 79
structure length 319
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldyA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldyA02
4LDUA 1NA6A 4LDVA 4I1KA 1WIDA 3HQFA 4LDXA 1YELA 4LDWA 4LDYA
chains in the Genus database with same CATH superfamily
5KYYB 3PT9A 1YITA 2K4YA 8AT1B 5GMKm 2AIRB 2X4XA 1KJWA 3QO3A 1LNXA 4XU3A 4DOVA 1Y57A 4OB2B 3CC4Q 1AWOA 1VQKQ 3QKJA 1RUWA 1WFWA 2QQBA 4R0KA 4PJOC 1WHHA 2H8HA 2QQRA 4C92D 1N6AA 3H9NA 1I81A 1N0GA 3VU3C 3RKXA 3GIBA 4LDVA 2KDSA 4MMLA 1YBYA 4CC2A 1RLQC 2DRKA 2XIDA 5GAN6 3OW2S 5GANd 3RKWA 2DTOA 1WXTA 3OBYA 3I35A 5DM7R 2LX9A 3GOXA 4ESRA 1FYNA 1GFCA 3L2ZA 1K8AU 1OOTA 1O75A 4CRIA 3HL8A 1UGSB 2QEXQ 3JB9H 4R56A 1QKWA 2RJEA 1YCYA 4OMLA 4C8QC 4F17A 3EG2A 4M7DB 4K11A 1QVFA 2KXDA 2HL5C 4M78C 1Q82R 1VQLT 2DL4A 2G6FX 4Q5WA 3S6WA 3PVQA 1SKUB 2MIOA 2YUQA 4YTLA 3X28B 1VIFA 4X9CA 4QVZA 1VQ4T 2HQHA 4OMPA 5L8RE 5GAMd 4XU2A 1ABOA 3M56A 3CPWS 1ZA2B 1A0NB 5GMKj 2ED0A 1ZSZB 2MWPA 2RHZA 3ZBDA 5GMKe 4LXCA 2GTOA 3JB9D 2EQIA 1ZA1B 1QCNA 3JB9I 2LNVA 2HSEB 1Y0MA 3AT1B 2EKOA 3L42A 2FL7A 3SHWA 3CCRA 2NYSA 3I55Q 1AHJB 3IQLA 4EDUA 1SPKA 3RKYA 1UGQB 2HL3A 4BUGA 1PC0A 4D6WA 1G3WA 4E2FB 1W4SA 3QWYA 4F7UB 3VYHB 1BYMA 3TEEA 3P8BB 1J3TA 2L0AA 3PIPA 1VQ9Q 5FRNA 3QYHB 1MMGA 3G6ET 4J7FA 4M7AD 4E7JA 5FROA 4IIMA 2DL5A 2M02A 1NJIR 5ECAA 3EGXB 5FRMA 2DE0X 4BI8B 2HZYA 4KGZB 3CMET 2CP2A 1FMVA 4VUBA 1WXUA 2L2PA 2M0YA 3L2VA 4L59A 2R5MA 1Q86R 1RI0A 2QI2A 1E7OA 3OS0A 2RNAA 4M7DF 1VQ8A 5D7UA 3EGDB 4M75D 3G1JA 1JU5C 4N4HA 2KRNA 2DIQA 1NE8A 3NFCA 4C5GA 1KD1R 4DBHA 5HK3A 1RAAB 4JRPA 1Q81R 3CXCP 4WTOB 1N0FA 4FL6A 4RTVA 3JB9G 2OTLT 2ED1A 3V7CA 7AT1B 2XHCA 2JJ9A 1BCMA 2YDLA 5KYXA 2DEUA 1YIJA 2VGNA 1M90C 1WQWA 4A4KA 2E5QA 1JXMA 4IURA 1D0XA 1KQ2A 4C92B 4OP0A 2YWWA 1KC8R 2KRMA 2CP0A 2D8JA 2F5KA 3CCEA 3QJYA 3M0PA 4F7UF 2KROA 1M8VA 1VQPA 1YHQT 2HKQB 2QEXT 3REBB 4RTZA 3SWNC 1V1CA 1WJSA 2K5FA 2VASA 1FWZA 4M7DE 2GBQA 5J39A 2JUFA 2KYMA 2FHDA 1K8AR 1D0ZA 3A5ZB 5IXFA 9ATCB 4M78A 3JCMQ 5IXBA 2EQKA 2K3YA 2L8DA 2MPXC 5GJWB 4IUVA 5GANh 1ZBXA 1K9MU 2C0OA 4R55A 1VQ6Q 3UPUA 1UE9A 2QAZA 2DFUA 1T3LA 2QQSA 4XTYA 4M75G 4FM4B 3OYGA 1E6HA 1PG5B 2ZPHB 5GAN7 2DERA 1X27A 1Q82C 4C5EA 5EC7A 2DBMA 4XQ3A 3JCMd 3M9QA 4BE0A 3PMIA 4FW1A 3CPWA 1G3SA 3G71A 2DEQA 4F7UE 3QDRB 1N9SA 1B3QA 2DD5A 3GF5A 5GAMh 1VQKA 1M1KU 1UGVA 5I11A 1TTHB 3FB9A 3C95A 2A08A 1WX6A 2OI3A 2J05A 2XDBA 1TWBA 1UUEA 3VUBA 2JXBA 2GQVA 3MEWA 5GAOr 1YWOA 4C92F 2FRYA 4J9DA 5CK9A 4E7HA 2FPFA 4M7AB 3KXTA 1ZHIA 2EJGA 1QW1A 2L89A 3CC7A 4DOWA 1WIDA 4QQDA 3JV3A 5KCOA 2EYWA 1XJWB 1X75C 1Z9QA 1M2VA 3HRSA 2OX7A 2ABLA 1C1AA 2DJZA 2HMAA 1NM7A 3X26B 3CCVQ 3GP8A 1I5OB 1YNZA 1WLPB 1QVGP 2LQ8A 5CVIA 1BB9A 3H0HA 1IZ6A 1KG1A 4DEYA 2OTJQ 2A3LA 1YITQ 1TH7A 5J26A 1NJIC 3VRYA 2DETA 4OGCA 1ZUUA 2RQTA 1AWXA 1Q86C 4HCCA 2XK0A 2YHTA 5A2QE 1UJ0A 3I55A 4BDYA 1OQKA 1BIAA 3JB9F 4C92E 2Y90A 5IHNA 2GQIA 2JM9A 4PJOD 1QP2A 2E70A 2CP5A 2ZPBB 3HRTA 1KD1C 2CUDA 1Q81C 1YFNA 2ZCFB 4BE1A 3URGA 2EAYA 3NMZC 1VQ9A 5DLQE 1YI2T 1B34A 1XNIA 3RNJA 2FVUA 3LW5E 4NL3A 1X6OA 5DLOA 1GBRA 4Z8AA 5FWCA 4PFZA 3PNWC 3SWNA 4LUEA 1M90U 2QDYB 3CCJT 2DK3A 4HVWA 1NLPC 4M7AF 3TSZA 4FT4A 3EFSA 1M3CA 1PNJA 1KC8C 4DBFA 4M78D 2BE9B 3UDCA 1PD1A 4PJMA 4EPCA 1VYVA 3CCLQ 2WSCE 5GAOn 1MV0B 2EYYA 3MO8A 4PKCC 1ACMB 3CCRQ 4LD6A 1PHTA 1UHFA 1K8AC 4OVAA 2LCSA 4BD3A 1AD5A 1X2QA 2IPOB 1YJ9T 1XQHA 3LYIA 3OYJA 3MP8A 4RKUE 3RUXA 4WCIA 5IHKA 2E10A 2C0TA 3E1SA 4JZ4A 5LJ3e 2QA4A 4MZMA 2H3JA 1WDXA 1UEBA 1YWPA 2RK2A 3FIFA 1LCKA 1RAFB 4RCBA 4PJOG 1M1KR 4ORZA 1OPLA 2J6KA 5D6XA 3FJPA 4PK4A 4ZGJB 4M7AE 4KUIA 2LNHB 1WGSA 2IVWA 1CSKA 1WHKA 2E41A 3JCMh 2BE7D 2QG9B 2RF0A 2ATCB 4ZNXA 1W6XA 2MI6A 2RD1A 2M16A 1M1GA 3CCQA 3P8HA 3QBYA 3VKIA 2LT4A 1PWTA 4BY6C 2OAUA 3CCST 4A53A 4C8QG 5FU6C 3LGLA 1VQNA 4M78G 2A36A 2DLPA 4FSXA 2RB6A 4RG8A 1I8FA 2BZ8A 4Z02A 1JJ2P 4M75E 2C06A 3V7RA 1VQ6A 3HPWA 5FLXE 4AMCA 2KVQG 2KNBB 1DJ7B 2M51A 1H641 3LGFA 2DD4A 2K2VA 3LWIA 1W2BS 1SHFA 2DILA 2CZ7B 2P4RA 1GCQA 3NGPA 3JCMP 3VS1A 4HKEA 4IUUA 4IIOA 2HD0A 2PVDB 5KYXB 2D0QB 1YJNA 3ULRB 2EVRA 4GLMA 3CCEQ 1MGQA 2CREA 3KBGA 5CKBA 3M59A 3VS6A 4AG1C 4Y28E 1X69A 1D0YA 3MJXA 1Y71A 3EGUA 2EJ9A 4M77C 1JBMA 1QWFA 1UTIA 2K3XA 4JLGA 5I21A 4I1KA 4J9GA 4Y92A 4MDXA 1Q86U 1RAHB 3META 4O6JA 5D6YA 1M9SA 3ASKA 2E5KA 4A63B 3CXCS 5CQXA 3CC2A 3EFRA 2DBKA 2AZVA 1U5SA 1WXBA 1NYGA 4XTUA 1X01A 1KD1U 1VQOQ 1GXIE 2MAMA 4HXJA 1WIEA 1Q81U 2CKKA 2AHJB 4M75A 3CCRT 2MF2A 1KQSP 2M0OA 1S72T 3MP6A 2FZCB 1BKBA 4PJLA 5CIUA 1UECA 2RI2A 2X3XD 3G71Q 1MMDA 3S3NA 4JRIA 1HJDA 2D0NA 4EMKC 1UGRB 2V8IA 3VS4A 2K5LA 4IUQA 1KC8U 1JO8A 1ZUYA 4JZ3A 3TREA 2O9VA 3FLGA 4J9BA 4JS4A 2RHUA 2AZSA 5CAIA 1D3BA 2DYIA 1VQ7T 4KH0B 1K9MC 2DKGA 2COWA 2DL3A 3UT1A 5HCKA 3OMGA 1M2OA 3OY9A 3UATA 2GTJA 3CC7Q 3MEVA 4J5YA 4J9EA 3KFVA 4IUTA 3M0UA 3EAEA 4FT2A 1SSFA 1G8XA 4V2SA 1T0HA 2M9UA 1VQ8T 1UGPB 3OQ5A 4C0ZA 4C0DC 2DMOA 4DBQA 4BB7A 2LMJA 1M1KC 2K7AA 3JSCA 3M0QA 3OMCA 4KRTA 3OB9A 4ZTFA 3QDFA 2JMAA 2YRCA 2KBTA 4MDWA 1BI2A 2HBPA 3CCMT 3QUIA 3CCLA 1QVFP 3E19A 2HBWA 3PGGA 1YIJT 6AT1B 4QQ6A 4E7IA 1OX9A 2PUKB 2KGTA 4OMMA 2A28A 4HCKA 2QTVA 1M1FA 1QMCA 3CCET 2A7YA 2VYTA 3A8OB 4BACA 4JLIA 1I07A 2BZXA 4CI0C 2FYKA 2D1XA 1VQPT 4PJOE 1W2BA 4N0AC 1RLPC 4M77A 1WYXA 4C5IA 5AT1B 3UF4A 3E9FA 4JS5A 1IRXA 1IHWA 5GAN2 1PRMC 3CCUA 2K3BA 1H8KA 1M30A 2KEAA 5GAOp 3E2UA 4AFQC 1M3BA 1OPKA 1W1FA 2RM4A 3SWNB 3GBQA 4JUVA 1ZX6A 1R8OB 4M78E 1G3YA 2LJ0A 2K2MA 1HD3A 3N5BB 4XU0A 2EQMA 2JN0A 1I0CA 5FW9A 3VS7A 3ZI5A 1Y07A 2KSSA 5M9OA 3SB2A 2QDLA 2RJDA 4D8KA 3RERA 5CO7A 3OYLA 2DNUA 3HQFA 2R5AA 3CC4T 1ZSZC 2KR3A 3GNGA 1UJYA 2HEQA 1Z9ZA 4RTWA 1VQKT 2CP6A 2RQUA 2QA4Q 2SEMA 4BE2A 1VQLA 1GCPA 2LQWA 3A98A 4L5GA 5HY6A 1RABB 2RHYA 1VQ4A 3RMSA 2DXTA 4EMKA 3GPLA 4QW2A 1B07A 4PJOA 5IHIA 5LJ5h 1CKBA 2X51A 2P0KA 3BDUA 1FMKA 1K4US 3BDLA 2GNCA 2YSQA 4MZPA 2HCKA 3LLRA 5KYWA 2QYZA 4XK8E 2AT1B 2E6ZA 5HK0A 1ZQ1A 1WJRA 5A0DA 3CCQQ 3CEYA 1P92A 1ZUKA 1AVZC 2XD0A 4RG2A 2QK0A 2CT3A 3OW2A 1Y7XA 3VRZA 3ZFJA 1VQNQ 4C8QA 4J6WA 4AFZC 1M27C 3PTAA 1HXDA 5GANe 3FC3A 5CKFA 1C0MA 2DRMA 2P4TA 3HFNA 2E4HA 5KCHA 1H92A 1PRLC 1TG0A 2LCCA 5GJVB 2ROTA 1M3AA 1OU9A 4QT7A 2XDDA 2GF7A 2K5IA 3C0CA 1IB8A 2RMOA 4TVRA 1GL5A 1VQOA 1RAIB 2LRQA 4QKUA 5C0MA 3U23A 3TU4K 3I55T 2JZ2A 3INZA 3ME9A 3R6NA 3WVEB 2C1LA 1YJWQ 1NPRA 4HVVA 1YJNQ 3ER0A 3M5AA 3OS2A 5GAMe 1RACB 2KT8A 4UC4A 2V1RA 4LUDA 1VQ9T 4J7IA 4QQGA 1NEBA 1ZLMA 2HNIA 1LJOA 1U06A 5D6WA 5FU7C 1LVKA 5CKHA 2PUOB 4OF1A 1OULA 3G7ZA 4C92C 1YP5A 3OYCA 4JJCA 2ZPGB 3CPWP 2RK1A 4M77D 1YN8A 1N27A 4KULA 2BIVA 4E7KA 3FDRA 1VQMA 1KFZA 1JJ2S 3VS5A 3UA6A 3CC2Q 3OYBA 3DLMA 2JTMA 4C5HA 1MHNA 3SDZA 4DEXA 1F1BB 1AT1B 4J83A 2JVVA 3NTIA 2PU9B 2EW3A 2FO0A 5CKEA 3R6OA 3H8ZA 1RL2A 2WSEE 2EYZA 3L2UA 1KSWA 4M75B 1RAEB 4XTVA 1GRIA 4DQ2A 4J9IA 2I0NA 3M57A 4IKFA 1CKAA 1SRLA 2HKNA 4JRQA 2LTOA 2PVOB 1K0XA 4FU6A 2CP3A 1B7TA 3EHRA 1D1AA 3V8LA 2QXFA 3MEAA 2DPPB 3G4SQ 1JRIA 2DTHA 4B9WA 3VYGA 1QLYA 1WHMA 3ZL7C 4ZGEB 1SG5A 3EH2A 5FWBA 3O8VA 4NOYA 2CS7A 1SHGA 1D3BB 2K6DA 2YUPA 2EQUA 4QVDA 4M4ZA 5CKDA 5CR2A 4X1VA 3H0IA 2KI7A 3BY7A 3Q1JA 4M77G 3RR6A 2KAFA 2JS2A 4CC7A 4M7AC 1KQSS 2NUPA 1NYFA 2ZPFB 1BIBA 2YRVA 1VOMA 3M53A 5KYUA 2FB7A 4J9CA 4A4GA 4C8QD 1JEGA 3RBBB 2F2VA 5GAOl 1VIEA 1HYOA 5CCAA 1VQ6T 1EFNA 2AK5A 2DZCA 2E1HA 1U3OA 4AFSC 2JMCA 2JTFA 1QKXA 2MK5A 3OYMA 4L6V5 3CMAA 5FU6B 2GGRA 2YXYA 3M54A 5LJ3g 4LD9K 3JAME 3MP1A 3MKDA 4OGEA 2DL7A 4M75F 2PNIA 5LJ3j 1NBEB 4JPBW 3L1AA 3OS1A 4E6RA 1PD0A 2P0QA 3RIRA 1SRMA 2KY9A 2VXFA 4HT8A 2LQNA 4JJNK 2VKNA 4RTYA 2KYBA 3BW1A 4FYXB 2X4JA 4OMQA 3SEMA 1UDLA 3JCMe 2QTXA 4LE9A 3CCUQ 2ZPEB 2EPDA 1H3HA 1Q7YU 1WQ7A 4M77B 2ESWA 1SSHA 3LWHA 4GBQA 4ZN1A 2O88A 3QWXX 3FEOA 3CBPA 2CSQA 3CCVT 2ZPIB 3UWNA 2EFIA 2OTJT 2XICA 3AHUA 3RDVA 2NUTA 2VB6A 1YITT 3JCMX 3DLLA 4D8DA 2E3IA 2DA9A 2O4XA 4XAXB 2JS0A 1MMAA 3DB4A 2J6FA 1YI2A 4OMNA 2P0PA 5KH6A 1T0JA 1NLOC 2DX1A 3OSSC 1NG2A 3TVTA 3HKSA 1PKSA 1WZOA 3MCAB 1VQLQ 4E7LA 4KUDK 4FSSA 2A0FB 1I4K1 1FX7A 3TQ7P 1PKTA 1NA6A 1VQ4Q 2HDAA 3HTRA 4Y91A 1QCOA 2FPEA 4FYWB 1YJWA 4DBRA 3V8KA 2OJ2A 2GFAA 2DAQA 4EMKB 1TUGB 2YLBA 2EIFA 3I56A 4PJOB 2IIMA 3I5SA 3VV0A 2E6NA 2ECZA 4NS5A 2QGGA 3P8DA 2LQKA 3OSVA 1VQ5A 1BI0A 1O9SA 1JQQA 1R77A 2EBPA 2O31A 4QVCA 5KYWB 1YJ9A 2VVKA 2W0ZA 3M0TA 1OX8A 3PVLA 4BI3A 3DB3A 4Z89A 3T9NA 2Y4YA 3A8GB 3QIIA 4KH1B 1N0EA 4II1A 5KYNA 3G6EQ 3VS2A 2X3WD 1K73U 1V76A 3CCLT 5KE3A 4C8QB 2DXBA 3C94A 4M78B 5GAN4 2YT6A 3SFMA 2Y4XA 4OMOA 5LJ3f 2P84A 2EYXA 1G2BA 2GFUA 2F1LA 3CD6A 5HKCA 2RHIA 4ME7A 3EHQA 1GFDA 1BK2A 2C0IA 2A37A 2CP7A 1ARKA 2RJCA 4ATOA 2YUNA 4RUGA 3L2WA 4E7SA 1RADB 4LDWA 3CCSA 4A4FA 1WHGA 1WI7A 2DVJA 1NZ9A 3CBOA 4MZTA 3CQTA 2L3RA 3G4SA 1MV3A 1PM3A 3KUFA 2DL8A 2V1QA 3WVDB 3OBWA 3CCUT 4IUPA 3L2QA 2OTLQ 2Z0WA 4F04B 1VQMQ 1EX4A 3CPFA 4F7UG 3F70A 4M77E 1XOVA 2RI5A 4PJOF 4RTTA 1R0BG 3NTKA 4AG2C 5GAOq 4XTWA 1KQ1A 1MNDA 1Q7YR 2O2OA 4J9FA 3OYEA 1NPPA 3QPHA 3JCMW 3EG0A 3V8JA 3VS3A 1M2VB 4B6MA 2M1HA 2RHXA 2RI3A 1YHQQ 2F69A 3MEUA 4J6YA 3L2RA 3JCMJ 1EZZB 3TSWA 4FYYB 3VUZA 4C8QF 3HSBA 4M78F 1K76A 2FPDA 2BTTA 4GLKA 3JB9J 2WSFE 1ABQA 2RPNA 3BFMA 2J6OA 1IGUA 2EQJA 2EGCA 4N4IA 2FG0A 4P5NA 3QSUA 4C0GA 5GMKh 1QP3A 1PSEA 5CQYA 1QCFA 4OB1B 3UA7A 1Q95G 2LT1A 2QASA 3S3OA 2RN8A 1N8RU 1S72A 1TS9A 4X9DA 2MMPA 3DKMA 5IN1A 1QVGS 4GY5A 2CZ0B 2WACA 4ELZC 2F2XA 2V8JA 1PCXA 4C92G 1B34B 1YELA 3VJPA 4JDSA 2V26A 3JRZA 3X24B 2HAXA 1W2BP 3PE0A 1VUBA 2NUPB 4M7DC 2J7IA 2MWOA 4C8QE 1VQOT 4N4GA 1K9AA 2RQRA 3FRNA 5KYUB 3EH1A 3X20B 1VQ7A 2LP5A 4FCYA 2BKDN 1TSFA 1QVPA 1C6VX 3CMAQ 2L3PA 3D7SB 1K73R 2FZGB 3THKA 2CZ6B 1K1ZA 4CC4B 3CXCA 4PL6A 4PFOA 2DYBA 3JCMc 2E3HA 4XTXA 3G71T 1OZ3A 3A8HB 2B86A 2KE9A 5LJ5g 3MPUB 4PJNA 3RESA 2VC8A 1D1CA 4ANJA 4LDXA 2R58A 2AKLA 2HQXA 3HHTB 2QQ9A 4HT9A 2CGHA 2LZ6B 5LJ5j 2VUBA 2K79A 1Y96A 2IG0A 2AKKA 5LJ5e 1OEBA 3OYFA 2JW4A 3J81E 1X6GA 3A8MB 1TU0B 1VQMT 3CCMA 3OYDA 3CC7T 1RAGB 2DTIA 2DIGA 4LDYA 4RCCA 3GNFB 4FIBA 2L5QA 4OB0B 5FU7B 4BDZA 5GANg 2PZ1A 1YCSB 1KIKA 2CT4A 4JJBA 3C12A 3A8LB 3JCMb 3GLXA 5GANj 1I1JA 2V8KA 4M7AG 2W10A 1W70A 3G6EA 1YI2Q 2VV5A 1WHLA 2NUTB 4J6XA 5KE2A 1MNEA 2O4XB 3JCMV 3EFOA 3OA6A 5GAMg 1BI3A 3OW2P 3CCJQ 2RA2A 3QZ9B 4PNOA 2H3EB 3EG9A 2I2LA 1BBZA 1Q7YC 4O5VA 3CMEA 2OAWA 5LJ3d 5GAMj 2GCXA 2L3QA 1BCOA 5KYYA 2MCNA 4BI4A 2K57A 4CC3A 5C6SA 2YRDA 3I56Q 3EG1A 1UFFA 1X6BA 3NPFA 2XU8A 4F16A 1LPLA 1VQ5Q 3LH0A 3H41A 2LC4A 1YJ9Q 2LJ1A 2PVGB 2B8AA 3LX7A 3CC4A 4N0AA 2CSIA 3V7SA 3NHNA 2OTLA 1WA7A 3O5ZA 1N8RR 1UB4A 1N5ZA 4PJJA 5I22A 3C4SA 4KGXB 1AWJA 1V29B 3FJ5A 1GBQA 2JNGA 4XU1A 2F2WA 2KRSA 2EGAA 4C0FA 1X2KA 2E65A 1S1NA 1TUCA 3M0RA 4ELYC 3CMAT 2D8HA 2CH4A 1QVGA 4HCBA 2KMTA 4M7DA 2BUDA 3SD4A 2NWMA 2EKHA 4ZGDB 1QQJA 1M8MA 3CD6Q 5GAN8 3OYHA 1YHQA 2HSPA 3H0FA 3M4GA 2XI9A 3HP9A 4F14A 3OYIA 2QGFB 4MMKA 5A0GA 2QEXA 2X9HA 1HK9A 4RTUA 1I5LA 2ZZDA 5LJ5f 3S3MA 2JM8A 2DXCA 2VXEA 2QA4T 1G3TA 3LH5A 2XDPA 4JJDA 2YUOA 3CCSQ 4KT0E 1ZSZA 3PIOA 3OYKA 2X4YA 2RO0A 2KK4A 3NTHA 1E6GA 4A54A 4HA8A 2KQWA 2JTEA 4PLLA 1K73C 2JOYA 4LNPA 3PMTA 3TCJA 1VYTA 3HFOA 1GCQC 1PSFA 3X25B 2DM1A 3J7AF 2K9GA 4A4HA 2DZ9A 1LOJA 2KT1A 2XMFA 4F7UA 5GANf 2F5TX 1MMNA 5EG2A 3CCQT 4EMGA 3H6ZA 1G5VA 2LDMA 3M58A 2G3RA 3CBMA 1VQNT 3M55A 1OI1A 2XG8D 2O9SA 2RQWA 2PTKA 3EG3A 3QZ5B 2COYA 2QQAA 2PQWA 3EGXA 2ZGWA 2L3SA 4WF2A 3VS0A 3OYAA 4RMOA 2FZKB 3ZEHA 5GAMf 1U8RA 1U1TA 1FXXA 1IGQA 2LVMA 4BY6B 4XTZA 5L23A 1SEMA 1SF9A 1ZBJA 5LL6S 5IH2A 2J06A 1TXQA 2LJ3A 4E7ZA 1AZGB 2VWFA 3QYGB 3EGDA 4A4EA 2ROLA 1YJWT 1QWEA 4M75C 1T3SA 1YJNT 4KBMB 1WNLA 2FEIA 1X43A 1WHJA 1D09B 2MOXA 4J8OA 3I56T 4HVUA 3QG1A 3MHXA 3RMQA 5GAOm 1K9MR 1ZSGA 5DY9A 1OV3A 1VYUA 3JCMg 1VQ5T 3BE3A 8ATCB 1R0CB 2DXUA 2DO3A 1S72Q 5J3BA 1OZ2A 2CH4W 1EIFA 1BU1A 2MYSA 5IAYA 5GMKi 1IHVA 4C92A 5I2MA 3A1PA 3CC2T 4AT1B 2LX7A 5LJ3h 3E9GA 2KXCA 2DF6A 5AYFA 2RQVA 2SRCA 2D9TA 1QVFS 5I2SA 1WPYA 2X35A 4KGVB 1G83A 1VQ7Q 1TOVA 2EWNA 4HCZA 1IREB 2VGMA 1M5Q1 4OMFB 3PFSA 2DJQA 2NLUA 1TUDA 4EIKA 2NUZA 2ZAEA 3CD6T 4OB3B 1Q82U 4M7DD 3REAB 1JJ2A 1IXDA 5GAN5 3QXEB 1UHCA 1BI1A 4PLIA 1XTDA 2EJFA 5GAN3 4EMHA 4ZTJA 1N8RC 3J80E 1VQ8Q 1UG1A 2ENMA 4E47A 2BZYA 4B9XA 2YLCA 4FYVB 1JXOA 3CCJA 4ZN3A 4NL2A 4DA4A 3QJ6A 3G4ST 1U1SA 1AEYA 2EGEA 1JB0E 1OYXA 2E64A 3CCMQ 1YIJQ 1Y96B 4LDUA 4Z88A 2RJFA 5A0LA 2E12A 3HRUA 3M0SA 2LCLA 2CZ1B 1WJQA 2D6FA 3I9QA 2FRWA 4RTXA 2CUBA 1MUZA 1IO6A 3I5RA 1VQPQ 2R57A 1KHCA 2CYZB 1NJIU 4M7AA 2O01E 5IT9E 2X4WA 1K0SA 3WXMB 1N9RA 4M77F 1OU8A 2RH2A 1AOJA 3OYNA 2COZA 3OYYA 5GMKl 4M7DG 4AFUC 2DVEA 1HSQA 1AZEA 1KHIA 4PFPA 1KQSA 3M4YA 4J9HA 1VA7A 4C0DB 2EYQA 1AWWA 4FW2A 3CMEQ 1KK7A 1M90R 1H3ZA 3OS5A 1RI9A 3EFOB 4JRKA 1M4ZA 1NEGA 3EG9B 2JT4A 3CCVA 3JCMf 4X34A 1D1BA 4LN2A 3QHSA 1FMWA 5LJ5d 2OTJA 2CDTA 2XKOC 2HQEA
chains in the Genus database with same CATH topology
3CXCA 4RCBA 3OYBA 3DLMA 2JTMA 3PT9A 4PL6A 2K4YA 4C5HA 1YITA 3JCMc 1MHNA 4XTXA 4PJOG 5GMKm 3SDZA 3G71T 2X4XA 3QO3A 1OZ3A 1LNXA 4XU3A 4DOVA 3A8HB 5D6XA 4J83A 3FJPA 4OB2B 4ZGJB 5LJ5g 2JVVA 4M7AE 4KUIA 3QKJA 3NTIA 3RESA 2QQBA 1WGSA 2IVWA 2PU9B 2VC8A 4PJOC 2QQRA 4LDXA 4C92D 2R58A 2HQXA 3HHTB 1N6AA 2E41A 5CKEA 3JCMh 3R6OA 1I81A 2QQ9A 1RL2A 3H8ZA 4HT9A 2CGHA 3VU3C 2VUBA 5LJ5j 2WSEE 3RKXA 2MI6A 3L2UA 1Y96A 3GIBA 2IG0A 2RD1A 4M75B 2M16A 4XTVA 4LDVA 2KDSA 1M1GA 5LJ5e 3OYFA 4MMLA 1YBYA 3P8HA 3QBYA 3VKIA 3CCQA 2XIDA 2LT4A 4DQ2A 5GAN6 3OW2S 3M57A 4IKFA 3J81E 5GANd 3RKWA 4BY6C 2OAUA 2DTOA 3A8MB 1VQMT 4JRQA 3OBYA 3CCST 4A53A 2LTOA 3OYDA 2PVOB 5DM7R 3CCMA 3CC7T 4C8QG 5FU6C 2LX9A 2DTIA 3LGLA 4FU6A 2DIGA 4LDYA 3GOXA 3L2ZA 4M78G 1K8AU 1VQNA 4RCCA 4FSXA 3GNFB 1O75A 2RB6A 4CRIA 3HL8A 4FIBA 1UGSB 2L5QA 4OB0B 4RG8A 5FU7B 3V8LA 1I8FA 4Z02A 4R56A 4BDZA 2RJEA 3JB9H 2QXFA 3MEAA 2DPPB 4M75E 1YCYA 5GANg 1JRIA 2C06A 3V7RA 4C8QC 1VQ6A 3HPWA 2DTHA 4B9WA 5FLXE 1QVFA 4M7DB 3C12A 4M78C 3VYGA 3A8LB 1VQLT 2KVQG 4Q5WA 3S6WA 1DJ7B 3JCMb 4ZGEB 1H641 3LGFA 2DD4A 2K2VA 3GLXA 3LWIA 1W2BS 4YTLA 3O8VA 4NOYA 5GANj 3X28B 2CS7A 1VIFA 4X9CA 1D3BB 4QVZA 1VQ4T 2V8KA 2EQUA 4QVDA 5L8RE 5CKDA 2CZ7B 4M7AG 5GAMd 4XU2A 5CR2A 3M56A 3JCMP 4HKEA 4IUUA 3CPWS 3G6EA 2HD0A 2PVDB 2VV5A 2D0QB 1YJNA 5GMKj 3BY7A 3Q1JA 4M77G 2KAFA 1MGQA 2MWPA 2RHZA 4J6XA 3ZBDA 5KE2A 5GMKe 4M7AC 1KQSS 2O4XB 3JB9D 3KBGA 5CKBA 3JCMV 3M59A 2ZPFB 1BIBA 2YRVA 3M53A 5GAMg 1BI3A 2LNVA 4Y28E 3JB9I 3OA6A 2FB7A 1Y71A 3L42A 2EKOA 2RA2A 2FL7A 3QZ9B 4A4GA 4PNOA 4C8QD 3CCRA 2EJ9A 4M77C 1JBMA 5GAOl 2I2LA 1Q7YC 1VIEA 2K3XA 5CCAA 1VQ6T 4O5VA 1AHJB 4EDUA 3CMEA 3RKYA 2DZCA 2E1HA 4JLGA 5LJ3d 5GAMj 1UGQB 2GCXA 4BUGA 4D6WA 1G3WA 1W4SA 5I21A 4I1KA 4MDXA 2JTFA 4F7UB 3VYHB 4BI4A 1Q86U 1BYMA 2K57A 3META 4O6JA 5D6YA 1M9SA 3ASKA 3TEEA 3OYMA 4L6V5 5C6SA 3P8BB 5FU6B 3CMAA 3M54A 3CXCS 3PIPA 5LJ3g 5CQXA 3CC2A 3EFRA 3QYHB 5FRNA 3G6ET 2XU8A 4LD9K 4J7FA 4M7AD 3JAME 3LH0A 3MP1A 4E7JA 5FROA 4OGEA 4M75F 4XTUA 5LJ3j 1X01A 2LC4A 1KD1U 2PVGB 1GXIE 2B8AA 2MAMA 3LX7A 3CC4A 3L1AA 3OS1A 2CKKA 2AHJB 4M75A 4N0AA 3V7SA 1Q81U 3CCRT 2OTLA 5FRMA 2P0QA 4BI8B 2MF2A 1UB4A 3RIRA 3CMET 2KY9A 2VXFA 2M0OA 4HT8A 4VUBA 4JJNK 3C4SA 3MP6A 3L2VA 1BKBA 1S72T 4L59A 1V29B 2R5MA 2JNGA 4XU1A 3BW1A 1RI0A 5CIUA 2QI2A 2RI2A 4C0FA 3OS0A 2E65A 2X4JA 4M7DF 3S3NA 4JRIA 1VQ8A 4ELYC 3CMAT 4EMKC 1QVGA 4HCBA 2V8IA 2QTXA 2KMTA 1UGRB 2K5LA 4IUQA 3JCMe 4M7DA 2BUDA 4M75D 3SD4A 1KC8U 2ZPEB 4N4HA 3TREA 4ZGDB 1Q7YU 2DIQA 3FLGA 1NE8A 3NFCA 1WQ7A 5GAN8 4C5GA 4M77B 3OYHA 4JS4A 1YHQA 3M4GA 2RHUA 5HK3A 2XI9A 4JRPA 3HP9A 5CAIA 3OYIA 4MMKA 5A0GA 3LWHA 2QEXA 1D3BA 1HK9A 1I5LA 2ZZDA 4ZN1A 5LJ5f 1VQ7T 4FL6A 3S3MA 1K9MC 3FEOA 2DXCA 2VXEA 2QA4T 3JB9G 2DKGA 3CBPA 3CCVT 2OTLT 1G3TA 2ZPIB 3V7CA 2XDPA 2XHCA 3UT1A 3UWNA 3OMGA 3OY9A 2EFIA 2OTJT 2XICA 2VGNA 1YIJA 1M90C 3AHUA 4KT0E 3MEVA 4J5YA 1WQWA 3PIOA 1YITT 3JCMX 3DLLA 2O4XA 4IUTA 4XAXB 4FT2A 3EAEA 2X4YA 3OYKA 2RO0A 1SSFA 3DB4A 2E5QA 4A4KA 2KK4A 4IURA 3NTHA 1YI2A 2P0PA 4A54A 5KH6A 1KQ2A 4HA8A 4C92B 4V2SA 2KQWA 2M9UA 3OSSC 4OP0A 1VQ8T 3HKSA 1UGPB 4PLLA 2F5KA 1K73C 3MCAB 2JOYA 3QJYA 3CCEA 3PMTA 3TCJA 3OQ5A 3HFOA 4E7LA 4KUDK 4C0ZA 1PSFA 3X25B 3J7AF 4F7UF 4A4HA 1I4K1 1M8VA 4C0DC 1VQPA 2DZ9A 1YHQT 1FX7A 1LOJA 4BB7A 1M1KC 4F7UA 3JSCA 5GANf 3OMCA 2QEXT 2F5TX 1NA6A 4Y91A 5EG2A 3CCQT 3OB9A 4EMGA 3SWNC 4ZTFA 1WJSA 2K5FA 3H6ZA 1FWZA 4M7DE 1G5VA 1YJWA 4MDWA 1BI2A 2JUFA 5J39A 2FHDA 2HBPA 2LDMA 3CCMT 3M58A 3QUIA 3V8KA 3CCLA 3A5ZB 2G3RA 3CBMA 3E19A 3PGGA 2GFAA 1VQNT 3M55A 1YIJT 2DAQA 4QQ6A 4EMKB 1OI1A 2XG8D 2YLBA 4E7IA 2EIFA 3I56A 4PJOB 4M78A 2PUKB 3QZ5B 3JCMQ 2EQKA 2K3YA 2QQAA 2PQWA 3VV0A 2L8DA 2E6NA 2ZGWA 4NS5A 5GANh 4IUVA 3P8DA 1ZBXA 2LQKA 3OSVA 1K9MU 4WF2A 1BI0A 1VQ5A 1M1FA 4R55A 3OYAA 1JJ2A 3CCET 1O9SA 2A7YA 4RMOA 3UPUA 2VYTA 3A8OB 3ZEHA 4BACA 4JLIA 5GAMf 2QQSA 1U8RA 1U1TA 4QVCA 1FXXA 4XTYA 1YJ9A 2LVMA 4M75G 4BY6B 4FM4B 4XTZA 2FYKA 4BI3A 4CI0C 3DB3A 3OYGA 1VQPT 3T9NA 5LL6S 2Y4YA 2ZPHB 4PJOE 3A8GB 3QIIA 5GAN7 1W2BA 3QYGB 1Q82C 4C5EA 4A4EA 4II1A 4M75C 4N0AC 1YJNT 1YJWT 1VQKA 4KBMB 4XQ3A 3JCMd 1K73U 1WNLA 3M9QA 3CCLT 5KE3A 4BE0A 4C8QB 3PMIA 3CPWA 1G3SA 4M77A 4C5IA 2DXBA 4J8OA 3G71A 3C94A 4M78B 5GAN4 2DEQA 4F7UE 3SFMA 3QDRB 2Y4XA 3E9FA 3I56T 1N9SA 2DD5A 3GF5A 3QG1A 5LJ3f 5GAMh 4JS5A 3MHXA 3RMQA 5GAOm 5GAN2 1M1KU 5DY9A 3CCUA 2GFUA 5GAOp 3JCMg 3CD6A 1VQ5T 3FB9A 3C95A 5HKCA 2DXUA 2RHIA 2DO3A 4ME7A 2XDBA 2RM4A 3SWNB 5J3BA 3VUBA 4JUVA 2GQVA 3MEWA 1OZ2A 1R8OB 1EIFA 2RJCA 5GAOr 1G3YA 4M78E 4C92F 4ATOA 3L2WA 5CK9A 5IAYA 5GMKi 4E7HA 4M7AB 3KXTA 3N5BB 4XU0A 1ZHIA 4C92A 2EQMA 2JN0A 5I2MA 4LDWA 2EJGA 3CCSA 3CC2T 4A4FA 1QW1A 2L89A 3CC7A 5LJ3h 4DOWA 3E9GA 1WIDA 4QQDA 1Y07A 2KSSA 5M9OA 5AYFA 3SB2A 1NZ9A 2RJDA 3CBOA 4MZTA 5KCOA 3RERA 2D9TA 5CO7A 1QVFS 3OYLA 2L3RA 5I2SA 1WPYA 3HQFA 1X75C 3G4SA 2X35A 3KUFA 3HRSA 2R5AA 3CC4T 3WVDB 3GNGA 2EWNA 4HCZA 1VQKT 1IREB 2DJZA 3OBWA 2VGMA 1M5Q1 4BE2A 1VQLA 4OMFB 3PFSA 4IUPA 3X26B 3L2QA 3CCUT 2NLUA 3GP8A 4E7KA 2LQ8A 5CVIA 3CPFA 4OB3B 1Q82U 3CD6T 5HY6A 1IZ6A 4L5GA 4M7DD 1KG1A 4F7UG 3F70A 2RHYA 2A3LA 4M77E 3RMSA 1VQ4A 1XOVA 2RI5A 4PJOF 5GAN5 2DXTA 4EMKA 3GPLA 1TH7A 4QW2A 5J26A 1NJIC 3QXEB 3NTKA 1BI1A 4PLIA 4PJOA 1XTDA 2EJFA 5GAOq 5GAN3 4XTWA 1KQ1A 4EMHA 4ZTJA 1N8RC 4OGCA 5LJ5h 3J80E 2P0KA 4E47A 3OYEA 1NPPA 3BDUA 3QPHA 3JCMW 4B9XA 3BDLA 2YLCA 3V8JA 1Q86C 4HCCA 4MZPA 3CCJA 3LLRA 4ZN3A 2M1HA 2XK0A 4NL2A 4XK8E 4DA4A 2RHXA 2YHTA 5A2QE 2RI3A 2E6ZA 5HK0A 3I55A 3QJ6A 3G4ST 4BDYA 1ZQ1A 2F69A 1U1SA 3MEUA 1WJRA 1BIAA 5A0DA 3JB9F 4C92E 2Y90A 4J6YA 3CEYA 1P92A 3L2RA 3JCMJ 4PJOD 1QP2A 2E70A 3VUZA 2XD0A 4RG2A 4C8QF 1JB0E 1OYXA 2E64A 3HSBA 2ZPBB 3OW2A 1Y7XA 4M78F 3HRTA 3ZFJA 1KD1C 4C8QA 1Q81C 1Y96B 4J6WA 4LDUA 2ZCFB 4BE1A 4GLKA 3PTAA 2RJFA 1HXDA 3URGA 5GANe 2EAYA 3FC3A 5A0LA 2WSFE 3JB9J 1VQ9A 5DLQE 5CKFA 2E12A 1YI2T 1B34A 2P4TA 3HFNA 3BFMA 1XNIA 2LCLA 2FVUA 2CZ1B 3HRUA 3LW5E 5KCHA 2EQJA 1WJQA 2LCCA 4NL3A 1X6OA 5DLOA 4N4IA 2XDDA 2GF7A 2K5IA 2D6FA 4TVRA 1VQOA 3PNWC 4P5NA 3SWNA 1M90U 3QSUA 2QDYB 3CCJT 2DK3A 2LRQA 4C0GA 5GMKh 1QP3A 4M7AF 2R57A 5C0MA 1KHCA 4FT4A 3EFSA 2CYZB 3I55T 3TU4K 1KC8C 2JZ2A 3INZA 1PSEA 4M78D 5CQYA 1NJIU 4M7AA 2O01E 4OB1B 2X4WA 3UDCA 5IT9E 3WXMB 1N9RA 2LT1A 3ME9A 4M77F 3WVEB 4EPCA 3S3OA 2RH2A 1S72A 1N8RU 1NPRA 4X9DA 3ER0A 2MMPA 3DKMA 5IN1A 3M5AA 3OS2A 3OYNA 5GAMe 1QVGS 3OYYA 2WSCE 4GY5A 4UC4A 5GMKl 5GAOn 2CZ0B 2WACA 4ELZC 2V8JA 4C92G 4M7DG 1B34B 2DVEA 3MO8A 4PKCC 1KHIA 1VQ9T 1KQSA 3VJPA 1YELA 4J7IA 4JDSA 3M4YA 4LD6A 4C0DB 3JRZA 4QQGA 3X24B 2EYQA 4OVAA 5FU7C 2HNIA 1LJOA 5D6WA 1K8AC 2HAXA 5CKHA 2PUOB 4OF1A 1VUBA 3G7ZA 1H3ZA 4BD3A 4C92C 4M7DC 3OYCA 3OS5A 2MWOA 4C8QE 1YJ9T 2ZPGB 4JRKA 4N4GA 1XQHA 3LYIA 3OYJA 3FRNA 3MP8A 4RKUE 3RUXA 1VQOT 3X20B 1VQ7A 2E10A 1M4ZA 2RK1A 4M77D 3E1SA 2BKDN 5LJ3e 2QA4A 3CCVA 1N27A 1QVPA 2BIVA 2H3JA 3FDRA 4KULA 4MZMA 4X34A 1UEBA 3JCMf 1VQMA 1JJ2S 5LJ5d 3QHSA 2RK2A 3FIFA 2OTJA 2CZ6B 2XKOC 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDU A;  1NA6 A;  4LDV A;  4I1K A;  1WID A;  3HQF A;  4LDX A;  1YEL A;  4LDW A;  4LDY A; 
#chains in the Genus database with same CATH topology
 5KYY B;  3PT9 A;  1YIT A;  2K4Y A;  8AT1 B;  5GMK m;  2AIR B;  2X4X A;  1KJW A;  3QO3 A;  1LNX A;  4XU3 A;  4DOV A;  1Y57 A;  4OB2 B;  3CC4 Q;  1AWO A;  1VQK Q;  3QKJ A;  1RUW A;  1WFW A;  2QQB A;  4R0K A;  4PJO C;  1WHH A;  2H8H A;  2QQR A;  4C92 D;  1N6A A;  3H9N A;  1I81 A;  1N0G A;  3VU3 C;  3RKX A;  3GIB A;  4LDV A;  2KDS A;  4MML A;  1YBY A;  4CC2 A;  1RLQ C;  2DRK A;  2XID A;  5GAN 6;  3OW2 S;  5GAN d;  3RKW A;  2DTO A;  1WXT A;  3OBY A;  3I35 A;  5DM7 R;  2LX9 A;  3GOX A;  4ESR A;  1FYN A;  1GFC A;  3L2Z A;  1K8A U;  1OOT A;  1O75 A;  4CRI A;  3HL8 A;  1UGS B;  2QEX Q;  3JB9 H;  4R56 A;  1QKW A;  2RJE A;  1YCY A;  4OML A;  4C8Q C;  4F17 A;  3EG2 A;  4M7D B;  4K11 A;  1QVF A;  2KXD A;  2HL5 C;  4M78 C;  1Q82 R;  1VQL T;  2DL4 A;  2G6F X;  4Q5W A;  3S6W A;  3PVQ A;  1SKU B;  2MIO A;  2YUQ A;  4YTL A;  3X28 B;  1VIF A;  4X9C A;  4QVZ A;  1VQ4 T;  2HQH A;  4OMP A;  5L8R E;  5GAM d;  4XU2 A;  1ABO A;  3M56 A;  3CPW S;  1ZA2 B;  1A0N B;  5GMK j;  2ED0 A;  1ZSZ B;  2MWP A;  2RHZ A;  3ZBD A;  5GMK e;  4LXC A;  2GTO A;  3JB9 D;  2EQI A;  1ZA1 B;  1QCN A;  3JB9 I;  2LNV A;  2HSE B;  1Y0M A;  3AT1 B;  2EKO A;  3L42 A;  2FL7 A;  3SHW A;  3CCR A;  2NYS A;  3I55 Q;  1AHJ B;  3IQL A;  4EDU A;  1SPK A;  3RKY A;  1UGQ B;  2HL3 A;  4BUG A;  1PC0 A;  4D6W A;  1G3W A;  4E2F B;  1W4S A;  3QWY A;  4F7U B;  3VYH B;  1BYM A;  3TEE A;  3P8B B;  1J3T A;  2L0A A;  3PIP A;  1VQ9 Q;  5FRN A;  3QYH B;  1MMG A;  3G6E T;  4J7F A;  4M7A D;  4E7J A;  5FRO A;  4IIM A;  2DL5 A;  2M02 A;  1NJI R;  5ECA A;  3EGX B;  5FRM A;  2DE0 X;  4BI8 B;  2HZY A;  4KGZ B;  3CME T;  2CP2 A;  1FMV A;  4VUB A;  1WXU A;  2L2P A;  2M0Y A;  3L2V A;  4L59 A;  2R5M A;  1Q86 R;  1RI0 A;  2QI2 A;  1E7O A;  3OS0 A;  2RNA A;  4M7D F;  1VQ8 A;  5D7U A;  3EGD B;  4M75 D;  3G1J A;  1JU5 C;  4N4H A;  2KRN A;  2DIQ A;  1NE8 A;  3NFC A;  4C5G A;  1KD1 R;  4DBH A;  5HK3 A;  1RAA B;  4JRP A;  1Q81 R;  3CXC P;  4WTO B;  1N0F A;  4FL6 A;  4RTV A;  3JB9 G;  2OTL T;  2ED1 A;  3V7C A;  7AT1 B;  2XHC A;  2JJ9 A;  1BCM A;  2YDL A;  5KYX A;  2DEU A;  1YIJ A;  2VGN A;  1M90 C;  1WQW A;  4A4K A;  2E5Q A;  1JXM A;  4IUR A;  1D0X A;  1KQ2 A;  4C92 B;  4OP0 A;  2YWW A;  1KC8 R;  2KRM A;  2CP0 A;  2D8J A;  2F5K A;  3CCE A;  3QJY A;  3M0P A;  4F7U F;  2KRO A;  1M8V A;  1VQP A;  1YHQ T;  2HKQ B;  2QEX T;  3REB B;  4RTZ A;  3SWN C;  1V1C A;  1WJS A;  2K5F A;  2VAS A;  1FWZ A;  4M7D E;  2GBQ A;  5J39 A;  2JUF A;  2KYM A;  2FHD A;  1K8A R;  1D0Z A;  3A5Z B;  5IXF A;  9ATC B;  4M78 A;  3JCM Q;  5IXB A;  2EQK A;  2K3Y A;  2L8D A;  2MPX C;  5GJW B;  4IUV A;  5GAN h;  1ZBX A;  1K9M U;  2C0O A;  4R55 A;  1VQ6 Q;  3UPU A;  1UE9 A;  2QAZ A;  2DFU A;  1T3L A;  2QQS A;  4XTY A;  4M75 G;  4FM4 B;  3OYG A;  1E6H A;  1PG5 B;  2ZPH B;  5GAN 7;  2DER A;  1X27 A;  1Q82 C;  4C5E A;  5EC7 A;  2DBM A;  4XQ3 A;  3JCM d;  3M9Q A;  4BE0 A;  3PMI A;  4FW1 A;  3CPW A;  1G3S A;  3G71 A;  2DEQ A;  4F7U E;  3QDR B;  1N9S A;  1B3Q A;  2DD5 A;  3GF5 A;  5GAM h;  1VQK A;  1M1K U;  1UGV A;  5I11 A;  1TTH B;  3FB9 A;  3C95 A;  2A08 A;  1WX6 A;  2OI3 A;  2J05 A;  2XDB A;  1TWB A;  1UUE A;  3VUB A;  2JXB A;  2GQV A;  3MEW A;  5GAO r;  1YWO A;  4C92 F;  2FRY A;  4J9D A;  5CK9 A;  4E7H A;  2FPF A;  4M7A B;  3KXT A;  1ZHI A;  2EJG A;  1QW1 A;  2L89 A;  3CC7 A;  4DOW A;  1WID A;  4QQD A;  3JV3 A;  5KCO A;  2EYW A;  1XJW B;  1X75 C;  1Z9Q A;  1M2V A;  3HRS A;  2OX7 A;  2ABL A;  1C1A A;  2DJZ A;  2HMA A;  1NM7 A;  3X26 B;  3CCV Q;  3GP8 A;  1I5O B;  1YNZ A;  1WLP B;  1QVG P;  2LQ8 A;  5CVI A;  1BB9 A;  3H0H A;  1IZ6 A;  1KG1 A;  4DEY A;  2OTJ Q;  2A3L A;  1YIT Q;  1TH7 A;  5J26 A;  1NJI C;  3VRY A;  2DET A;  4OGC A;  1ZUU A;  2RQT A;  1AWX A;  1Q86 C;  4HCC A;  2XK0 A;  2YHT A;  5A2Q E;  1UJ0 A;  3I55 A;  4BDY A;  1OQK A;  1BIA A;  3JB9 F;  4C92 E;  2Y90 A;  5IHN A;  2GQI A;  2JM9 A;  4PJO D;  1QP2 A;  2E70 A;  2CP5 A;  2ZPB B;  3HRT A;  1KD1 C;  2CUD A;  1Q81 C;  1YFN A;  2ZCF B;  4BE1 A;  3URG A;  2EAY A;  3NMZ C;  1VQ9 A;  5DLQ E;  1YI2 T;  1B34 A;  1XNI A;  3RNJ A;  2FVU A;  3LW5 E;  4NL3 A;  1X6O A;  5DLO A;  1GBR A;  4Z8A A;  5FWC A;  4PFZ A;  3PNW C;  3SWN A;  4LUE A;  1M90 U;  2QDY B;  3CCJ T;  2DK3 A;  4HVW A;  1NLP C;  4M7A F;  3TSZ A;  4FT4 A;  3EFS A;  1M3C A;  1PNJ A;  1KC8 C;  4DBF A;  4M78 D;  2BE9 B;  3UDC A;  1PD1 A;  4PJM A;  4EPC A;  1VYV A;  3CCL Q;  2WSC E;  5GAO n;  1MV0 B;  2EYY A;  3MO8 A;  4PKC C;  1ACM B;  3CCR Q;  4LD6 A;  1PHT A;  1UHF A;  1K8A C;  4OVA A;  2LCS A;  4BD3 A;  1AD5 A;  1X2Q A;  2IPO B;  1YJ9 T;  1XQH A;  3LYI A;  3OYJ A;  3MP8 A;  4RKU E;  3RUX A;  4WCI A;  5IHK A;  2E10 A;  2C0T A;  3E1S A;  4JZ4 A;  5LJ3 e;  2QA4 A;  4MZM A;  2H3J A;  1WDX A;  1UEB A;  1YWP A;  2RK2 A;  3FIF A;  1LCK A;  1RAF B;  4RCB A;  4PJO G;  1M1K R;  4ORZ A;  1OPL A;  2J6K A;  5D6X A;  3FJP A;  4PK4 A;  4ZGJ B;  4M7A E;  4KUI A;  2LNH B;  1WGS A;  2IVW A;  1CSK A;  1WHK A;  2E41 A;  3JCM h;  2BE7 D;  2QG9 B;  2RF0 A;  2ATC B;  4ZNX A;  1W6X A;  2MI6 A;  2RD1 A;  2M16 A;  1M1G A;  3CCQ A;  3P8H A;  3QBY A;  3VKI A;  2LT4 A;  1PWT A;  4BY6 C;  2OAU A;  3CCS T;  4A53 A;  4C8Q G;  5FU6 C;  3LGL A;  1VQN A;  4M78 G;  2A36 A;  2DLP A;  4FSX A;  2RB6 A;  4RG8 A;  1I8F A;  2BZ8 A;  4Z02 A;  1JJ2 P;  4M75 E;  2C06 A;  3V7R A;  1VQ6 A;  3HPW A;  5FLX E;  4AMC A;  2KVQ G;  2KNB B;  1DJ7 B;  2M51 A;  1H64 1;  3LGF A;  2DD4 A;  2K2V A;  3LWI A;  1W2B S;  1SHF A;  2DIL A;  2CZ7 B;  2P4R A;  1GCQ A;  3NGP A;  3JCM P;  3VS1 A;  4HKE A;  4IUU A;  4IIO A;  2HD0 A;  2PVD B;  5KYX B;  2D0Q B;  1YJN A;  3ULR B;  2EVR A;  4GLM A;  3CCE Q;  1MGQ A;  2CRE A;  3KBG A;  5CKB A;  3M59 A;  3VS6 A;  4AG1 C;  4Y28 E;  1X69 A;  1D0Y A;  3MJX A;  1Y71 A;  3EGU A;  2EJ9 A;  4M77 C;  1JBM A;  1QWF A;  1UTI A;  2K3X A;  4JLG A;  5I21 A;  4I1K A;  4J9G A;  4Y92 A;  4MDX A;  1Q86 U;  1RAH B;  3MET A;  4O6J A;  5D6Y A;  1M9S A;  3ASK A;  2E5K A;  4A63 B;  3CXC S;  5CQX A;  3CC2 A;  3EFR A;  2DBK A;  2AZV A;  1U5S A;  1WXB A;  1NYG A;  4XTU A;  1X01 A;  1KD1 U;  1VQO Q;  1GXI E;  2MAM A;  4HXJ A;  1WIE A;  1Q81 U;  2CKK A;  2AHJ B;  4M75 A;  3CCR T;  2MF2 A;  1KQS P;  2M0O A;  1S72 T;  3MP6 A;  2FZC B;  1BKB A;  4PJL A;  5CIU A;  1UEC A;  2RI2 A;  2X3X D;  3G71 Q;  1MMD A;  3S3N A;  4JRI A;  1HJD A;  2D0N A;  4EMK C;  1UGR B;  2V8I A;  3VS4 A;  2K5L A;  4IUQ A;  1KC8 U;  1JO8 A;  1ZUY A;  4JZ3 A;  3TRE A;  2O9V A;  3FLG A;  4J9B A;  4JS4 A;  2RHU A;  2AZS A;  5CAI A;  1D3B A;  2DYI A;  1VQ7 T;  4KH0 B;  1K9M C;  2DKG A;  2COW A;  2DL3 A;  3UT1 A;  5HCK A;  3OMG A;  1M2O A;  3OY9 A;  3UAT A;  2GTJ A;  3CC7 Q;  3MEV A;  4J5Y A;  4J9E A;  3KFV A;  4IUT A;  3M0U A;  3EAE A;  4FT2 A;  1SSF A;  1G8X A;  4V2S A;  1T0H A;  2M9U A;  1VQ8 T;  1UGP B;  3OQ5 A;  4C0Z A;  4C0D C;  2DMO A;  4DBQ A;  4BB7 A;  2LMJ A;  1M1K C;  2K7A A;  3JSC A;  3M0Q A;  3OMC A;  4KRT A;  3OB9 A;  4ZTF A;  3QDF A;  2JMA A;  2YRC A;  2KBT A;  4MDW A;  1BI2 A;  2HBP A;  3CCM T;  3QUI A;  3CCL A;  1QVF P;  3E19 A;  2HBW A;  3PGG A;  1YIJ T;  6AT1 B;  4QQ6 A;  4E7I A;  1OX9 A;  2PUK B;  2KGT A;  4OMM A;  2A28 A;  4HCK A;  2QTV A;  1M1F A;  1QMC A;  3CCE T;  2A7Y A;  2VYT A;  3A8O B;  4BAC A;  4JLI A;  1I07 A;  2BZX A;  4CI0 C;  2FYK A;  2D1X A;  1VQP T;  4PJO E;  1W2B A;  4N0A C;  1RLP C;  4M77 A;  1WYX A;  4C5I A;  5AT1 B;  3UF4 A;  3E9F A;  4JS5 A;  1IRX A;  1IHW A;  5GAN 2;  1PRM C;  3CCU A;  2K3B A;  1H8K A;  1M30 A;  2KEA A;  5GAO p;  3E2U A;  4AFQ C;  1M3B A;  1OPK A;  1W1F A;  2RM4 A;  3SWN B;  3GBQ A;  4JUV A;  1ZX6 A;  1R8O B;  4M78 E;  1G3Y A;  2LJ0 A;  2K2M A;  1HD3 A;  3N5B B;  4XU0 A;  2EQM A;  2JN0 A;  1I0C A;  5FW9 A;  3VS7 A;  3ZI5 A;  1Y07 A;  2KSS A;  5M9O A;  3SB2 A;  2QDL A;  2RJD A;  4D8K A;  3RER A;  5CO7 A;  3OYL A;  2DNU A;  3HQF A;  2R5A A;  3CC4 T;  1ZSZ C;  2KR3 A;  3GNG A;  1UJY A;  2HEQ A;  1Z9Z A;  4RTW A;  1VQK T;  2CP6 A;  2RQU A;  2QA4 Q;  2SEM A;  4BE2 A;  1VQL A;  1GCP A;  2LQW A;  3A98 A;  4L5G A;  5HY6 A;  1RAB B;  2RHY A;  1VQ4 A;  3RMS A;  2DXT A;  4EMK A;  3GPL A;  4QW2 A;  1B07 A;  4PJO A;  5IHI A;  5LJ5 h;  1CKB A;  2X51 A;  2P0K A;  3BDU A;  1FMK A;  1K4U S;  3BDL A;  2GNC A;  2YSQ A;  4MZP A;  2HCK A;  3LLR A;  5KYW A;  2QYZ A;  4XK8 E;  2AT1 B;  2E6Z A;  5HK0 A;  1ZQ1 A;  1WJR A;  5A0D A;  3CCQ Q;  3CEY A;  1P92 A;  1ZUK A;  1AVZ C;  2XD0 A;  4RG2 A;  2QK0 A;  2CT3 A;  3OW2 A;  1Y7X A;  3VRZ A;  3ZFJ A;  1VQN Q;  4C8Q A;  4J6W A;  4AFZ C;  1M27 C;  3PTA A;  1HXD A;  5GAN e;  3FC3 A;  5CKF A;  1C0M A;  2DRM A;  2P4T A;  3HFN A;  2E4H A;  5KCH A;  1H92 A;  1PRL C;  1TG0 A;  2LCC A;  5GJV B;  2ROT A;  1M3A A;  1OU9 A;  4QT7 A;  2XDD A;  2GF7 A;  2K5I A;  3C0C A;  1IB8 A;  2RMO A;  4TVR A;  1GL5 A;  1VQO A;  1RAI B;  2LRQ A;  4QKU A;  5C0M A;  3U23 A;  3TU4 K;  3I55 T;  2JZ2 A;  3INZ A;  3ME9 A;  3R6N A;  3WVE B;  2C1L A;  1YJW Q;  1NPR A;  4HVV A;  1YJN Q;  3ER0 A;  3M5A A;  3OS2 A;  5GAM e;  1RAC B;  2KT8 A;  4UC4 A;  2V1R A;  4LUD A;  1VQ9 T;  4J7I A;  4QQG A;  1NEB A;  1ZLM A;  2HNI A;  1LJO A;  1U06 A;  5D6W A;  5FU7 C;  1LVK A;  5CKH A;  2PUO B;  4OF1 A;  1OUL A;  3G7Z A;  4C92 C;  1YP5 A;  3OYC A;  4JJC A;  2ZPG B;  3CPW P;  2RK1 A;  4M77 D;  1YN8 A;  1N27 A;  4KUL A;  2BIV A;  4E7K A;  3FDR A;  1VQM A;  1KFZ A;  1JJ2 S;  3VS5 A;  3UA6 A;  3CC2 Q;  3OYB A;  3DLM A;  2JTM A;  4C5H A;  1MHN A;  3SDZ A;  4DEX A;  1F1B B;  1AT1 B;  4J83 A;  2JVV A;  3NTI A;  2PU9 B;  2EW3 A;  2FO0 A;  5CKE A;  3R6O A;  3H8Z A;  1RL2 A;  2WSE E;  2EYZ A;  3L2U A;  1KSW A;  4M75 B;  1RAE B;  4XTV A;  1GRI A;  4DQ2 A;  4J9I A;  2I0N A;  3M57 A;  4IKF A;  1CKA A;  1SRL A;  2HKN A;  4JRQ A;  2LTO A;  2PVO B;  1K0X A;  4FU6 A;  2CP3 A;  1B7T A;  3EHR A;  1D1A A;  3V8L A;  2QXF A;  3MEA A;  2DPP B;  3G4S Q;  1JRI A;  2DTH A;  4B9W A;  3VYG A;  1QLY A;  1WHM A;  3ZL7 C;  4ZGE B;  1SG5 A;  3EH2 A;  5FWB A;  3O8V A;  4NOY A;  2CS7 A;  1SHG A;  1D3B B;  2K6D A;  2YUP A;  2EQU A;  4QVD A;  4M4Z A;  5CKD A;  5CR2 A;  4X1V A;  3H0I A;  2KI7 A;  3BY7 A;  3Q1J A;  4M77 G;  3RR6 A;  2KAF A;  2JS2 A;  4CC7 A;  4M7A C;  1KQS S;  2NUP A;  1NYF A;  2ZPF B;  1BIB A;  2YRV A;  1VOM A;  3M53 A;  5KYU A;  2FB7 A;  4J9C A;  4A4G A;  4C8Q D;  1JEG A;  3RBB B;  2F2V A;  5GAO l;  1VIE A;  1HYO A;  5CCA A;  1VQ6 T;  1EFN A;  2AK5 A;  2DZC A;  2E1H A;  1U3O A;  4AFS C;  2JMC A;  2JTF A;  1QKX A;  2MK5 A;  3OYM A;  4L6V 5;  3CMA A;  5FU6 B;  2GGR A;  2YXY A;  3M54 A;  5LJ3 g;  4LD9 K;  3JAM E;  3MP1 A;  3MKD A;  4OGE A;  2DL7 A;  4M75 F;  2PNI A;  5LJ3 j;  1NBE B;  4JPB W;  3L1A A;  3OS1 A;  4E6R A;  1PD0 A;  2P0Q A;  3RIR A;  1SRM A;  2KY9 A;  2VXF A;  4HT8 A;  2LQN A;  4JJN K;  2VKN A;  4RTY A;  2KYB A;  3BW1 A;  4FYX B;  2X4J A;  4OMQ A;  3SEM A;  1UDL A;  3JCM e;  2QTX A;  4LE9 A;  3CCU Q;  2ZPE B;  2EPD A;  1H3H A;  1Q7Y U;  1WQ7 A;  4M77 B;  2ESW A;  1SSH A;  3LWH A;  4GBQ A;  4ZN1 A;  2O88 A;  3QWX X;  3FEO A;  3CBP A;  2CSQ A;  3CCV T;  2ZPI B;  3UWN A;  2EFI A;  2OTJ T;  2XIC A;  3AHU A;  3RDV A;  2NUT A;  2VB6 A;  1YIT T;  3JCM X;  3DLL A;  4D8D A;  2E3I A;  2DA9 A;  2O4X A;  4XAX B;  2JS0 A;  1MMA A;  3DB4 A;  2J6F A;  1YI2 A;  4OMN A;  2P0P A;  5KH6 A;  1T0J A;  1NLO C;  2DX1 A;  3OSS C;  1NG2 A;  3TVT A;  3HKS A;  1PKS A;  1WZO A;  3MCA B;  1VQL Q;  4E7L A;  4KUD K;  4FSS A;  2A0F B;  1I4K 1;  1FX7 A;  3TQ7 P;  1PKT A;  1NA6 A;  1VQ4 Q;  2HDA A;  3HTR A;  4Y91 A;  1QCO A;  2FPE A;  4FYW B;  1YJW A;  4DBR A;  3V8K A;  2OJ2 A;  2GFA A;  2DAQ A;  4EMK B;  1TUG B;  2YLB A;  2EIF A;  3I56 A;  4PJO B;  2IIM A;  3I5S A;  3VV0 A;  2E6N A;  2ECZ A;  4NS5 A;  2QGG A;  3P8D A;  2LQK A;  3OSV A;  1VQ5 A;  1BI0 A;  1O9S A;  1JQQ A;  1R77 A;  2EBP A;  2O31 A;  4QVC A;  5KYW B;  1YJ9 A;  2VVK A;  2W0Z A;  3M0T A;  1OX8 A;  3PVL A;  4BI3 A;  3DB3 A;  4Z89 A;  3T9N A;  2Y4Y A;  3A8G B;  3QII A;  4KH1 B;  1N0E A;  4II1 A;  5KYN A;  3G6E Q;  3VS2 A;  2X3W D;  1K73 U;  1V76 A;  3CCL T;  5KE3 A;  4C8Q B;  2DXB A;  3C94 A;  4M78 B;  5GAN 4;  2YT6 A;  3SFM A;  2Y4X A;  4OMO A;  5LJ3 f;  2P84 A;  2EYX A;  1G2B A;  2GFU A;  2F1L A;  3CD6 A;  5HKC A;  2RHI A;  4ME7 A;  3EHQ A;  1GFD A;  1BK2 A;  2C0I A;  2A37 A;  2CP7 A;  1ARK A;  2RJC A;  4ATO A;  2YUN A;  4RUG A;  3L2W A;  4E7S A;  1RAD B;  4LDW A;  3CCS A;  4A4F A;  1WHG A;  1WI7 A;  2DVJ A;  1NZ9 A;  3CBO A;  4MZT A;  3CQT A;  2L3R A;  3G4S A;  1MV3 A;  1PM3 A;  3KUF A;  2DL8 A;  2V1Q A;  3WVD B;  3OBW A;  3CCU T;  4IUP A;  3L2Q A;  2OTL Q;  2Z0W A;  4F04 B;  1VQM Q;  1EX4 A;  3CPF A;  4F7U G;  3F70 A;  4M77 E;  1XOV A;  2RI5 A;  4PJO F;  4RTT A;  1R0B G;  3NTK A;  4AG2 C;  5GAO q;  4XTW A;  1KQ1 A;  1MND A;  1Q7Y R;  2O2O A;  4J9F A;  3OYE A;  1NPP A;  3QPH A;  3JCM W;  3EG0 A;  3V8J A;  3VS3 A;  1M2V B;  4B6M A;  2M1H A;  2RHX A;  2RI3 A;  1YHQ Q;  2F69 A;  3MEU A;  4J6Y A;  3L2R A;  3JCM J;  1EZZ B;  3TSW A;  4FYY B;  3VUZ A;  4C8Q F;  3HSB A;  4M78 F;  1K76 A;  2FPD A;  2BTT A;  4GLK A;  3JB9 J;  2WSF E;  1ABQ A;  2RPN A;  3BFM A;  2J6O A;  1IGU A;  2EQJ A;  2EGC A;  4N4I A;  2FG0 A;  4P5N A;  3QSU A;  4C0G A;  5GMK h;  1QP3 A;  1PSE A;  5CQY A;  1QCF A;  4OB1 B;  3UA7 A;  1Q95 G;  2LT1 A;  2QAS A;  3S3O A;  2RN8 A;  1N8R U;  1S72 A;  1TS9 A;  4X9D A;  2MMP A;  3DKM A;  5IN1 A;  1QVG S;  4GY5 A;  2CZ0 B;  2WAC A;  4ELZ C;  2F2X A;  2V8J A;  1PCX A;  4C92 G;  1B34 B;  1YEL A;  3VJP A;  4JDS A;  2V26 A;  3JRZ A;  3X24 B;  2HAX A;  1W2B P;  3PE0 A;  1VUB A;  2NUP B;  4M7D C;  2J7I A;  2MWO A;  4C8Q E;  1VQO T;  4N4G A;  1K9A A;  2RQR A;  3FRN A;  5KYU B;  3EH1 A;  3X20 B;  1VQ7 A;  2LP5 A;  4FCY A;  2BKD N;  1TSF A;  1QVP A;  1C6V X;  3CMA Q;  2L3P A;  3D7S B;  1K73 R;  2FZG B;  3THK A;  2CZ6 B;  1K1Z A;  4CC4 B;  3CXC A;  4PL6 A;  4PFO A;  2DYB A;  3JCM c;  2E3H A;  4XTX A;  3G71 T;  1OZ3 A;  3A8H B;  2B86 A;  2KE9 A;  5LJ5 g;  3MPU B;  4PJN A;  3RES A;  2VC8 A;  1D1C A;  4ANJ A;  4LDX A;  2R58 A;  2AKL A;  2HQX A;  3HHT B;  2QQ9 A;  4HT9 A;  2CGH A;  2LZ6 B;  5LJ5 j;  2VUB A;  2K79 A;  1Y96 A;  2IG0 A;  2AKK A;  5LJ5 e;  1OEB A;  3OYF A;  2JW4 A;  3J81 E;  1X6G A;  3A8M B;  1TU0 B;  1VQM T;  3CCM A;  3OYD A;  3CC7 T;  1RAG B;  2DTI A;  2DIG A;  4LDY A;  4RCC A;  3GNF B;  4FIB A;  2L5Q A;  4OB0 B;  5FU7 B;  4BDZ A;  5GAN g;  2PZ1 A;  1YCS B;  1KIK A;  2CT4 A;  4JJB A;  3C12 A;  3A8L B;  3JCM b;  3GLX A;  5GAN j;  1I1J A;  2V8K A;  4M7A G;  2W10 A;  1W70 A;  3G6E A;  1YI2 Q;  2VV5 A;  1WHL A;  2NUT B;  4J6X A;  5KE2 A;  1MNE A;  2O4X B;  3JCM V;  3EFO A;  3OA6 A;  5GAM g;  1BI3 A;  3OW2 P;  3CCJ Q;  2RA2 A;  3QZ9 B;  4PNO A;  2H3E B;  3EG9 A;  2I2L A;  1BBZ A;  1Q7Y C;  4O5V A;  3CME A;  2OAW A;  5LJ3 d;  5GAM j;  2GCX A;  2L3Q A;  1BCO A;  5KYY A;  2MCN A;  4BI4 A;  2K57 A;  4CC3 A;  5C6S A;  2YRD A;  3I56 Q;  3EG1 A;  1UFF A;  1X6B A;  3NPF A;  2XU8 A;  4F16 A;  1LPL A;  1VQ5 Q;  3LH0 A;  3H41 A;  2LC4 A;  1YJ9 Q;  2LJ1 A;  2PVG B;  2B8A A;  3LX7 A;  3CC4 A;  4N0A A;  2CSI A;  3V7S A;  3NHN A;  2OTL A;  1WA7 A;  3O5Z A;  1N8R R;  1UB4 A;  1N5Z A;  4PJJ A;  5I22 A;  3C4S A;  4KGX B;  1AWJ A;  1V29 B;  3FJ5 A;  1GBQ A;  2JNG A;  4XU1 A;  2F2W A;  2KRS A;  2EGA A;  4C0F A;  1X2K A;  2E65 A;  1S1N A;  1TUC A;  3M0R A;  4ELY C;  3CMA T;  2D8H A;  2CH4 A;  1QVG A;  4HCB A;  2KMT A;  4M7D A;  2BUD A;  3SD4 A;  2NWM A;  2EKH A;  4ZGD B;  1QQJ A;  1M8M A;  3CD6 Q;  5GAN 8;  3OYH A;  1YHQ A;  2HSP A;  3H0F A;  3M4G A;  2XI9 A;  3HP9 A;  4F14 A;  3OYI A;  2QGF B;  4MMK A;  5A0G A;  2QEX A;  2X9H A;  1HK9 A;  4RTU A;  1I5L A;  2ZZD A;  5LJ5 f;  3S3M A;  2JM8 A;  2DXC A;  2VXE A;  2QA4 T;  1G3T A;  3LH5 A;  2XDP A;  4JJD A;  2YUO A;  3CCS Q;  4KT0 E;  1ZSZ A;  3PIO A;  3OYK A;  2X4Y A;  2RO0 A;  2KK4 A;  3NTH A;  1E6G A;  4A54 A;  4HA8 A;  2KQW A;  2JTE A;  4PLL A;  1K73 C;  2JOY A;  4LNP A;  3PMT A;  3TCJ A;  1VYT A;  3HFO A;  1GCQ C;  1PSF A;  3X25 B;  2DM1 A;  3J7A F;  2K9G A;  4A4H A;  2DZ9 A;  1LOJ A;  2KT1 A;  2XMF A;  4F7U A;  5GAN f;  2F5T X;  1MMN A;  5EG2 A;  3CCQ T;  4EMG A;  3H6Z A;  1G5V A;  2LDM A;  3M58 A;  2G3R A;  3CBM A;  1VQN T;  3M55 A;  1OI1 A;  2XG8 D;  2O9S A;  2RQW A;  2PTK A;  3EG3 A;  3QZ5 B;  2COY A;  2QQA A;  2PQW A;  3EGX A;  2ZGW A;  2L3S A;  4WF2 A;  3VS0 A;  3OYA A;  4RMO A;  2FZK B;  3ZEH A;  5GAM f;  1U8R A;  1U1T A;  1FXX A;  1IGQ A;  2LVM A;  4BY6 B;  4XTZ A;  5L23 A;  1SEM A;  1SF9 A;  1ZBJ A;  5LL6 S;  5IH2 A;  2J06 A;  1TXQ A;  2LJ3 A;  4E7Z A;  1AZG B;  2VWF A;  3QYG B;  3EGD A;  4A4E A;  2ROL A;  1YJW T;  1QWE A;  4M75 C;  1T3S A;  1YJN T;  4KBM B;  1WNL A;  2FEI A;  1X43 A;  1WHJ A;  1D09 B;  2MOX A;  4J8O A;  3I56 T;  4HVU A;  3QG1 A;  3MHX A;  3RMQ A;  5GAO m;  1K9M R;  1ZSG A;  5DY9 A;  1OV3 A;  1VYU A;  3JCM g;  1VQ5 T;  3BE3 A;  8ATC B;  1R0C B;  2DXU A;  2DO3 A;  1S72 Q;  5J3B A;  1OZ2 A;  2CH4 W;  1EIF A;  1BU1 A;  2MYS A;  5IAY A;  5GMK i;  1IHV A;  4C92 A;  5I2M A;  3A1P A;  3CC2 T;  4AT1 B;  2LX7 A;  5LJ3 h;  3E9G A;  2KXC A;  2DF6 A;  5AYF A;  2RQV A;  2SRC A;  2D9T A;  1QVF S;  5I2S A;  1WPY A;  2X35 A;  4KGV B;  1G83 A;  1VQ7 Q;  1TOV A;  2EWN A;  4HCZ A;  1IRE B;  2VGM A;  1M5Q 1;  4OMF B;  3PFS A;  2DJQ A;  2NLU A;  1TUD A;  4EIK A;  2NUZ A;  2ZAE A;  3CD6 T;  4OB3 B;  1Q82 U;  4M7D D;  3REA B;  1JJ2 A;  1IXD A;  5GAN 5;  3QXE B;  1UHC A;  1BI1 A;  4PLI A;  1XTD A;  2EJF A;  5GAN 3;  4EMH A;  4ZTJ A;  1N8R C;  3J80 E;  1VQ8 Q;  1UG1 A;  2ENM A;  4E47 A;  2BZY A;  4B9X A;  2YLC A;  4FYV B;  1JXO A;  3CCJ A;  4ZN3 A;  4NL2 A;  4DA4 A;  3QJ6 A;  3G4S T;  1U1S A;  1AEY A;  2EGE A;  1JB0 E;  1OYX A;  2E64 A;  3CCM Q;  1YIJ Q;  1Y96 B;  4LDU A;  4Z88 A;  2RJF A;  5A0L A;  2E12 A;  3HRU A;  3M0S A;  2LCL A;  2CZ1 B;  1WJQ A;  2D6F A;  3I9Q A;  2FRW A;  4RTX A;  2CUB A;  1MUZ A;  1IO6 A;  3I5R A;  1VQP Q;  2R57 A;  1KHC A;  2CYZ B;  1NJI U;  4M7A A;  2O01 E;  5IT9 E;  2X4W A;  1K0S A;  3WXM B;  1N9R A;  4M77 F;  1OU8 A;  2RH2 A;  1AOJ A;  3OYN A;  2COZ A;  3OYY A;  5GMK l;  4M7D G;  4AFU C;  2DVE A;  1HSQ A;  1AZE A;  1KHI A;  4PFP A;  1KQS A;  3M4Y A;  4J9H A;  1VA7 A;  4C0D B;  2EYQ A;  1AWW A;  4FW2 A;  3CME Q;  1KK7 A;  1M90 R;  1H3Z A;  3OS5 A;  1RI9 A;  3EFO B;  4JRK A;  1M4Z A;  1NEG A;  3EG9 B;  2JT4 A;  3CCV A;  3JCM f;  4X34 A;  1D1B A;  4LN2 A;  3QHS A;  1FMW A;  5LJ5 d;  2OTJ A;  2CDT A;  2XKO C;  2HQE A; 
#chains in the Genus database with same CATH homology
 3CXC A;  4RCB A;  3OYB A;  3DLM A;  2JTM A;  3PT9 A;  4PL6 A;  2K4Y A;  4C5H A;  1YIT A;  3JCM c;  1MHN A;  4XTX A;  4PJO G;  5GMK m;  3SDZ A;  3G71 T;  2X4X A;  3QO3 A;  1OZ3 A;  1LNX A;  4XU3 A;  4DOV A;  3A8H B;  5D6X A;  4J83 A;  3FJP A;  4OB2 B;  4ZGJ B;  5LJ5 g;  2JVV A;  4M7A E;  4KUI A;  3QKJ A;  3NTI A;  3RES A;  2QQB A;  1WGS A;  2IVW A;  2PU9 B;  2VC8 A;  4PJO C;  2QQR A;  4LDX A;  4C92 D;  2R58 A;  2HQX A;  3HHT B;  1N6A A;  2E41 A;  5CKE A;  3JCM h;  3R6O A;  1I81 A;  2QQ9 A;  1RL2 A;  3H8Z A;  4HT9 A;  2CGH A;  3VU3 C;  2VUB A;  5LJ5 j;  2WSE E;  3RKX A;  2MI6 A;  3L2U A;  1Y96 A;  3GIB A;  2IG0 A;  2RD1 A;  4M75 B;  2M16 A;  4XTV A;  4LDV A;  2KDS A;  1M1G A;  5LJ5 e;  3OYF A;  4MML A;  1YBY A;  3P8H A;  3QBY A;  3VKI A;  3CCQ A;  2XID A;  2LT4 A;  4DQ2 A;  5GAN 6;  3OW2 S;  3M57 A;  4IKF A;  3J81 E;  5GAN d;  3RKW A;  4BY6 C;  2OAU A;  2DTO A;  3A8M B;  1VQM T;  4JRQ A;  3OBY A;  3CCS T;  4A53 A;  2LTO A;  3OYD A;  2PVO B;  5DM7 R;  3CCM A;  3CC7 T;  4C8Q G;  5FU6 C;  2LX9 A;  2DTI A;  3LGL A;  4FU6 A;  2DIG A;  4LDY A;  3GOX A;  3L2Z A;  4M78 G;  1K8A U;  1VQN A;  4RCC A;  4FSX A;  3GNF B;  1O75 A;  2RB6 A;  4CRI A;  3HL8 A;  4FIB A;  1UGS B;  2L5Q A;  4OB0 B;  4RG8 A;  5FU7 B;  3V8L A;  1I8F A;  4Z02 A;  4R56 A;  4BDZ A;  2RJE A;  3JB9 H;  2QXF A;  3MEA A;  2DPP B;  4M75 E;  1YCY A;  5GAN g;  1JRI A;  2C06 A;  3V7R A;  4C8Q C;  1VQ6 A;  3HPW A;  2DTH A;  4B9W A;  5FLX E;  1QVF A;  4M7D B;  3C12 A;  4M78 C;  3VYG A;  3A8L B;  1VQL T;  2KVQ G;  4Q5W A;  3S6W A;  1DJ7 B;  3JCM b;  4ZGE B;  1H64 1;  3LGF A;  2DD4 A;  2K2V A;  3GLX A;  3LWI A;  1W2B S;  4YTL A;  3O8V A;  4NOY A;  5GAN j;  3X28 B;  2CS7 A;  1VIF A;  4X9C A;  1D3B B;  4QVZ A;  1VQ4 T;  2V8K A;  2EQU A;  4QVD A;  5L8R E;  5CKD A;  2CZ7 B;  4M7A G;  5GAM d;  4XU2 A;  5CR2 A;  3M56 A;  3JCM P;  4HKE A;  4IUU A;  3CPW S;  3G6E A;  2HD0 A;  2PVD B;  2VV5 A;  2D0Q B;  1YJN A;  5GMK j;  3BY7 A;  3Q1J A;  4M77 G;  2KAF A;  1MGQ A;  2MWP A;  2RHZ A;  4J6X A;  3ZBD A;  5KE2 A;  5GMK e;  4M7A C;  1KQS S;  2O4X B;  3JB9 D;  3KBG A;  5CKB A;  3JCM V;  3M59 A;  2ZPF B;  1BIB A;  2YRV A;  3M53 A;  5GAM g;  1BI3 A;  2LNV A;  4Y28 E;  3JB9 I;  3OA6 A;  2FB7 A;  1Y71 A;  3L42 A;  2EKO A;  2RA2 A;  2FL7 A;  3QZ9 B;  4A4G A;  4PNO A;  4C8Q D;  3CCR A;  2EJ9 A;  4M77 C;  1JBM A;  5GAO l;  2I2L A;  1Q7Y C;  1VIE A;  2K3X A;  5CCA A;  1VQ6 T;  4O5V A;  1AHJ B;  4EDU A;  3CME A;  3RKY A;  2DZC A;  2E1H A;  4JLG A;  5LJ3 d;  5GAM j;  1UGQ B;  2GCX A;  4BUG A;  4D6W A;  1G3W A;  1W4S A;  5I21 A;  4I1K A;  4MDX A;  2JTF A;  4F7U B;  3VYH B;  4BI4 A;  1Q86 U;  1BYM A;  2K57 A;  3MET A;  4O6J A;  5D6Y A;  1M9S A;  3ASK A;  3TEE A;  3OYM A;  4L6V 5;  5C6S A;  3P8B B;  5FU6 B;  3CMA A;  3M54 A;  3CXC S;  3PIP A;  5LJ3 g;  5CQX A;  3CC2 A;  3EFR A;  3QYH B;  5FRN A;  3G6E T;  2XU8 A;  4LD9 K;  4J7F A;  4M7A D;  3JAM E;  3LH0 A;  3MP1 A;  4E7J A;  5FRO A;  4OGE A;  4M75 F;  4XTU A;  5LJ3 j;  1X01 A;  2LC4 A;  1KD1 U;  2PVG B;  1GXI E;  2B8A A;  2MAM A;  3LX7 A;  3CC4 A;  3L1A A;  3OS1 A;  2CKK A;  2AHJ B;  4M75 A;  4N0A A;  3V7S A;  1Q81 U;  3CCR T;  2OTL A;  5FRM A;  2P0Q A;  4BI8 B;  2MF2 A;  1UB4 A;  3RIR A;  3CME T;  2KY9 A;  2VXF A;  2M0O A;  4HT8 A;  4VUB A;  4JJN K;  3C4S A;  3MP6 A;  3L2V A;  1BKB A;  1S72 T;  4L59 A;  1V29 B;  2R5M A;  2JNG A;  4XU1 A;  3BW1 A;  1RI0 A;  5CIU A;  2QI2 A;  2RI2 A;  4C0F A;  3OS0 A;  2E65 A;  2X4J A;  4M7D F;  3S3N A;  4JRI A;  1VQ8 A;  4ELY C;  3CMA T;  4EMK C;  1QVG A;  4HCB A;  2V8I A;  2QTX A;  2KMT A;  1UGR B;  2K5L A;  4IUQ A;  3JCM e;  4M7D A;  2BUD A;  4M75 D;  3SD4 A;  1KC8 U;  2ZPE B;  4N4H A;  3TRE A;  4ZGD B;  1Q7Y U;  2DIQ A;  3FLG A;  1NE8 A;  3NFC A;  1WQ7 A;  5GAN 8;  4C5G A;  4M77 B;  3OYH A;  4JS4 A;  1YHQ A;  3M4G A;  2RHU A;  5HK3 A;  2XI9 A;  4JRP A;  3HP9 A;  5CAI A;  3OYI A;  4MMK A;  5A0G A;  3LWH A;  2QEX A;  1D3B A;  1HK9 A;  1I5L A;  2ZZD A;  4ZN1 A;  5LJ5 f;  1VQ7 T;  4FL6 A;  3S3M A;  1K9M C;  3FEO A;  2DXC A;  2VXE A;  2QA4 T;  3JB9 G;  2DKG A;  3CBP A;  3CCV T;  2OTL T;  1G3T A;  2ZPI B;  3V7C A;  2XDP A;  2XHC A;  3UT1 A;  3UWN A;  3OMG A;  3OY9 A;  2EFI A;  2OTJ T;  2XIC A;  2VGN A;  1YIJ A;  1M90 C;  3AHU A;  4KT0 E;  3MEV A;  4J5Y A;  1WQW A;  3PIO A;  1YIT T;  3JCM X;  3DLL A;  2O4X A;  4IUT A;  4XAX B;  4FT2 A;  3EAE A;  2X4Y A;  3OYK A;  2RO0 A;  1SSF A;  3DB4 A;  2E5Q A;  4A4K A;  2KK4 A;  4IUR A;  3NTH A;  1YI2 A;  2P0P A;  4A54 A;  5KH6 A;  1KQ2 A;  4HA8 A;  4C92 B;  4V2S A;  2KQW A;  2M9U A;  3OSS C;  4OP0 A;  1VQ8 T;  3HKS A;  1UGP B;  4PLL A;  2F5K A;  1K73 C;  3MCA B;  2JOY A;  3QJY A;  3CCE A;  3PMT A;  3TCJ A;  3OQ5 A;  3HFO A;  4E7L A;  4KUD K;  4C0Z A;  1PSF A;  3X25 B;  3J7A F;  4F7U F;  4A4H A;  1I4K 1;  1M8V A;  4C0D C;  1VQP A;  2DZ9 A;  1YHQ T;  1FX7 A;  1LOJ A;  4BB7 A;  1M1K C;  4F7U A;  3JSC A;  5GAN f;  3OMC A;  2QEX T;  2F5T X;  1NA6 A;  4Y91 A;  5EG2 A;  3CCQ T;  3OB9 A;  4EMG A;  3SWN C;  4ZTF A;  1WJS A;  2K5F A;  3H6Z A;  1FWZ A;  4M7D E;  1G5V A;  1YJW A;  4MDW A;  1BI2 A;  2JUF A;  5J39 A;  2FHD A;  2HBP A;  2LDM A;  3CCM T;  3M58 A;  3QUI A;  3V8K A;  3CCL A;  3A5Z B;  2G3R A;  3CBM A;  3E19 A;  3PGG A;  2GFA A;  1VQN T;  3M55 A;  1YIJ T;  2DAQ A;  4QQ6 A;  4EMK B;  1OI1 A;  2XG8 D;  2YLB A;  4E7I A;  2EIF A;  3I56 A;  4PJO B;  4M78 A;  2PUK B;  3QZ5 B;  3JCM Q;  2EQK A;  2K3Y A;  2QQA A;  2PQW A;  3VV0 A;  2L8D A;  2E6N A;  2ZGW A;  4NS5 A;  5GAN h;  4IUV A;  3P8D A;  1ZBX A;  2LQK A;  3OSV A;  1K9M U;  4WF2 A;  1BI0 A;  1VQ5 A;  1M1F A;  4R55 A;  3OYA A;  1JJ2 A;  3CCE T;  1O9S A;  2A7Y A;  4RMO A;  3UPU A;  2VYT A;  3A8O B;  3ZEH A;  4BAC A;  4JLI A;  5GAM f;  2QQS A;  1U8R A;  1U1T A;  4QVC A;  1FXX A;  4XTY A;  1YJ9 A;  2LVM A;  4M75 G;  4BY6 B;  4FM4 B;  4XTZ A;  2FYK A;  4BI3 A;  4CI0 C;  3DB3 A;  3OYG A;  1VQP T;  3T9N A;  5LL6 S;  2Y4Y A;  2ZPH B;  4PJO E;  3A8G B;  3QII A;  5GAN 7;  1W2B A;  3QYG B;  1Q82 C;  4C5E A;  4A4E A;  4II1 A;  4M75 C;  4N0A C;  1YJN T;  1YJW T;  1VQK A;  4KBM B;  4XQ3 A;  3JCM d;  1K73 U;  1WNL A;  3M9Q A;  3CCL T;  5KE3 A;  4BE0 A;  4C8Q B;  3PMI A;  3CPW A;  1G3S A;  4M77 A;  4C5I A;  2DXB A;  4J8O A;  3G71 A;  3C94 A;  4M78 B;  5GAN 4;  2DEQ A;  4F7U E;  3SFM A;  3QDR B;  2Y4X A;  3E9F A;  3I56 T;  1N9S A;  2DD5 A;  3GF5 A;  3QG1 A;  5LJ3 f;  5GAM h;  4JS5 A;  3MHX A;  3RMQ A;  5GAO m;  5GAN 2;  1M1K U;  5DY9 A;  3CCU A;  2GFU A;  5GAO p;  3JCM g;  3CD6 A;  1VQ5 T;  3FB9 A;  3C95 A;  5HKC A;  2DXU A;  2RHI A;  2DO3 A;  4ME7 A;  2XDB A;  2RM4 A;  3SWN B;  5J3B A;  3VUB A;  4JUV A;  2GQV A;  3MEW A;  1OZ2 A;  1R8O B;  1EIF A;  2RJC A;  5GAO r;  1G3Y A;  4M78 E;  4C92 F;  4ATO A;  3L2W A;  5CK9 A;  5IAY A;  5GMK i;  4E7H A;  4M7A B;  3KXT A;  3N5B B;  4XU0 A;  1ZHI A;  4C92 A;  2EQM A;  2JN0 A;  5I2M A;  4LDW A;  2EJG A;  3CCS A;  3CC2 T;  4A4F A;  1QW1 A;  2L89 A;  3CC7 A;  5LJ3 h;  4DOW A;  3E9G A;  1WID A;  4QQD A;  1Y07 A;  2KSS A;  5M9O A;  5AYF A;  3SB2 A;  1NZ9 A;  2RJD A;  3CBO A;  4MZT A;  5KCO A;  3RER A;  2D9T A;  5CO7 A;  1QVF S;  3OYL A;  2L3R A;  5I2S A;  1WPY A;  3HQF A;  1X75 C;  3G4S A;  2X35 A;  3KUF A;  3HRS A;  2R5A A;  3CC4 T;  3WVD B;  3GNG A;  2EWN A;  4HCZ A;  1VQK T;  1IRE B;  2DJZ A;  3OBW A;  2VGM A;  1M5Q 1;  4BE2 A;  1VQL A;  4OMF B;  3PFS A;  4IUP A;  3X26 B;  3L2Q A;  3CCU T;  2NLU A;  3GP8 A;  4E7K A;  2LQ8 A;  5CVI A;  3CPF A;  4OB3 B;  1Q82 U;  3CD6 T;  5HY6 A;  1IZ6 A;  4L5G A;  4M7D D;  1KG1 A;  4F7U G;  3F70 A;  2RHY A;  2A3L A;  4M77 E;  3RMS A;  1VQ4 A;  1XOV A;  2RI5 A;  4PJO F;  5GAN 5;  2DXT A;  4EMK A;  3GPL A;  1TH7 A;  4QW2 A;  5J26 A;  1NJI C;  3QXE B;  3NTK A;  1BI1 A;  4PLI A;  4PJO A;  1XTD A;  2EJF A;  5GAO q;  5GAN 3;  4XTW A;  1KQ1 A;  4EMH A;  4ZTJ A;  1N8R C;  4OGC A;  5LJ5 h;  3J80 E;  2P0K A;  4E47 A;  3OYE A;  1NPP A;  3BDU A;  3QPH A;  3JCM W;  4B9X A;  3BDL A;  2YLC A;  3V8J A;  1Q86 C;  4HCC A;  4MZP A;  3CCJ A;  3LLR A;  4ZN3 A;  2M1H A;  2XK0 A;  4NL2 A;  4XK8 E;  4DA4 A;  2RHX A;  2YHT A;  5A2Q E;  2RI3 A;  2E6Z A;  5HK0 A;  3I55 A;  3QJ6 A;  3G4S T;  4BDY A;  1ZQ1 A;  2F69 A;  1U1S A;  3MEU A;  1WJR A;  1BIA A;  5A0D A;  3JB9 F;  4C92 E;  2Y90 A;  4J6Y A;  3CEY A;  1P92 A;  3L2R A;  3JCM J;  4PJO D;  1QP2 A;  2E70 A;  3VUZ A;  2XD0 A;  4RG2 A;  4C8Q F;  1JB0 E;  1OYX A;  2E64 A;  3HSB A;  2ZPB B;  3OW2 A;  1Y7X A;  4M78 F;  3HRT A;  3ZFJ A;  1KD1 C;  4C8Q A;  1Q81 C;  1Y96 B;  4J6W A;  4LDU A;  2ZCF B;  4BE1 A;  4GLK A;  3PTA A;  2RJF A;  1HXD A;  3URG A;  5GAN e;  2EAY A;  3FC3 A;  5A0L A;  2WSF E;  3JB9 J;  1VQ9 A;  5DLQ E;  5CKF A;  2E12 A;  1YI2 T;  1B34 A;  2P4T A;  3HFN A;  3BFM A;  1XNI A;  2LCL A;  2FVU A;  2CZ1 B;  3HRU A;  3LW5 E;  5KCH A;  2EQJ A;  1WJQ A;  2LCC A;  4NL3 A;  1X6O A;  5DLO A;  4N4I A;  2XDD A;  2GF7 A;  2K5I A;  2D6F A;  4TVR A;  1VQO A;  3PNW C;  4P5N A;  3SWN A;  1M90 U;  3QSU A;  2QDY B;  3CCJ T;  2DK3 A;  2LRQ A;  4C0G A;  5GMK h;  1QP3 A;  4M7A F;  2R57 A;  5C0M A;  1KHC A;  4FT4 A;  3EFS A;  2CYZ B;  3I55 T;  3TU4 K;  1KC8 C;  2JZ2 A;  3INZ A;  1PSE A;  4M78 D;  5CQY A;  1NJI U;  4M7A A;  2O01 E;  4OB1 B;  2X4W A;  3UDC A;  5IT9 E;  3WXM B;  1N9R A;  2LT1 A;  3ME9 A;  4M77 F;  3WVE B;  4EPC A;  3S3O A;  2RH2 A;  1S72 A;  1N8R U;  1NPR A;  4X9D A;  3ER0 A;  2MMP A;  3DKM A;  5IN1 A;  3M5A A;  3OS2 A;  3OYN A;  5GAM e;  1QVG S;  3OYY A;  2WSC E;  4GY5 A;  4UC4 A;  5GMK l;  5GAO n;  2CZ0 B;  2WAC A;  4ELZ C;  2V8J A;  4C92 G;  4M7D G;  1B34 B;  2DVE A;  3MO8 A;  4PKC C;  1KHI A;  1VQ9 T;  1KQS A;  3VJP A;  1YEL A;  4J7I A;  4JDS A;  3M4Y A;  4LD6 A;  4C0D B;  3JRZ A;  4QQG A;  3X24 B;  2EYQ A;  4OVA A;  5FU7 C;  2HNI A;  1LJO A;  5D6W A;  1K8A C;  2HAX A;  5CKH A;  2PUO B;  4OF1 A;  1VUB A;  3G7Z A;  1H3Z A;  4BD3 A;  4C92 C;  4M7D C;  3OYC A;  3OS5 A;  2MWO A;  4C8Q E;  1YJ9 T;  2ZPG B;  4JRK A;  4N4G A;  1XQH A;  3LYI A;  3OYJ A;  3FRN A;  3MP8 A;  4RKU E;  3RUX A;  1VQO T;  3X20 B;  1VQ7 A;  2E10 A;  1M4Z A;  2RK1 A;  4M77 D;  3E1S A;  2BKD N;  5LJ3 e;  2QA4 A;  3CCV A;  1N27 A;  1QVP A;  2BIV A;  2H3J A;  3FDR A;  4KUL A;  4MZM A;  4X34 A;  1UEB A;  3JCM f;  1VQM A;  1JJ2 S;  5LJ5 d;  3QHS A;  2RK2 A;  3FIF A;  2OTJ A;  2CZ6 B;  2XKO C;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...