1VEXA

F-spondin tsr domain 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
GSIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNEDLEQAEKCMLPECP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the first and fourth TSR domains of F-spondin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
molecule keywords F-spondin
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00090 TSP_1 Thrombospondin type 1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.100.10 Mainly Beta Single Sheet TSP-1 type 1 repeat Thrombospondin type-1 (TSP1) repeat 1vexA00
3T5OA 4HQNA 1VEXA 4HQOA 4A5WB 3VDLA 4HQLA 1SZLA 3VDKA 3R6BA 1LSLA 3VDJA
chains in the Genus database with same CATH superfamily
3T5OA 4HQNA 1VEXA 4HQOA 4A5WB 3VDLA 4HQLA 1SZLA 3VDKA 3R6BA 1LSLA 3VDJA
chains in the Genus database with same CATH topology
3T5OA 4HQNA 1VEXA 4HQOA 4A5WB 3VDLA 4HQLA 1SZLA 3VDKA 3R6BA 1LSLA 3VDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T5O A;  4HQN A;  1VEX A;  4HQO A;  4A5W B;  3VDL A;  4HQL A;  1SZL A;  3VDK A;  3R6B A;  1LSL A;  3VDJ A; 
#chains in the Genus database with same CATH topology
 3T5O A;  4HQN A;  1VEX A;  4HQO A;  4A5W B;  3VDL A;  4HQL A;  1SZL A;  3VDK A;  3R6B A;  1LSL A;  3VDJ A; 
#chains in the Genus database with same CATH homology
 3T5O A;  4HQN A;  1VEX A;  4HQO A;  4A5W B;  3VDL A;  4HQL A;  1SZL A;  3VDK A;  3R6B A;  1LSL A;  3VDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...