The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
117
|
structure length |
117
|
Chain Sequence |
RSAEALFEKAVTPSDVGKLNRLVIPKHHAEKHFPLPSSNVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGSDLDA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution Structure of the B3 DNA Binding Domain of the Arabidopsis Cold-Responsive Transcription Factor RAV1
pubmed doi rcsb |
| molecule keywords |
DNA-binding protein RAV1
|
| molecule tags |
Dna binding protein
|
| source organism |
Arabidopsis thaliana
|
| total genus |
14
|
| structure length |
117
|
| sequence length |
117
|
| ec nomenclature | |
| pdb deposition date | 2004-05-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02362 | B3 | B3 DNA binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | At1g16640 B3 domain | DNA-binding pseudobarrel domain |
#chains in the Genus database with same CATH superfamily 4LDY A; 1YEL A; 4I1K A; 4LDW A; 4LDV A; 3HQF A; 1NA6 A; 4LDX A; 1WID A; 4LDU A; #chains in the Genus database with same CATH topology 1N0E A; 4LDY A; 1YEL A; 4I1K A; 4LDW A; 4LDV A; 3HQF A; 1NA6 A; 4LDX A; 4LDU A; 3ZI5 A; 2C1L A; 1WID A; 1N0G A; 1N0F A; #chains in the Genus database with same CATH homology 4LDY A; 1YEL A; 4I1K A; 4LDW A; 4LDV A; 3HQF A; 1NA6 A; 4LDX A; 1WID A; 4LDU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...