The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
67
|
structure length |
67
|
Chain Sequence |
GSHTPDESFLCYQPDQVCCFICRGAAPLPSEGECNPHPTAPWCREGAVEWVPYSTGQCRTTCIPYVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase inhibitor
|
| source organism |
Hirudo medicinalis
|
| publication title |
NMR structural characterization and computational predictions of the major intermediate in oxidative folding of leech carboxypeptidase inhibitor
pubmed doi rcsb |
| molecule keywords |
Metallocarboxypeptidase inhibitor
|
| total genus |
4
|
| structure length |
67
|
| sequence length |
67
|
| ec nomenclature | |
| pdb deposition date | 2005-04-20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Carboxypeptidase Inhibitor; Chain A | Carboxypeptidase inhibitor |
#chains in the Genus database with same CATH superfamily 1ZFL A; 1DTD B; 1ZFI A; 1DTV A; 2ABZ C; #chains in the Genus database with same CATH topology 4HSC X; 1DTD B; 3HVN A; 3PJV D; 3G2Q A; 2ABZ C; 1M3J A; 1ZFI A; 3G2O A; 4BIK A; 1PFO A; 1S3R A; 3G2M A; 1M3I A; 1ZFL A; 3G2P A; 1DTV A; 3CQF A; 3IF8 B; #chains in the Genus database with same CATH homology 1ZFL A; 1DTD B; 1ZFI A; 1DTV A; 2ABZ C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
