3HVNA

Crystal structure of cytotoxin protein suilysin from streptococcus suis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
468
structure length
466
Chain Sequence
b'DINQYFQSLTYEPQEILTNEGEYIDNPPATTGMLENGRFVVLRREKKNITNNSADIAVIDAKAANIYPGALLRADQNLLDNNPTLISIARGDLTLSLNLPGLANGDSHTVVNSPTRSTVRTGVNNLLSKWNNTYAGEYGNTQAELQYDETMAYSMSQLKTKFGTSFEKIAVPLDINFDAVNSGEKQVQIVNFKQIYYTVSVDEPESPSKLFGTTVEDLKRNGITDEVPPVYVSSVSYGRSMFIKLETSSRSTQVQAAFKAAIKGVDISGNAEYQDILKNTSFSAYIFGGDAGSAATVVSGNIETLKKIIEEGARYGKLNLGVPISYSTNFVKDNRPAQILSNSEYIETTSTVHNSSALTLDHSGAYVAKYNITWEEVSYNEAGEEVWEPKAWDKNGVNLTSHWSETIQIPGNARNLHVNIQECTGLAWEWWRTVYDKDLPLVGQRKITIWGTTLYPQYADEVIELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of cytotoxin protein suilysin from Streptococcus suis
doi rcsb
source organism Streptococcus suis
molecule tags Toxin
total genus 98
structure length 466
sequence length 468
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01289 Thiol_cytolysin Thiol-activated cytolysin
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 3hvnA04
3.30.1040.20 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3hvnA02
3.40.30.40 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Perfringolysin 3hvnA03
3.90.840.10 Alpha Beta Alpha-Beta Complex HIV-1 Reverse Transcriptase; Chain A, domain 3 Thiol-activated cytolysin superfamily/Thiol-activated cytolysin, alpha-beta domain 3hvnA01
1M3IA 3HVNA 4BIKA 1M3JA 1PFOA 4HSCX 3CQFA 5CR8A 1S3RA
chains in the Genus database with same CATH superfamily
4GQFA 4GW5A 2QFPA 3SDXB 4O5UA 3WFDH 3KP8A 3AROA 1I4FA 3EYSL 4LEXH 2EECA 2PYFB 3FH7A 3TPKA 1JOIA 4QLWA 2ZXEB 1XCXA 3LPOA 3UVHA 1T83C 4JO1H 2O8VB 1OPGL 1FLTX 3BFWA 2WHVA 4MQSB 1FVDA 1IBFA 2C7FA 4LCUA 1ORSB 2WBKA 5EVOA 5CUSL 1XVQA 4NWYA 1UZ8B 1TQCB 3ZL2A 3BKYL 3FT0A 4JQVC 2FR4A 1VF4A 1QBML 4DUXA 4LA1A 4QJ3B 3Q5OA 3TIEB 5I5IA 3TYFB 4YDIL 3SJVB 3ZHDA 5C3TA 1J8HD 4D8OA 3GRWH 2EDLA 4G6ML 2X9WA 5IB4B 3QXDA 2G60H 3PWLA 3LNFA 3AS3A 4Y9GA 1RKRA 1T5XB 3FU7B 4Z78A 3FU0A 1MDAA 1BW8A 2W81C 3RX5A 3NCWA 3MLUH 5EZJA 3B6SB 5D70L 2YEZB 3KMOA 4YSPA 3VXPA 5DFAA 4KI5D 4YSUA 1ZV5A 1IU1A 3MRIB 3PGFL 4PB9H 5CM1A 5MHSD 2FTAA 3Q48A 2PMZA 3LEXA 4QRQA 1KCVH 1YYCA 3LZNA 5C09B 2KZBA 3SPJA 3X2QB 4N2BA 5HP5A 5DQSA 5TQ0H 5DZNA 4X98B 5EZOL 5L4MA 1JZOA 2N0MA 1WFUA 1WUZA 2VDLH 3CVIL 3IDJB 2BNQB 3MA9L 2XUWA 2OSWA 3ML9A 3BZ4B 4OZ4A 2RQEA 1MDIA 5MP6H 3NIGF 2WUBH 2BHFA 12GSA 3D18A 2BIHA 4FNQA 2R2BB 1NICA 1Y18B 1CICA 3FB8B 4WFHE 2AYTA 2DIYA 4WK4B 5E1AB 4PS4L 3UPCA 2ODHA 4R97B 2GJRA 3FO9A 3LKRB 5TDNB 2NCMA 4XBMA 5AZ2L 1N2AA 2YWNA 3LYKA 4CW1A 2R9HC 3LXAA 3TV8A 3IJ7A 5C92A 4Q9RH 3AQDA 5EZIH 4M7LT 2NYZA 4KI1A 2GK0A 2OQJA 1XD0A 2PWGA 2NZ1A 3L5HA 1LK3L 4RGMB 4X4XA 4UOJA 5LAXA 1PX8A 4UOW0 4ZXBA 1RULL 4E41E 5ABDE 2EDTA 4ZMOA 2ZCLH 3JVFC 3QDME 3V10A 3LPWA 4PJXA 2EIZA 1QSEB 1EJ6A 4GSDH 3TOUA 3EJTA 2NZIA 1U4FA 4FP8H 3PREA 5HGBB 2DLGA 3DROB 5TGBA 2WCGA 4A2GA 2E7HA 4FN0A 4PJDF 4UYQA 4GG6A 4UOQA 3LPFA 2Q86B 1M4KA 2O6DA 1QYGL 3RIKA 1EMTL 3F2LA 3LB6C 3FU9A 1IT9H 2E7BA 3EOTH 3GA4A 3P73B 2ROYA 2XIIA 1BVKA 5IJKA 4L0UA 3VXQB 3UTTB 1G7IA 2B4CC 2V5MA 1WZLA 4G1EA 1QSFB 1KXVA 1BZEA 1N64H 2DWEB 4HGKC 4JG5A 1UYWL 2I25N 2ZXQA 4O51B 4AH2A 4WTXA 4UUJA 4X9HA 4X8CA 4JFXA 3IOSA 3BAIA 3TWCH 3DVGA 4KROB 3KLAB 1ZXKA 4QGYA 4FYUA 3D3VD 1E5UI 2RCSL 3UG5A 5C86A 3ULVF 4OV5A 2CX4A 4DEPB 4XH2B 4MJBA 5CWSA 2IBBA 2IBZY 5D1QA 2MTPA 1WFMA 4XNAA 4AYBA 1NUDA 5CMAA 1P9MC 1B4JH 2V0AA 3KLLA 1HJCA 3EO0A 2PP9A 4YOKA 5E9AA 4PIRF 2H32A 1G94A 1Q90A 1H8SA 4JO4L 1EP7A 4NXKA 4KRPB 2LLNA 4LCWA 4QGTA 2LVEA 3ZN6A 1LNUB 2CSPA 5IQOA 4OFMA 2G30A 2YAMA 3ZBMA 4F7MA 4BV1A 3SDXE 4M29A 2OS7A 1XIWB 2WXKA 5AKRA 1OSPL 1P4IL 4KJYA 3CBUA 3S8WA 2JQMA 4RMUA 3MRPB 4GNKB 1S7UA 2IDTA 5T3ZL 5FLVA 3VD9A 3N9GH 4F2IA 4J5VA 3MLVL 4NPKA 2VM2A 2IH3B 1U3ZA 1P6WA 4HS6A 1N10A 3C6LB 4ZD3H 1CG9A 4HQSA 4UQ9A 3CC5B 2DKIA 1ND0B 4FXLA 4BK8A 3TB2A 1CBVH 2OI9B 4YQUA 3SJVE 1OM3H 4CVZB 3GI9H 2VMDA 4PREB 4U6XB 1BXAA 3D69B 4H8PA 4Z7AA 3A4EA 2OXHA 2IWFA 5DF0A 3RVXD 1JGDA 3ULVC 1C72A 1LEKA 3UIWA 4NQCA 3F3RA 4MZ3A 5D7EA 2W80C 3QWOA 1LBKA 2J2ZA 3GBNH 3IFLH 3QXAA 2R56L 2YGQA 5FC9A 4EPSA 4NHCH 5T1MB 3EZ8A 4KDTA 4APQA 1X7SA 2J8UB 5F3BB 3MAWA 4EUPA 2HSHA 4UV7H 1WS7A 2X41A 4K4KA 2ZP0T 4FQ1H 3V4PH 5L2JB 2VERA 2YPVH 3S9FA 2EXWD 3GMRB 2HVBA 2DWDA 3NEOA 4F8LA 4ZW5A 1VDGA 2BNQE 4NZFA 2WNXA 5JO5B 2MQ0A 2WJ7A 1OM9A 3L5WA 3GNMH 1QSVA 4G6KL 2ZD0A 2E7MA 4M6MH 4PRPB 4A7SA 1SJHB 1PDKB 3H9SB 4Y7OC 4GI9A 4TUOA 4UNTA 3RVTC 3ML8A 4X7SH 5AIVA 1FCGA 2C4JA 2A4ZA 3CLEH 2NPLX 5TJWK 2QKSA 1FPTL 1VRSD 5FYLE 4FG0A 1N26A 5D2NC 5FCUH 4E0RB 3O6KL 4MLYA 2QHLA 1XTMA 3VQ1C 3CXDH 4UQ3A 2AGJH 3FQNA 2X9YA 4OFDA 1ZOXA 3FO0H 5FW8A 4J3OD 3K0WA 1E4WL 1F2QA 2FQEA 2X2IA 4EVNA 1C8PA 3EGXB 1PLGH 2IPUG 2XVBA 1QSEE 4RGND 3HE6A 5F72S 2X4UB 2DTMH 4Y5XC 1OLZA 4MZBA 4CY6A 1ETA1 2G4EA 2WCPA 3U0WH 4LP4A 4FNLH 1GGIL 1CUOA 1MWAB 4OLZH 3WDJA 3ARED 1N68A 3RGVC 2WWOA 1TZ8A 5MEQA 4MBOA 2K6YA 5D2LE 4G0LA 3ARZA 4RBPK 4H7VA 1ADQH 3WTUA 3FU8A 4U0RC 1KTCA 2OE0A 1BREA 4EN3C 4MA1B 4G7VL 4PWHA 5DMJB 3N41F 3M9KA 3OGOE 3KW7A 2BTOT 4JPQA 4YSTA 1HQ4A 2JJTA 1ZT7A 5EU3A 5F1NA 4EIBA 1WH0A 3UTTE 1J5OL 2ZUQC 2V17L 4UM8A 4UDUA 1U58A 5DS1A 1GTBA 1KV7A 4MQTB 1SY6L 3C8KA 3D52A 4JUTA 3US9A 3QIWA 4F1ZA 3TC9A 2ZKYA 1K4DB 5CJOH 3NA9L 3VXSB 4DVCA 1QLEH 5DK3A 1Z9LA 2C9QA 4YR6B 4E9SA 1DBKH 4OLYH 1PX4A 2WOYA 1OE2A 4PH8A 1T20A 1I9EA 5E23A 5IK3A 1C16B 5MERA 3ME8A 3RDTD 1Q9LB 4UQ2A 4WAFA 1HJBC 4L8SA 2R59A 4HV8A 4MASA 5HYJD 4IKJA 1OP5K 2RAMA 1C7SA 2ZYSA 5DJ0A 2M80A 3KPTA 1T4KA 2WNGA 4HX1A 4MA8L 5I1KH 4POUB 3SGJC 2HTKD 4ZS6C 3KWWA 1H8LA 3RPPA 2VDPB 4OM1H 4YHZH 3CU7A 3U7YH 1OAUL 2PABA 4AGMA 5HJBA 1KCBA 4BSVA 2XIBA 5FO9A 2F6AA 5HYQB 4LKCA 2E7CA 2CRIA 4J6RH 4JJOA 4BINA 1HEZA 4IRJD 1ZLVK 3R3EA 3OKMB 2C4FT 4GKOA 2ES7A 2HSIA 1RU9L 5DEFB 5FB8B 3WOVA 1RQ5A 3BAXA 3P3RA 2VXQA 3Q8EA 2YRPA 3VXMA 1JFUA 4BWWA 5C0EB 2MKLC 1Z5LB 2WO2B 4E9TA 5AG9A 3GBLA 1GGCH 4H26A 5LCVL 3N44F 2P8MA 5CLXA 4PJIF 6GSUA 1JGUL 1OP4A 5BQ7B 1F97A 2CM5A 3G9BA 5E94A 3EFOB 3VWKC 1MFMA 3MLYH 4F8TA 4JANA 1KG0A 1KLUB 3HG3A 2X44D 4PD4J 4PJ5B 5C70A 4R4BB 4RLDA 5CJQH 2DWSA 2FB4L 3BSHA 2ARJB 1MFVA 2EDOA 5EFIA 1G9ML 5C0BA 3OJDB 2KDGA 2AQPA 3HEIB 1AZNA 2OXGB 4PRBB 4KZ0A 3O6MH 4E42B 3ULUF 1CDCA 3IKCB 2GSIB 4U6YB 4G8FB 2E27L 3H55A 4PJDB 5INDA 2ATKB 2PO6A 2B08A 3IFNH 1E27B 1K6QL 3ARGA 4PG2A 2BIPA 5EOCL 4KGIA 1YN7A 5C0CE 3A23A 3BHBA 3VNYA 4YXHH 4PRPE 4UT6L 4DP9X 4PCYA 4JEGB 4N2IA 3H9SE 1VZGA 1NC2A 1OQXA 4QDGA 1ZLWK 4J2QA 4I1RA 4F9LA 3LKPB 1EZKA 4MRCA 2EDWA 2V8LA 5CIPB 2CDEB 3MR9B 1ZYEA 2GJJA 3FMWA 4M7ZB 4NI6A 5HDBB 5AQ0A 3CHQA 3T4YB 1CFTA 2YHGA 4OZIF 3DRNA 3K7UA 3PFUA 5C07B 3ETBJ 1U93B 5GHWH 4Y4FC 1EZLA 2APFA 2M1KA 1BZ9B 3QE5A 3DSNA 3FFCB 4A7GF 3OQRA 2A4HA 1U9KA 5A7EA 1JGEB 3LJ3A 3KJ6H 3O8XC 3OAUH 4GQ9L 2OYPA 4HWEL 5E8NA 3QUHA 1NGWB 3TYGL 3NQIA 1Y0LB 2OKAA 3KNBA 4D73B 1K3OA 1JS4A 2J88H 4HHAA 5IMOA 1URZA 1E9QA 2B2XL 3VRLF 2K7PA 3ULUC 1YHPA 5ANME 4Q89A 3H7BB 3ZQWA 3INUL 4L8CA 1UCTA 3HVXA 1O9ZA 3SKMB 3IJYA 3PABB 2X70A 4BZ1H 3VFIA 4PGZA 2W1NA 5ECKB 2QGDA 3G6DL 2LU4A 5ECNB 4K5PA 3ZHKA 2VC2B 9PCYA 3CNKA 1THOA 5ALBH 4EDWL 3TA3C 1ZHNB 3EBAA 2DYSB 2W65B 1GHFL 1LO0L 3I9GH 3HHSA 4RRPA 5DD6A 3LEYH 3QRLA 5J6HA 1JZRA 4GRWH 1MCRA 3UXFA 4NCC1 4X7EC 1I8UA 5G5DB 3CHRA 3N9JA 4F03A 3HLAA 3KLHD 1DQTA 1BQ5A 3RRQA 4P9HL 3VXSE 2XTJD 2F54D 1FNHA 5D2NB 1QLFB 3GJEB 5L6YH 2H1BA 4BK5C 4KNSA 1FRGH 2Q20A 3M46A 1R6VA 1UD6A 1JP5A 2DKMA 3PV7A 4YHKH 3S37L 2ZPKH 4OTXH 3C5ZD 2GTWB 1KYAA 5JOPE 4MDJB 4W9KC 4OGAC 2RMNA 4FA7B 2VDNH 4Y2NA 1KBGH 1YDKA 3F65A 4FXKA 1B4QA 5E2UL 3D2UB 5HTSA 3Q74A 4X4KA 1I7RB 5F7AA 4Y5XB 2OMUB 4C4BA 2AXHA 2AQRA 5ABAA 4HIHA 1T7VA 2R0KL 1E2YA 1FYTA 1LQBC 1CWVA 2F9BT 3RGVB 1N0LB 3NN8A 4EMZA 1EX0A 4C4UA 1KULA 4U0RB 4N3UA 1QQDA 4ZPTA 1CN4A 4EN3B 5CRGA 3VD5A 1ERVA 3AU1A 1NCBL 4PWFA 4WKZA 2OJZL 1AZZC 4X9FA 2CO1A 1MVFA 5GRUH 5IFHH 3RUGA 4CDOA 3LDBC 3HNVH 1FAKT 5C0IB 1CURA 2BINA 2JKWA 2ZUQB 4XOAA 5EEWA 4UOZA 1B0RB 2BW5A 5AZEH 1JHLH 1VGEH 1OEZW 1CIDA 4K7FB 4BYHA 1CLYL 3R0MA 1A47A 3BO8A 5F7DA 3KR3L 3QAVA 3FPYA 2GJPA 1MFEL 1MCKA 2N5BA 2DF3A 5C0AA 3TO4A 4IOSA 2BIOA 4PJ5E 1KEGL 1ZANL 2R3XA 2MCMA 2WLZA 4PB0L 2WXJA 4WDIA 5AYUL 2YWOA 4TNVK 2Y7QB 2Z4QB 4TQEL 4UTBL 5FOJA 1TP9A 3F4RA 1VZIA 1N5AB 3E6FA 5AVTB 5KYYA 2PGTA 3UP1A 4ATTA 3ARDD 3ARYA 2P42B 3K6OA 3QWRA 5ECRB 3GUTA 2X53A 4FFYH 4HXBH 4PJ8C 4JZQA 2NY4C 1F58H 1YPZB 3MRFA 3I50L 1XWBA 2JNZA 4MJ6A 4ZMYA 4DGYH 3MGTB 3TJPA 1MFNA 4AJWA 4CU8A 3T65B 3N41B 1D7CA 4AYEC 3L5XL 1MI5D 1X4ZA 1T1XA 3CHOA 2WXFA 2BSEA 4OCRH 2CXKA 4AW4A 1XGUA 3GSNA 4BPYA 1JN6B 1MCPH 2DWXA 5HDBE 5JHAA 3W8JA 3DMLA 1JUFA 4EO5A 2IDSA 4UAOC 4ZK8A 3T2LA 4K0GA 3VO0A 2R0ZH 3FFCE 1SQMA 5IUCA 1MFAH 3HTLX 2NXZD 3IFOA 3VWKB 3D0AA 1XGYL 4QXVA 3GSVB 2J6WA 3QDGB 4G9FB 5EORL 3D12B 1RSYA 5DQJA 1D5MA 3RX8A 2PVOC 4PQXA 1FC1A 3QZWB 4WLCA 4X5WA 3DJZA 3VCLB 1KFAL 3M45A 1TKWB 2P43B 4NQEE 5JLZB 2IPKA 2YFNA 3D85B 3ZUNC 3D6GA 1AHWB 4XBGB 2UY6A 1EVTC 5IQ7H 5G30A 1HHHB 3KPPB 5AN1A 1MRCH 2D3NA 5F0GA 4HIJA 2A6DA 3ALPA 1IEAB 2XBDA 4ZAKD 4XWOC 4M8QB 4PV9A 1RUQL 2Y2WA 3AUVA 3CMGA 5C08A 3GS4A 4TSCH 4NV2A 1ZCRA 3KPOA 4H1LH 2FQDA 4KDUA 2XQYK 1B4TA 4Q6KA 2YFOA 4JR9L 4KVNL 4NRYB 4NQDA 1MFBL 5FUZL 4EDXA 2V7HA 2PPFA 2BSBA 4NNXA 1XB8A 5EU5B 5DVBA 3PWPB 1EQWA 4LVHC 4GMSH 4HG4K 2WB9A 1T5WA 1K9TA 1ZA3B 2GKIA 3B2UD 1BJ1H 5A4VA 5D2NE 3S7GA 1A4BA 3ROOA 1JZDC 1WWWX 3TZVC 1T00A 4G83A 1M7DB 4ZQKB 1FL5A 2CUMA 4Y4FB 3JV4A 5ACZB 3NFPA 4OKDA 2W91A 4PQ1A 4X0KB 4V1DD 3O8XB 2GSMB 5KN5B 1KGUA 1TZHB 3BXNA 4J7RA 2CBTA 4K94H 1H3XA 1IGTA 3DTXB 1M1XA 2NW2A 5HGAA 3ZE0E 4NUMA 2D7TH 1YN6B 3WGVB 1RLWA 1ILOA 1P53A 4TSAH 2EINB 5EOTB 4XZUB 4RQXA 1MCCA 1X5DA 4IQAA 5C04A 4XXWA 5KANG 1KIQB 2HT3C 3KYNB 3ZDXB 3GC3A 3CH1A 3KCPB 4U1NB 5GGUB 5K1JA 3T6WA 3WD5L 1Q0YL 1VCAA 3GKZA 1WTLA 3OWRA 1T66C 1G7JB 2GT5A 3TA3B 3VTAA 5DUBB 4G7RB 1FH5L 2BNRD 3BH9A 3WHE1 4JPIB 3VFTB 1WIOA 3G6JF 3K6DA 5F0PB 2DEWX 1KXQA 5FGBA 3KLKA 2FO4A 1DANU 4L05A 5ID0B 3N1QC 3DXAE 3ABMB 2ZCKL 1J48A 1Z5YD 5PAZA 3C71A 4IOIB 4OZIB 4ONFL 1QMVA 2R2EA 4DT2A 4IK6A 3IDVA 4LPTA 1ZE3C 3TV3H 2APWA 2Q3ZA 1EJOL 1T1YA 4AVJA 2N7SA 4X6CF 5D7HA 3MAKA 1JYXA 2DKHA 1URIA 3QZMA 2AEWA 2B1AL 3AQZA 3MNWB 3QIUC 4NP4L 3UGEA 4MJ2A 1TU7A 2VLME 3O9WC 4HJGB 1Q4JA 2Y06H 4HS8L 4X83A 1YPZE 3FT1A 3TEWA 1E65A 2C26A 4F93B 4GW1B 4JPWH 4G43B 1AAJA 4MX7A 1THAA 3E8VA 2SODB 4H88L 4KO5A 1LO5A 3UAJA 1MH5A 1A2YB 4UMSA 1HYSD 2FGWL 5CZXC 3FT3A 3ZRSA 2X6MA 5GZZB 3B4NA 2Y1YA 2GHWB 4A7GA 2IG2H 4XMTA 2KERA 4U6VL 3UBXB 4ZFOA 5IW6A 5HHOD 5KN3A 1LO4L 2X1XR 3FQRA 4P99A 2JIXD 3UERA 3LDBB 3FF8A 3QO0B 4MKMA 2KDYA 4ANXA 1ZTMA 5LLIC 1URMA 1I9RL 1BX2A 7PAZA 5L2KB 5AAMC 3QQXA 4O2EB 5KSVA 5FK9A 5IESH 3MNMA 5C0RL 5CD5C 1TO4A 3NK3A 3TBVB 4Q0XL 1GW6A 1XVSA 2BP8B 1JVLA 3QDGE 4G9FE 3NACL 4N1HB 2ADGA 4OZHF 5CN1A 2Q10A 3JWOC 2PWHA 2H0PA 4ELKA 2HFGL 1CXFA 5ITFA 5DCGA 2AK4A 2W0FB 5CSZA 5EZPA 5ICXB 1NMCC 1TJIL 3FR9A 3BSGA 4PRNA 4I2XA 3HNTL 4WUUA 3VXUD 2EZ0D 3F3QA 3MOAL 4ETQB 4JG1L 1UB6B 3J27A 4PJ8B 2AZUA 2PWJA 2QL1A 3I3EA 4ZRGA 2P80A 4N9GB 4TUKL 1FCCA 4JDEB 2R0LH 4HGMA 1M57B 3EJPA 4QRSA 1DDHA 2DQDH 3H3PL 1E4XI 1RPUA 4ZUSA 2R8SL 5FV2A 4I87A 5HY9A 3W2DH 2TIRA 1ERNA 3JUYA 2PXYD 4KPHH 2R27A 5AKSA 5IBLC 2OL3L 1Z5HA 4ZYKA 3EINA 2WSKA 1OK0A 2HLEB 1NC4D 4K0OA 4ODUA 1W6LA 2C34A 2Z6FA 4LP5A 1GCFA 3ETBF 4FQCH 5F1IB 3P3TA 3LHPH 1EO7A 3MODL 4NZRL 4QAWA 2IV9A 5JCUA 3TEZA 3V0DA 4I3SH 4DP1X 4MNNA 4MS8D 1A7QH 5I8CA 3IGLA 2L59A 4UAOB 1ZL9A 2OR7A 2JZRA 1AS7A 5B7CA 1JF1A 1NCAH 3POCA 4CDHA 1WRYA 2GB2A 2JLPA 4WW1A 1LMKA 5J4MA 3E3QC 4FZ8L 1B2WH 3FCSA 5FUOL 2YK1H 2JB6A 4FLRA 4F2MA 1HXYB 3VYNA 3B2DC 4OM0L 5ECLB 4FFZH 4W68A 3BD4A 4PU2A 3S34H 4L0YA 1G9NL 3M1GA 5B8BA 3PYCA 3CMOL 2KPNA 2EP6A 3KH4A 2WTRB 2XY1A 4HFUH 3ZDXE 3KXFD 4Z0BH 1SLUA 1YF0A 1T04A 2EDDA 5DZPA 5FYJU 1SNRA 2IJ0C 3GO1L 2W9EL 4K8MA 4LL9A 4L5OA 3RVUC 5E4AA 1PX3A 3I74A 4M61A 2WVTA 2PCFB 4NPYB 1R1CA 3SQRA 3FUFA 3FXIC 5DMIL 3V4UH 4JO2L 4UANA 3E1F1 5AEAA 1N4XL 1BMWA 1YEIH 2BK8A 2EKSB 4LVHB 1O73A 4QXGL 3IAGC 1M56B 1QD0A 3IMTA 2WS2A 2XPZA 5AKTA 4B9IA 3NOIA 2VXVL 3RY6A 1QACA 1CMOA 2W60B 3C60A 3S3JA 1MEXH 4EBQH 4ZMVA 3W81A 2FATL 2ZUXA 4QRPA 4X4ZA 5G4OA 3ECQA 2D7MA 4KKAC 2EILB 4X9IA 3WIFA 3L8QA 2CZNA 3RKDD 4JQXC 2Z31D 2Q9OA 2XWXA 4L4VB 3BKML 2B5YA 4LKXB 3S96A 4MNQE 3VFPB 4XPHH 43C9A 5IVXF 3ZW3A 5JR1H 3MRBA 3GSUB 5EEXA 1IGYB 1E6BA 1DJSA 2EXSA 3APNA 4X99B 1A6UH 5CZKA 4JFYB 4R7NA 3M17A 2P48B 2ZOWA 4YK4C 5A16B 2JZTA 4GXVL 4KUCD 4G7YL 2W0LA 2HRPH 2PLTA 1CYXA 3VGHA 3ERWA 2R4RL 3RHWF 4NHWA 1MLBB 2HN7A 1YAZA 4NKMB 3D4GA 2R0WL 4N0FB 3V52H 1ACYL 1A0QL 4TM9A 4UILL 4JFFD 3NFSH 2D0HA 3BESR 4I0CC 4LCYB 4Q14A 4MJ4A 1MRFH 1E4KC 1GZQA 2CJSA 4P9ML 4PIBA 1TDIA 5DJYB 4C4KO 3KBHE 4GP4B 4C47A 4L0WA 4CADB 4PTTB 1NMBH 3MUHL 3UDWC 1DUGA 4FZEL 4ZMZA 3M3MA 1XW9A 4D0BA 4PR5A 4W9GC 1W72A 2AQNA 4I13B 3ZYOA 5FCSH 2JF1A 4YSOA 3H1ZA 1M7IA 1CL7I 2WMPA 2L5LA 5B21A 4G11A 4HMDA 4Y16D 5AL8A 1GS7A 1DLFL 3A22A 5J1SC 1PZ5B 3QIUB 4KI5F 1BQKA 1KT2B 2WGXA 3FOMB 4JLRB 2Z7UA 2W9LA 3QJZA 5BS0B 3MV8D 3O9WB 5EBMB 2ZWYA 4U3HA 1T3FB 4QXUH 3SO5A 2O6CA 4MF6A 2IGFL 5D4HA 1MW1A 4X7TA 3DYRA 4CNIA 5M95B 1WP0A 4WBJA 3S6CA 4WFGE 2DQJL 5JDJA 3EMXA 3GSRA 4EZJA 4OCXL 2DN7A 1KIRB 1T0NB 3WTTA 1BEXA 4AL8C 4WFFE 4XC3L 1FL6A 1L7TH 3Q8AA 5T5FA 1P6FA 4LMQI 1J1XL 2GIYA 2JXMA 1A7OH 4XHMA 4JMNA 4M4RB 5DLML 5ES4B 2G5UA 1JI2A 3HG5A 3WU1A 5IUSA 4JM2C 3H2QA 4QKXB 2NX5B 3IDGB 4IDJL 5IVOA 1TTGA 4WI0A 2DQFA 2KLSA 5IGXL 3H42L 3KYMA 4PRAA 3TT3L 5LGJB 5I76B 2OW6A 1ILUA 1JPGA 5C00A 5EPMB 2XFXA 5C0DB 2NTFA 4KI5C 1SUJA 4B9JA 1IVTA 4G42B 2DJ1A 2NY3C 3N43B 1NMCB 3QFJD 4FQQA 4MJIE 5HVWA 4LSVL 1CGYA 4LVEA 1XF3B 3GZPA 2BNUA 3KWVA 2GJZA 4U4BA 1YC7A 3UAAA 5IMZA 5HJGA 4I88A 1ZT1B 3IGAB 1WD8A 4GWRA 4Z9KB 1F11A 2XWTB 2WIIB 4PGBA 4KMLB 1Z0NA 4KF9A 4JHUA 3ZL4L 2K4WA 1P4LA 2J20A 5EUOF 2CKBL 5IMDA 1ILSA 1JPFA 1E6JH 4B5ZA 4CAGA 3WT1A 3QUML 4NO3B 4WI6A 3VA6A 3VRJA 2OE3A 3ES6B 1E4XL 5CBEA 1PG7X 1QO3B 1R7HA 3MLXL 1ANUA 2MCG1 2H3NB 2WO3B 1L0XA 4HUWB 2VR7A 4KTGA 1AQKL 3QPKA 3WFZA 3PV6A 2OFQA 1NCCH 4IS6B 4J6IA 1IBDA 1J10A 1TEGA 1XMWA 4CVWA 1U95B 1B0WA 5HHPA 1JMZA 5ID2A 4OD2B 3P9LB 4JPKH 4AIOA 4U6TA 3BCKA 4JFSA 3CBRA 1UQSB 4HQQL 3DOIA 2DJUA 3PHQB 2FK9A 5ESQB 1DQQB 1QRNA 1ES0A 4UM9D 5IQLA 1R3JA 1A64A 5E6ZA 3R7QA 1IYHA 3TONA 3MYJA 2P3YA 5KVDL 1I3RA 1FO0B 4WI4A 1M7XA 1AQDA 1JCKA 3NZSA 1I9JH 2YZHA 2Y72A 1DJYA 1TFPA 2FEDD 3WS3A 5PCYA 2O5ZH 1LXMA 1YSOA 2RB8A 3PWVB 4W81A 5GGVY 8FABB 3FU6A 5DWPA 1BYOA 3HIZA 3G2MA 2V2TA 4NI3A 1F3DH 4K3DH 2DMLA 3PQYA 3F0IA 2XACC 3GD1C 1FNSL 4MSWB 3HPLA 4PYGA 3OD3A 1NEPA 4DW2H 3WGUB 1F3JB 4I0PA 2WINB 2WKGA 1I1YA 4DNLA 3G7IA 2Z92B 3P9MA 1NGZB 1F4YL 1A5FH 3PDDA 2R1XA 4JFDB 5LGHH 1SL1B 1SDDA 5KSBF 4LEOB 2DQTH 3OR6A 1N12A 4JZNA 2OMYA 1AIUA 1S7RA 3AAZA 3GTVA 4WJKB 1HI6A 1T22A 4HW6A 1R19A 4WHYH 3N3EA 5BS0E 1F5WA 3QW9A 3IVKA 3IC4A 3RAJL 1RZQA 3I75B 1CR9H 1WJ3A 1ET5A 3C5SB 4NC0B 4LL4B 3BWZA 5BZDB 4YK4B 2I9TB 4I2UA 1IBHA 5AB0A 4IBWA 3BPCA 3WUZA 4WHTA 3GKNA 1A0RP 4ZBBA 25C8L 1KGYE 5EO0A 1RIUH 1AOHA 4POMA 3BCIA 3IU4H 2DQEH 2VCXA 3TIDA 2DQUL 4Z3HA 1DFBH 3UTZB 1R5PA 1OB1B 3II1A 4N0YL 4NN6B 5KVFE 1E5CA 4NX0A 1U3NA 3ELAT 4ZW3A 1XVWA 1JVKA 1Z9PA 1HCVA 2X99A 4HHGA 4Y1TA 3TPUA 3FO1B 5F9JB 5JIIA 2VDKH 3SPVA 3CV5A 4D2NA 5JZ7D 2V9RA 2YSTA 1OGPA 2PYEA 4XBEL 4XP4L 1EGJH 3WFBH 2EDEA 2NX5E 4Y8AA 1KCKA 1MCHA 4J3OF 5F96H 4IGBD 3L5JA 1A24A 5IVZA 1A3LH 4ZBAA 1T1ZA 2C9PA 5J4UA 3P0VH 4MFHA 4AQEA 4WI9A 2FIKA 3QR2A 5IJKC 5LVEA 1UWFA 5IVXB 4KXDA 1GYVA 5T33H 2IFQA 1ZEAL 1KXVC 5D7IF 1JCVA 2EXWC 3DHPA 3QA3B 2OYKA 2B7DT 4WFED 1I1CA 4NS0A 4ONGH 1ML6A 5F88A 1GRXA 3DO3A 3DIDA 1UZ6E 4RI7A 2E8ZA 4JU5A 1PSKL 5LD0A 4NO0B 3STZA 3QFDA 3UBGA 2Z9TA 3Q01A 1WWBX 5EBWB 4EF0A 2Z8RA 5B38B 1SHXA 4PVBA 2VIMA 3I6AA 1B90A 1N8ZB 5E95B 4M9OA 5D4QA 1XF1A 3U36B 1SJXA 1R24B 1YF1A 2VDRB 2BSCA 4Q5QA 3FUJA 1BBJA 3BGAA 3IRPX 1M7UA 4ODVH 4HFWB 1D6EA 4X4MA 5DRZA 2O26U 5JXAL 4J3OC 3V0VA 3SBPA 2AEQL 1FDLL 1M9BA 4JM2B 3BISA 5KZCD 3FCTB 1SOXA 1FO5A 4B96A 2VAJA 6GSYA 2WXOA 1VFBB 1SF3A 2XQBL 1CXEA 2ZCHL 2NY7L 3FTYA 4HK0A 2CBOA 1MWOA 1WE5A 2NTOA 4OFYD 1QSZA 1FIEA 1N7MH 2GT9B 4QTFA 2R51A 2AJVH 3Q7JA 1PIGA 3A47A 3RWEB 3T09A 4Q5FA 4FA8A 3OPUA 1TU8A 5FA3A 5BMUA 2NY3B 2N56A 5IROD 4I8BA 3JTTB 3CDFA 2GDRA 5CJBA 2EVJA 3L6FB 4KJPD 5E59A 4JE4B 3GYRA 5H94B 3NJIA 2Q8AL 5FX3A 5F0JB 4DKFL 1AD9A 5FO2A 3CVCA 3PL6B 3WUWG 3BKCL 3IDNB 2CIKA 3V6OE 5B8CA 5IB2A 3OJMB 3VYPA 3MVSA 1K2DA 4N0CD 1I7TB 3HG1A 5DHYB 5BW7C 4NC1E 2GFBB 2AZAA 4LLWA 2WZPA 2GT6A 3MLRH 4FCHA 1DQML 3O0RH 3QQ9D 4MNGA 4H25A 5IEHA 4KDTC 4APQC 3IHQA 1SL2B 3P77A 1K5WA 2VSKB 3RY4A 5I71C 2YO3A 4L8DA 5JUEH 2J6EH 5LGKA 3B8YA 2EXYC 3BVTA 1NM4A 1BXXA 2PCPA 4W9HC 3BJLA 4G5ZH 2R4VA 1U8JA 1F4AA 1ODAA 5BPPA 4GW5B 2ADFH 4P2RA 2H0JA 5IB5A 4YPGA 5IW1A 2FCHA 1MJUH 2PWDA 5JQ6L 3RDTC 4LRNL 4N2NA 5AVQB 4B6ZA 4DN3L 4Z8FL 3KPSD 4U1JA 5L0QC 1U92A 1O0VA 4X80L 5J1AB 4YGVA 4I6XA 3FRPB 4PS7A 5G2NA 1FVDB 3DNKA 3QYMA 3CHPA 4O7HA 4E9YA 4XAWH 3WFDL 3MCLH 3FS9A 4YJZL 2X10A 2H1XA 4XPGL 4TN9A 2FR4B 5I82A 4QPEA 1WCBA 4F37F 4EE0A 4NQSA 4E9LA 5KVGE 4IN0A 4KFZC 3HJ0A 4WO4D 3GHBH 4QAMB 3WHE0 1ZV9A 1E8WA 1MW2A 5DD5L 1BXUA 2UZPA 1TQTA 3BGMB 1PL2A 3L7EA 2ZIDA 2R37A 3TBSA 5D1XD 5DK2A 3HZVB 2YQ3A 4LDLB 3GURA 4EQ3A 3BX7C 5ECPB 4OIIH 3X1FA 1WYJA 4WEYA 2VLJD 2A9NL 4W93A 4CN6A 2HFEA 3UTSE 3C73A 3HE6C 1EBPA 2WXMA 2OE1A 1RP9A 5FHBH 2H0GA 3GRWL 4MLIA 2X38A 1G7PA 1TSHA 3QJQB 4MXQC 4Z7NE 1F42A 3PDOB 2LV3A 1MWAH 2LGNA 4NDMB 5TF1H 3LNGA 2CAKA 4LNRB 4NZJA 5HHNA 5IBUG 5KOWA 5G4MA 1UENA 4QRQB 1FFPA 1SY6A 3LEXB 4DOHB 7CGTA 5IHZB 1J5CA 1V57A 3SGEI 3MN8A 3MLUL 5LBGA 4YBQD 4GEJA 3V0WH 3BW9A 4QOKD 1BVLA 4YLQT 2JJTC 1O7SA 3EGDA 3HJEA 4OZ4B 4J4PA 4PB9L 4WWNA 1KN2L 2QVIA 1X9WB 4OBRA 1KCVL 4NHZA 1A66A 1CICB 1WF5A 3EYQD 4Y19D 2P5WA 3ZTEA 3LTVA 5EUOA 2VDLL 1J5IA 2EIEA 1NBQA 2Y3NA 3OMZA 2DKSA 3FO9B 1P4UA 3I85A 1GGTA 3SDCA 1E2WA 5MP6L 2H3XC 4V2NA 2G2PA 1RXLA 1MQ8A 3RQ3A 3O4LD 4CW1B 4AKOA 2I5YH 3X12A 2OSYA 2GK0B 4K3JH 3PUCA 2OQJB 5LAXB 4X4XB 15C8H 4HI7A 3UO1H 3CVHH 4YE4H 2H7WA 3ZVVA 3CXGA 1RHHB 1AQHA 4PJXB 2OK0H 3SDAA 3VQ2C 3O4OC 2FSDA 4QXTB 2LRNA 3Q2LA 4ACTA 4Q9RL 4OUOA 2NSQA 5TGBB 2P47B 1JFHA 2XN9A 4MB5A 4EO3A 3GPSA 1WA1X 5MEOA 1UH4A 1JYVA 1BJ8A 1EEYB 1GIGH 1JYNA 3HUJA 5GIRB 4KBPA 3V4VA 2DDQH 4GSDL 5LCVA 3IDMB 4FLOA 4FP8L 1TSRA 3NT0A 3GSQB 3VXRA 1Z6MA 5KBLA 3LRGA 3D9AH 1L9QA 1JGIA 4OF3A 4CL7A 3NGBC 4N1CA 1BOGA 4TXOA 2J1WA 3CHXA 1WFNA 1G7IB 1OT4A 2I81A 3D07A 1HESA 1IT9L 2X9ZA 1QEXA 2QZQA 2FDBP 3FN3A 4AH2B 4UUJB 3EOTL 3QUZD 4JFXB 4PTSA 3DVGB 2ZICA 4S0TD 4OV6F 4BFIA 5T1LD 3SQOH 1CPUA 5CRWA 1OHQA 1UADC 3MBWA 1N64L 3VH8G 5IY5B 2ESVD 3AVEA 4NQXA 2QR0B 2FLSA 3TWCL 3S35X 3HS0A 4I5BB 2DL9A 1UM5H 2DYPD 3EO0B 3U1QA 4XTSA 5IM9A 5AISA 2EACA 2XTJC 3AABA 4UT6A 5DR5H 2FT6A 2MJWA 4L3EA 3PXHA 4QIRA 4HPYH 2Y7SA 2WB7A 1U8PB 3ERFA 3DJ9A 3U4EA 4NJ9H 4BCYA 4PG2C 4DJMA 5DS8B 4NM4H 4KJYB 1AIZA 4HS3A 1TITA 2V2WA 3KZ8A 3EF7A 5LBSA 2C8NA 3DMMA 1S7UB 4Q5RA 1WAAF 1BD2D 3NCJH 4KTDH 4U1KA 4WJG3 2JKNA 3ZT6A 3L9SA 4CHSA 3GFUA 2KUTA 2XX1A 3A4DA 4LPCA 4R5VA 2VLKA 3V9CA 1JF5A 4BGLA 5CIPH 4HS6B 2KL6A 3O6FD 5CINH 3V5HB 5LQBH 2YOCA 1D5IH 2FGXA 1OV8A 3PP4L 3B83A 5FGSA 2WP3O 3ULVH 3G2OA 1LEKB 4OQ1A 4NQCB 3SHSA 4D3CH 4PUAA 5T5NF 3TBWA 2MBTA 3HD5A 4HUKB 4ZD3L 1NDGA 1NUNB 5KG9A 3FUEA 4HIXH 1KCSL 2J2ZB 1KBNA 2AJQB 1CBVL 4PJFA 1OM3L 4B41A 3RX7A 1R9FA 3FTGA 4H8WH 1V7NH 4APQB 1XV8A 4W9FC 1KBWA 1HINL 1AC6A 3FTUA 4M56A 4EUPB 5I71B 3PIQA 4ZW7A 5GS1C 1BAFH 4LCIH 5GGQL 3CXFA 3EU3A 4X6DF 1CFVH 4A66A 4FIWA 3GBNL 3IFLL 4DOHE 3FO2A 1MIMH 1PKWA 4NHCL 1PG7H 2VLLA 2DWDB 5B39G 3WNJA 5DJ6B 3RDTB 5DGQA 1SXCA 2YBGA 3ARDC 3L5WB 3RTQA 3TJHD 3KVDD 4FL4C 5F7LB 1X5CA 1Q1PA 3V4PL 5BZWA 3B2XA 2Z35A 1FZJA 3INOA 2YPVL 4TUOB 2TSBA 3QEUB 4IRSA 1BDYA 2V3DA 1KB9J 4GSUA 5JW5B 2IAND 4ANUA 1PEWA 2QMKA 3WSQH 1QG3A 3D5JA 4EDYA 5KN0A 4NNPH 4OZFG 3KGKA 2H47C 2YAQA 4ANWA 2A9CA 4M6ML 5CNWA 1OXYA 1NAML 2WBWB 3X1BA 5AW7B 2YQ2A 3QPQD 4NEHB 4UQ3B 2V9UA 2VO5A 3FQNB 4X7SL 1PD0A 2CMRH 3CLEL 3OB8A 3UC0H 3RA7H 1WA2X 4N0RA 4QNPF 4MJCA 4YZFF 3IBHA 4EVNB 1F8TH 2Q8BH 1A9EB 1M53A 4PJXE 2A38A 5FCUL 3HE6B 2LW3A 4AEHH 5D5MA 3QZOA 3T0AA 3CXDL 2AGJL 3KPNA 3PJNA 5KJ4A 2IADB 3FO0L 2H70A 2GK2A 3EDDA 3FTWA 1GSFA 4GG6E 1ZHLB 4N90D 1AQVA 1INDL 3F5WB 1IE4A 4YC2C 4Z5RA 1PLGL 2PWEA 1BZ7A 3QUKA 5I1CH 2VZSA 4ICXA 2DTML 5AVVB 5ECIB 4RGOH 3DXBA 3HS9A 4TVPH 3Q6GL 3WYWA 3L3HA 3HS8A 1RP8A 2DQGH 2ZX9A 4FNLL 1HQ4B 4TMPA 4OLZL 1ZT7B 5EU3B 3OTTA 4GRMA 1XF5A 1UUNA 4JO3H 4UM8B 1PQZA 1PX6A 1YCSA 4KH7A 1U58B 3C87A 1ADQL 4P23A 3DO7A 2X4NA 4X5LA 4JQIH 5DO2D 3UTQA 1N2RA 5KSAA 1FIGL 1K3IA 4JPVH 1B0GB 2J44A 3FUKA 4OD7A 3FB5A 2VYRE 4Y4KA 4WU7B 4L4TA 1TT6A 1UJ3A 4O4YH 1JVOA 4XOCA 3WGEA 3ISRA 5I23A 3KBEA 4PJCA 3RWCA 5D1QE 3U7AA 3CLFH 2J56A 3IS1X 4XC1H 1CLOH 3LH2L 5MERB 1PFOA 3CSYA 3ET9F 3NFNA 5K39B 4Z3IA 5ENUA 4UQ2B 4HV8B 4CN1A 5TE6H 2X4PB 4LCWE 4HX1B 1DBKL 2F8FA 3MLWH 1WUNT 3DA0A 3O4OB 5JPNA 2H6XA 3JXAA 2YQGA 3K2UH 4D9QD 3MBXH 3HI6H 4N2FA 4BSVB 4JL2A 1RY7B 3V6FA 2Z1KA 4GT7A 5FO9B 2WQRA 3VE0B 1SUHA 5D96A 4OAWB 1NBVH 3DIFA 1SK2A 1MAJA 2NR6A 1TK0B 1SHWA 3NVQA 5E9DD 1HEZB 1KACB 3DBXA 4MMMA 2AXWA 3L5IA 2IMEA 3CMIA 4YHZL 3U7YL 3N2JA 1EHLH 1FJ1A 3NGBB 3QNXA 4M48H 4YFLI 1R34A 1YNKH 4J6RL 3I3BA 1YZZA 3O3AA 4HYTB 3FW2A 1B88A 4K5RA 3MKGA 1RI8A 4H26B 5CP7A 3ABGA 1DQKA 1JZ4A 2DJMA 4M5SA 1IVLA 3LH8A 4OI9A 1XZOA 4NQCE 1X5HA 1DUYA 4P46A 5J89A 2HRAA 2GJ6A 2XBQA 4JANB 3P8WA 1KG0B 2E6PA 2XKNB 3NZ8A 4YAVA 4WK2B 4M7LL 3WJLA 1GGCL 3GSSA 4P5TA 3M8OH 3MV7D 4HGWA 5CHNA 4N2HA 5EFIB 2VSDA 3D0VA 2FGZA 1V58A 3DURA 4G7SB 4PLOB 3N40F 1TG8A 5E00A 5TE4H 3MLYL 5J1TC 1L0QA 3JV5A 2CX3A 3UARA 2PF6A 1P7KA 4R7DA 4RWHA 2YPMA 2F53D 2IIJA 1VACB 2HTLC 2OP4H 2MRYA 5KJRH 1WRFA 3SKNA 4BHUA 4PGDA 2X4RA 4NBYB 1J05A 1K5NA 2G5BB 4OSUH 2RFXA 4Z7VA 3UGUA 5SWZD 2H6UA 3OAZK 4XN5A 3U4AA 4NZTL 3DK0A 1NC2B 5DWUH 5DZVA 3WEXA 1AOZA 1MD3A 2BWQA 4M7KH 5C9KA 3IJSA 5GGSY 4D0DA 3IFNL 1AC1A 3GXDA 2JELL 3RNQA 2BVPA 2IBZX 5IT2H 4KX7A 3TNMA 3L9RA 4JREC 1DVFA 1N8OE 2XWBB 3UAFA 4FQJH 5GS2H 2P24A 1V8HA 1RJZA 2HPTA 2IOOA 3VI4F 4N0UA 4XNUH 1A3QA 2FNOA 3WXVH 1VFAA 1XBRA 4HK3N 3PHAA 4QRBA 3QQ3B 4JFUA 4Y2DD 3HZYA 5E8NB 4KVCH 4N2MA 4BHUI 3EOBA 1TRWA 3QK0A 3UTPD 5IMOB 4HHAB 1A7BA 4X42A 1E9QB 4O9HH 3UZQA 3KJ6L 1NJ9A 3OAUL 5GS1B 3IJYB 4JY6B 2GC4C 2R29H 3HN8A 3GTTA 1BFSA 2J88L 4Y5YA 4GLTA 3HHSB 5J6HB 3ZDWA 3GMLA 4Z18A 3ARDB 3C1SA 4ECBA 4KQ0A 4ZDHA 4FL4B 3DX4A 4I85A 3WO4B 1AS8A 4BZ1L 2G0FA 1ZS8A 2EZ0C 1WFIA 5I1JH 2MQ3A 3BAEH 3MJ9H 4ODTH 5I18H 4OFTA 5EU7C 5ALBL 1A7RH 3HLAB 3GIZL 5HHXH 2LJRA 2VR8A 3I9GL 3WCYA 1EZUA 2DZEA 4OMVA 3LEYL 2G9KA 5ABZA 1BZDA 3GSXA 3I9AA 3OHXC 4QRFA 3PJVD 2PW1A 2PXYC 3KGTA 2VH5H 4N24A 4C57C 5IEKB 3GK8H 3ZREA 5CCJA 2VNCA 2J5LC 2EVFA 4TYUA 1DSWA 2BO0A 3FQYA 1AQMA 4OCLC 2Q3AA 3C12A 4NUGL 1MI5B 3GL5A 3WJJA 4GBXD 4WCYH 1HE7A 4QHMA 1DQJA 4U1LA 3EYUL 5L6YL 4I89A 1A14H 2FUG2 1FRGL 3VWXA 2ZONA 1EOHA 4XWGL 4OTXL 4C58B 2Z0BA 5GZND 1YMMA 3DVIA 3GJFK 4HIHB 4P4KD 5TDOB 4R2GC 4ZQTA 2EDRA 1KBGL 1FYTB 3KPQA 2LKUA 5DTFA 3GMNA 3N42F 4OLXH 3QSKB 4P2QD 4YC2B 4K9JA 3NN8B 1TNMA 4NIKB 4MMYA 3ZOAA 1FGNH 3FB7A 3FYGA 3GSWA 3JZYA 1UEYA 4KJWD 5EU4B 2B6MA 4TW5A 1QQDB 4ZPTB 5IHHA 4U6HA 3AU1B 1X44A 4B9FA 2ZWLT 3FF7A 4WKZB 3TRQA 4I8DA 1ROWA 1XO8A 2Z7YA 3RUGB 3VXME 1L9RA 4U2ZA 4KUCF 3RKPA 2YAEA 3VH8A 5IQ9B 5DUPH 1O8XA 1Q94A 4CSPA 4EZMA 3BO8B 3V8CA 1DQIA 1MCWM 5F7DB 4V33A 3V6ZA 3D1MC 1M05B 4KVPA 3U2IA 2DJJA 2Y1ZA 5IFHL 3DI2B 1OALA 2EDMA 5GRUL 2O61A 3TO4B 1HEHC 3HNVL 4MZCA 2K8MA 1WK0A 4RX4A 1TFHA 5DQ9A 3KPMB 3ASOB 4PRIA 5AZEL 3U9UA 1JHLL 4WDIB 4JRYD 3DJTA 3UBFA 5I1GH 1U87A 1RK0B 2LQRA 1NPNA 4MS6A 1G4RA 5C0BE 4EI5D 5BO0D 5KYYB 2VL5B 2OL3A 1KTLB 5G5FA 3GUTB 3K8NA 5EO1B 3ROLA 1INEH 3NIGE 1P7QA 3U2JA 4Z3JA 2N1TE 1EHAA 4JVWA 1UA5A 2A9DA 3MRFB 3GX0A 3Q0HA 3KLSA 1W89A 4MJ6B 1ZPUA 2DIAA 3O3TA 3GZOA 4WWID 2BP5M 4V1DB 2KS0A 4HUVA 1X5JA 2WKOA 5GZOA 4BA0A 4FFYL 4HXBL 4UT9A 3T3PB 5HYEA 1O5DT 4ADGA 4G82A 4O02L 3ZPDA 5HI3D 5E0FA 1I1AA 4TUJA 3BEWA 5CJ8A 5GAND 4M5YH 1XGUB 3GSNB 4FLSA 2ZCZA 6FABH 3LN5A 1EPFA 4WI7A 5D9VA 2VCOA 3S3CB 1ZLSL 4DZBA 3CSGA 4IBVA 1JUFB 3ZJAA 5E6IA 4GB9A 3KL3A 4L1LA 4MAUH 2QGBA 4L2YA 4F9PC 4MZWA 3K4ZA 5CILL 2GS3A 3OJVC 4GIAA 1DBJL 4W4OA 1FVCA 5E08L 3IFOB 2BNRB 5AYTA 5IJVA 3GSOB 4OCRL 4EN2A 1MCPL 4G72B 4BDVB 4DN4H 1O6VA 5DQJB 1D5MB 1WDAA 3GHEH 4XVUC 4JFHD 4I9WD 4X5WB 4ZOCA 2R0ZL 2V5YA 1L9PA 1WC7A 1MFAL 1ONQA 4KMQA 2IPKB 3UACA 4JHAH 3DDFA 1T1WA 1Z9OA 3QDAA 2HPOA 1I9IH 1S9YA 4G6FD 5ANHA 3LVEA 1XG8A 1JNHA 2FLBT 2A6DB 4HJIA 4Q6YA 3CFDB 4JL1A 4ZX3A 3LIZA 1IJ9A 2C3XA 1SEBA 2ED8A 2YD0A 1EUTA 4OZFA 5C08B 3QAWA 3KPOB 4DIXA 2PP7A 3GBMH 2PR4H 3B7TA 3FCUB 4NQDB 1U4EA 3P9WB 5EWIH 1NIEA 1NFDA 2ZYHA 4YHOH 2FHFA 1R3KA 2VJ0A 5CZRA 1QNZH 3A21A 2H1PH 1T5WB 4LASH 1BP3B 1A4JA 1RURL 2I07A 3QFAC 5T1KA 2EEFA 3ROOB 3PWNB 4JREB 4YSQA 3C60C 5INCB 3APOA 3NK4A 2F8XC 2HJFA 3AW5A 4HSAC 3QCUH 4U05A 2LAGB 1L5GB 3HMXH 3JV4B 4HWUA 2QGCA 3NFPB 2CDGA 4FFTA 4GMSL 1NW2A 3LQAL 4MH3A 1E3XA 4KQ3H 3BXNB 5HHOB 1IGTB 3TFKD 2NW2B 1M9SA 5HGAB 3BEVA 3L0HA 5DXWA 3UH8A 3T2PA 5EC1A 4DGUA 2X4AA 4FTVD 1NCIA 4FQHA 1GY2A 4M9PA 1TZGH 2Z93A 5IMLB 1YY7A 2DH3A 1FYTE 2VTFA 3VSQA 1QUWA 3K72B 2HRHA 2X3AA 3H53A 2EDBA 5CD3A 2I1UA 1H0DA 3CH1B 2D7TL 2NNAA 3CXHJ 5EIVA 2KI6A 4DFIA 2N7AA 2HZEA 4Z76A 1L9TA 2OR9H 3AU0A 3NDZE 2WTPA 2PUKC 2OZ4A 4TSAL 4BK4A 1ERWA 4HBCH 1I1FA 2VN7A 3F6LA 5TDPA 2V2XB 1RMFH 3DV6B 2NUPA 2X40A 3RUGE 4EOWL 2X64A 5JQIB 5ISZA 2O7KA 1JK8A 2FO4B 1OVNA 4N8VG 1TPXC 3HVDA 5F6HJ 4B9PA 1YUHA 4NXSA 1FHEA 2ZOOA 2XBZA 2QQLL 4HD5A 3T04D 1PJWA 4RSVA 3OHXB 3RURA 2FT8A 2JCCA 5C0AE 2PXYB 2A1WL 4JB9H 1DFXA 1ZE3H 5CP3H 2J5LB 1OB0A 2E56A 1NFIA 1MTCA 4Z7OF 5E7FA 3GMPA 2EO1A 3GL3A 4WXTA 3HB3D 5J0BA 1DEDA 3QMXA 1XOBA 3D7PA 1KEMH 4QRAA 1KPRA 2YR3A 3LORA 2NLJA 4N6QA 3E9JB 1V10A 3HZKA 4Z7WF 4RFEA 4X6FA 3TV3L 2EO9A 1ZWIB 1YEPA 5GS0D 4QJ5B 1LDPH 2XA8H 3EZJB 2J1YA 2LOEA 4Y5VA 4DFHA 4R2GB 2KKQA 1Y6KR 4MX7B 2XICA 3VFGH 1EO8H 1XSOA 4NQTA 1LO5B 4EXKA 1MH5B 1CDIA 1CVRA 2Y06L 3MHZA 2YANA 3T3PE 4PHXA 5IBTL 1XD1A 3QJXA 5JW3H 3ZHLA 1N3NB 1KC5L 4GO6B 4K3GA 4URTB 2F7RA 1TMCB 2M26A 5FW6A 1UXLA 4JPWL 1FNAA 2YGNA 3FQXA 1PYWB 3HR6A 1Z32X 2OMVB 5IW6B 1GR7A 1NCDH 1WBYA 4PJAA 2C3HA 3FQRB 1P6AB 3BQUA 4C56A 4ETYA 5JHLH 3WDHA 3BYTA 3L1EA 4LDEB 1L0PA 4C59B 3TH2T 2WZ6A 3T0DA 2W88A 1BX2B 4YAQB 4XPBL 2EIRA 4HMCA 4WTZG 5KSVB 4RETB 3OX8A 2IG2L 1X5AA 4DESA 3CZNA 2CK2A 4GAJH 5ETUA 2ADGB 4GG8B 4ZUTA 3WNPA 3U25A 1EFXA 6PAZA 3JWOH 4ABVA 3NSYA 4JGJA 2QHRH 4K9EH 5HHME 1GSQA 1PRXA 1ABAA 5ITFB 2VM1A 5GSVA 2L6CA 2AK4B 4WFHD 3NCXA 4XB7A 3KEDA 2W07A 3EBIA 5CSZB 1FFNA 1X5YA 2ZZUT 4PRNB 4K0NA 4I2XB 2VL3A 1BM3H 4ZFQA 2CKBA 4WF7A 4IJIA 1AZVA 3O6LH 2HKFH 3QUMA 4KH9A 4QRSB 3ZKMD 4DVBA 5D6CA 5JNYA 2P5PA 4ZUSB 4UV4H 4F58H 1S3DA 5C08E 4JFZH 3RJDA 3VI5A 3PG2A 5H8DA 4MA9A 4E41D 1GSMA 4NQDE 4MJ5A 2JQZA 2DOCA 3QDMD 2JSFA 4ODUB 4OR1A 1RK1A 4N8CH 4PJGF 1KELL 4AQ8A 5BOPA 3B5TA 1J18A 3QEQA 3D39A 4KPHL 5DVNA 4DUVA 2YGVA 3CZEA 4HT1H 1NH6A 2WBJD 3EAKA 3IPEA 5KSUA 5JPMA 1JF1B 3QUGA 3LZFH 4FQCL 3VWJA 1XR8A 3LHPL 1BXVA 4WW1B 3GBEA 3WMSA 1KJ3H 4EAEA 1LWJA 3FFOA 1GRWA 4WKWA 1OGTA 3IA1A 3FCSB 1NMAH 2VE6B 3SPCA 2MYGA 4ZX4A 4F2MB 1A7QL 5IOPB 1AHKA 5LHDA 5D7SL 4TPRH 4UDTA 4TRPL 2EIJB 2NDOA 3FUNA 3MXVL 1M2OA 1FO0H 2CA4A 2WUCH 3LZQA 1B2WL 4IGBC 2ENSA 3C5JB 2HKHH 3PF2A 4NC2B 5EIIB 2QPSA 3OC5A 4KK9D 5I0YA 4JEDA 1NEUA 5TK2A 1T04B 3CCHB 2EIQA 3AY4C 3GS0A 4W6XB 3WV0A 1ZDQA 3QIBD 2FWSA 1ID5I 4LOFA 1RL1A 2OMWA 1M3JA 4M61B 3MZTA 4HFUL 2QSIA 1KXQE 4HEMA 2VABA 5FT3A 3OAWA 2R1YA 4LCVA 1HHJA 4PJ7F 1T7PB 4I0PC 3TTSA 4E9VA 4JY4B 1ZCPA 5IQYA 2PN8A 4BA7A 3U7WH 4KTEL 1LJMA 4QYAA 2MMAA 2VITA 2C9SA 3C60B 3V4UL 4KCEA 3ORJA 4RMVA 4IKHA 2D31B 4HF5L 1S8DA 3CFIC 1YQ2A 1YEIL 4QRPB 4TL5A 4UU9A 3BBYA 3LSOB 4HETA 4ELMA 3PINA 3WIFB 4BELD 2AV1B 2WVSA 3NJFA 5K93A 4F8PA 1E2VA 3S96B 5KWYC 2WVUA 1SHMA 2Y07L 3JWNE 5A2JH 3MRBB 3LWAA 2X4QA 1NFAA 5FIEA 1MEXL 3HCVA 4EBQL 4R7NB 2EYRA 3SJVD 3CX2A 4F91B 1X5EA 2TRCP 2VSMB 3CYNA 5BRPA 2AXJA 4GLRH 4A2EA 3BUDA 5J5NA 2Z0UA 4XO8A 5KVGH 5KS9A 3WHXA 4XPHL 2YSSA 3FKUS 4I9XA 2XA3A 4NKDA 3ELQA 1SL0B 2MWCA 5EEVA 1LILA 3ZDZF 2F18A 2GUOA 2OCJA 4I77H 2HRPL 1GZQB 3DTUB 3QFJB 1YA5A 5JXED 1H15A 1TYEB 1G0DA 3MACH 2WFCA 1PIFA 1SXZA 4OIAA 4P05A 1QFNA 4YDMA 2ZUVA 4FERA 4ODBD 3V52L 5SX4H 3KTBA 2CBQA 3DECA 4ES9A 1V40A 4POZD 4PR5B 4D0BB 1W72B 3PNRB 2BNQD 3MZGB 1F86A 1MRFL 3R06A 1YYLL 2CRMA 1KLFA 4AJVA 3ASNB 1RSFA 3IJEA 5I17A 1JGLH 4DSRA 3FH8A 4JRXA 3TTYA 1S3CA 3SZKC 5CLYA 2AK4E 2ROXA 5DVKA 1G6VK 1N67A 4BQCA 4N28A 4POKA 1EV2E 1GSUA 4QRUA 4BZ2H 4I2XE 4WUUE 5FYLD 1N5YH 3IAM2 1R5VB 4ACSA 5FUCE 4XP9L 3W39A 2WRTA 4O2CA 2G75A 1F4HA 4QR7A 5DMKB 1G6WA 4CNIB 2XN1A 1J11A 2AXFB 2I27N 4XMPH 1ZVSA 3DWVA 2O5NA 1CQGA 3QISA 1A6VH 4RIRA 4UT7H 2PU9C 3CTFA 1AR1D 2Y22A 3JTSA 1GS6X 5DHMC 1QSED 4DP0X 4UM9B 2CLRB 2H74A 4LRIA 1IGJB 4LAQH 1SJIA 2VDRH 4WO4C 4XCEA 3LSZA 1XSKA 3S5LG 4JFQA 2FSEB 3ZIMA 3IK7A 3UROR 2BIMA 4NGHH 1Z6NA 2EE3A 4KK5D 2RUEA 2CQ9A 5D1XC 1L7TL 2XQ0A 3DX7A 4N2DA 1XQ4A 2FBJH 3J07A 4HIIB 5IHUH 4CKVX 4DKEH 1CLCA 3BH8A 2DQFB 1A7OL 3VXTA 1NBZA 2E9IA 4HJUA 4IHBA 3CH8A 4A37A 4JKPH 3R19A 4PRAB 3II2A 4KUZH 4PCSA 1D5ZA 1IARB 1RH8A 2FD6H 3UTTD 1PZAA 1JPGB 4XHJD 4F2ME 2XFXB 1B2YA 3HHMA 2NTFB 3GWJA 3W9DA 2Y0SA 3ZZ1A 1WISA 2O5YH 1D9KA 5C0JB 2X42A 4QF1A 3D4TA 3WS6C 1E8ZA 1A8ZA 4TTGA 4V2BA 1KB5H 5B8CC 4YBQC 1NLDH 35C8H 1KEBA 2X4OA 4FXGC 2BVYA 3FT4A 1GKOA 3QRFM 1F11B 4JS7A 3F58L 1A6WL 4PGBB 4XBPB 4XCNB 5AB1A 3MRMB 4PLJC 2EUZA 1AYRA 1TU2A 4OGYH 4KRPD 3GF8A 1P4LB 1JPEA 2BFVH 3EYQC 4J23A 4ZSOB 3RFZA 4BFOA 3AWFA 4BKSC 4ZPVB 4MCYB 1YVLA 2IALA 4R4NC 1FFOA 5DUJA 1E28A 3DSFH 4DEWA 5I8OH 3NSDA 1IBGH 2EE9A 3QC6X 1GCYA 4WW2F 5JWOB 2XZQH 2C0EA 4EVMA 3HG2A 3PV6B 4QRPE 2J3SA 1F6AA 3QYNA 1SYRA 1RJLB 19GSA 2PERA 5HHPB 4PS8A 1NIFA 5ID2B 5D72H 3UVTA 1SYXA 4KNUA 4ZX6A 1EXHA 1PG7W 2IPUK 4ORZC 4YL9A 3WMQA 2Z64C 3E9TA 2AJ3B 1QRNB 2YMTA 1ES0B 3AM8A 5EU6A 2YN3A 3MJWA 4NRZA 2GY7B 3MYJB 2JLLA 4ATWA 3DHJA 1AQDB 5DHXB 1GOFA 2PCXA 3LKNA 4IGBB 1LTXA 3QORA 1RQMA 1HIMH 4BWTA 3HI1B 1SXBA 4HOMA 4N8VA 1GTUA 1SRDA 2DTSA 2R1WA 3T4AC 1YEXA 2GZPA 4HU2A 2KYIA 2MKWA 4DQAA 2Z4TA 4KWUA 4BE6A 1NIAA 1SFHA 1MQKH 2A6KA 4XCFL 2V2TB 4OLEA 2J8HA 2WKLA 1I9JL 2WO4A 1G5AA 3QJVB 4JFPA 5DS2A 3VFMB 3PQYB 4FO5A 5KYUA 4M3HA 2O5ZL 1X7QB 2VQTA 4HALA 2DW5A 3HPLB 3QUZC 4PJGB 3RL1A 4CBPA 3DRTA 4PI0A 3MV9A 1GYAA 4I0PB 1ECYA 1USZA 3RPIA 1I1YB 3S0PA 1IM3A 3ZDYE 3P9MB 1UB5B 2VUYA 5F7UA 4LMQE 3TF7C 2R1XB 5C0CD 3NPSC 4U1GC 3B2MA 1OCRB 1SDDB 4PRPD 4D9LL 3OR6B 2ALWA 1XBDA 1Q4NX 3U9PL 4DW2L 5EA0H 3H9SD 5FO7A 4MXWL 5DALB 2OMYB 4KAQL 3IK2A 4J4PC 1S7RB 3AAZB 4ECNA 5DK0B 1IGCH 1T22B 1BYPA 1I8IA 3AGWA 4LF3B 5H37G 4CC4C 3LKOA 4HK3J 5LGHL 1AI1H 4F24A 4TNFA 1J5HA 22GSA 2WLLA 1CDHA 4A2DA 3RP1A 1WBXB 1CGVA 2X3CA 4QHLB 1V3LA 5LN8A 3CSJA 4M43H 4W9IC 3NSCA 3QI9A 2J5WA 4PRHA 3TVMA 1CR9L 3TIDB 3LRKA 2DIJA 1WPCA 1Q9WA 2YUZA 3L7FA 1NOFA 5I1EH 2KP2A 1XGQB 2YKKA 2QJDA 2RTTA 3CIAA 4Z7UF 1KTEA 4FI7A 4FYRA 4Q9CA 4PJEF 5I8EA 3SDAC 2X0WA 3TPUB 1MY7A 3GLDA 1RIUL 3PLYA 5I74C 4EIPA 4C8XA 2BXZA 3IU4L 3SPVB 1CDGA 1S5HA 1P1ZB 2PYEB 4S1RL 3G08A 5JIDA 1V98A 1S7WA 3CDGA 1SLWA 1GULA 2PBJA 3TEYA 4X4YA 3DX2A 4HKXA 1A4KB 1VFOA 1ZK9A 3B9EA 3P0GB 4AQOA 4ZIJA 1JFQH 2AXGB 5IVZB 4ZL8A 5DJCB 1IAKB 1T1ZB 3JCML 1KCRH 1JPTH 4AQEB 1EGJL 1TLMA 1BZQK 3MO1A 3WFBL 1TRVA 2FIKB 3PXLA 1RZ8A 1SJEB 5F96L 2CHNA 3OZ9H 4L4JA 1TQVA 3M1CA 3WN5A 3VXSD 5HGHB 2PTUA 3V5KA 4GQQA 4GPVA 2XVLA 4PY7B 5KYWA 4F7CA 4R5TA 1XXDC 4F33A 3PAVA 1MJ8H 3AY8A 2HJLA 5HVFB 5JOPD 4KDXA 3KPSB 4GKLA 2VMEA 1OAXH 2YLHA 4I4WA 4ZUVA 2AJZA 3I9IA 5EUKA 4HQZA 5DRNA 5HPMA 1SU9A 1KDIA 2EH7H 3H2WA 4ONGL 3CN4A 3VWVA 4A7VA 3HS0C 4X8JA 5BVPH 2KPWA 3NG5A 3B9AA 3QUXA 1DUZB 4LSPH 4F82A 4X5QA 2H32H 3K80A 3DX9B 1CDUA 3ESVF 5F7MC 4WO4B 4HOWA 2XVKA 4NHUB 4BRVA 2QKEA 1A1NB 5CEYB 5A3ID 2CR0A 1XR9B 5D7LA 4UTAL 3KE0A 3QPQC 4P57A 3MROB 5D1XB 5F06A 4ZNEA 1N70A 3I02A 4B97A 1AACA 3X3FH 2P31A 1P1VA 3MU3A 1RUPH 4W70A 2CLVA 5B4MD 2XWJA 2GBTA 4NAMA 3E0UA 1SGKA 2PWFA 4HK0B 3J7Yb 5GRWA 1L6XA 4BQ9A 1QWUA 4ODVL 4MMZC 1TJGL 1XF2A 2QSTA 1QRNE 4YUEH 2IIYA 5E6SB 2J4WH 3HW7A 5DDHA 3VFNB 1F0LA 2VL2A 4NJAH 2OTUB 2R0PA 1IBYA 2COQA 3JYBA 4MJEA 2CPUA 4AQAA 5EULV 4XX5A 2WYIA 3A6BH 3QDJA 5B22A 1B4LA 2QVFB 3MJ6A 2V9QA 1WEJH 5F89B 4K9ZA 1AD9B 3HBPA 4M6OH 1IQWH 4PY8J 1UOKA 5B8CB 4PJ5D 4TF4A 3GQFA 1XZWA 2AJVL 1CVSC 5D1ZA 1Z3GH 2RQ8A 1K2DB 1EEUA 3HG1B 4Y9FA 1U8KA 4EF3A 1CDJA 3SCMD 4JZOA 2FCBA 4QHKI 3VMPA 5AKVA 1KTRL 2AS5M 3ZVJD 2FX8L 1KJ2A 3PQYE 3OKLB 4MNGB 5DO2C 4H25B 5IEHB 4LSUH 4IW4C 1PLAA 5ILTL 3P77B 5LJYH 4L8DB 1YEHH 4EUPH 3V4PA 3EXLA 3CFKA 2LQOA 3PGCB 1PZ3A 2YPVA 2EIMB 3MLRL 2PCPB 3O0RL 4OWYA 3FQTA 1L6PA 4LLUB 3WTXA 4PUBH 5F7NC 1U8JB 4TVUA 5IB5B 4P2RB 3WTYA 2VLVA 3PJSA 2GITA 1EJFA 4A2FA 1YEFL 4IYKA 3RTQC 1JZ2A 2YAOA 1GC1C 2J6EL 3JT2A 4NFBA 5JUEL 1JNJA 4RQRA 4XN4A 1NAMA 1U92B 4LBEB 2AKRA 4M1GH 2OMNA 3PPEA 1CZ8H 3QDHA 5D1ZI 4LPYA 1IC7H 4G5ZL 4MDIA 5JA9A 3IT8D 5IQMA 2LNTA 1D2OA 4AOFA 4F0BA 3IGUA 1WCBB 1BZ8A 4DTGH 4NQSB 4U1HA 3FFCD 2X9XA 1REIA 1H6FA 1HH9A 1I82A 5JORA 5IMAA 4ISDA 1CXKA 1AGEA 4DO5A 2YBRA 1R5WB 3T4AB 4XAWL 3TBSB 5F07A 2NZ9D 5DK2B 2NXYC 3PRZA 4TLTA 4AZUA 1AP2B 1GTFA 2HFEB 4NQED 3CQPA 3OXSA 4RESB 1IL1A 1MELA 4OLVH 4F27A 5HYSG 4LIQH 4JDVB 2DKUA 2PYEE 4POBA 4AEIH 4I1NB 3O3UN 2ED6A 4OIIL 4F80A 3TO2A 5LO7A 2AMGA 3FOLA 1ADQA 4E8HA 5T1LB 2QC7A 1NGYB 1C7TA 4HWBL 4UQAA 3NPSB 4U1GB 2ESVB 5FHBL 3RGHA 5KBDA 2R69A 2J1ZA 1Z66A 2NY1D 2WWKO 3BW9B 1BVLB 5DA4A 4U0QB 1EWHA 2NQCA 3C6SA 3RVTD 3U82B 1KWGA 2AEOA 2C3NA 4HS1A 1MPAH 3LW9A 1NL0L 3T8MA 4P23C 1Q9OA 1JDCA 3B8SA 2PUQT 4S1QH 5FA4B 1TUPA 2D4DA 5KSAC 1RIVL 3V0WL 2EYSA 2J55A 3LXUX 1A9BB 1JK9B 2Q5BA 2ICEA 4Y4KC 4IDLA 4F57H 3IMWA 1TTRA 1XEDA 4UZSA 5I2IA 1CTMA 1UJ3C 4KGLA 1X9MB 4R26H 3ZSTA 4LZKA 1LO2H 4AG4L 4JGNA 2JB5H 1YEWA 3RDJA 3EOAB 2JI3A 4P5MA 3C75A 3X12B 1BD2B 3D2UD 3P0YL 5I30H 2VT0A 2GCYB 2ENYA 5AB2A 1ZVYA 3SDAB 5JPNC 4PQIA 1HYRC 2H72A 2M72A 1DN0A 5I74B 2K78A 3ME7A 4XCCL 3O2VH 4X4ME 3E38A 4K3JL 3VI3A 1KGCE 15C8L 4MXVE 5MEOB 4D0CB 4EN3D 4Y2DC 4YE4L 5JMOC 5D96C 2IFFH 3HUJB 4Q9BA 3V4VB 4WKXA 4KKCD 5CKGA 2JK5B 2NR6C 5C6TH 1INQA 4DAGH 4G6JH 4WO0A 4CC1A 2VDPL 3NJLA 4OQTL 1MXGA 3BVDB 4PWJA 3LQZA 3SODB 2EDQA 4OZGF 4TXOB 1BOGB 2VXQH 3DXAD 1GIGL 4PXOA 3BUTA 3PGDA 2XC2A 1S7VA 2CZ2A 2IPTH 4N3TA 1MCJA 2Y7MA 2ZWNA 4MB3A 4QYOA 4B9KC 3ZL1A 3VGAB 3HG1E 1RJYA 2W94A 3SPGA 2DBLH 3LEVL 3QNYA 2B4CL 1UXSB 3MBWB 3QYCA 5I6PA 3UC2A 2VLMD 4MNGE 3WJLC 5B1CA 4YHML 4L5LA 3ABKB 4NQXB 4Z7UB 1FUNA 3V7AG 5BXFA 4AIZB 3HS0B 1IC4H 4LLYA 4ZS6D 1AXSA 3UYOD 4YDLC 4B0MM 4YDZA 2C9RA 3BWSA 4L3EB 3WNKA 3SQOL 1IM9A 2CO6A 1KYFA 1TETL 4I3RL 5B3SB 4K94C 4PEEA 3U4EB 2BCMA 4P2RE 3QPXL 1NHOA 2BHUA 2P1YA 4NPJA 1DVTA 4NYLB 5HI5D 1TQSA 2H2SD 1OOWA 2VR3A 2YJQA 4HS3B 1UOLA 2V2WB 3SDDA 4XVTL 4HPYL 4JN1L 5CFHA 1IGFH 4U1KB 4MMZB 5DGRA 1AKJD 4P4KC 4QI3A 3RE0A 2Z91A 4NM4L 1YNLH 1XB6A 3TNNB 3ZTJG 4F2FA 3X13A 1H6UA 4ZO9A 3TP4A 1CO1A 1DVFC 2D7NA 3P4MA 4L8BB 1JXJA 3HMWH 3VWKD 3QWNA 3FCGA 4YMPA 3NCJL 4KTDL 5IP4A 3QDGD 4G9FD 5BV7C 3F7VA 1MDTA 1JSYA 4JKWA 4QRTA 4S1DC 1K3YA 5TK4A 3LZRA 4M1DL 3TCOA 1WICA 3P69A 3TBWB 4LSTH 5CINL 5LQBL 4E36A 2YD3A 3KHQA 1D5IL 4LCCA 4PJFB 3IMBA 3D85D 1MLCB 2EVIA 2GI7A 3FTGB 4XAKE 1WIPA 3ULVL 2LAAA 1AIFA 4BZ1A 3PIQB 4D3CL 2UWEA 4AGPA 4JAMA 4LHUG 3DUSA 2PKDA 4HIXL 4YSCA 2QQNH 1UJTA 2BY1A 3AXLA 3LIUA 3FO2B 1S9VB 5HI4D 4JNXA 2J73A 4U49A 1O5PA 5H35A 2BOCB 1V7NL 3CN1A 2ISDA 4EI5C 1TXXA 3HZ4A 1XSJA 1N8JA 3TUEA 3RTQB 1H5BA 1BAFL 3IB4A 3N04A 5FGCB 3S98A 1G7LA 3HFFA 3HXSA 3NJMA 1EH9A 1NDTA 2BFGA 2Z35B 3ESMA 3TCLB 1OGAA 4ONOA 4NO2A 1M0UA 3IU3B 4LBAA 2Z3FA 2VC2L 1UASA 4IRSB 4L9DA 1PG7L 2P5WE 3MSPA 4X6EA 5EUOE 5GS2D 4KKLC 5IZ7A 3DLQR 1BYEA 3H9HA 2GSTA 4PP1D 2GVYA 1T80A 1JTOA 1QMUA 3ESOA 4MJJA 32C2A 4HC1H 5BUAA 2CU9A 3C8HA 1HT6A 4KHTL 2R2HA 2XY2A 4DWHA 3DX1A 2APSA 5DSCB 3SGKC 3WJJC 4OCWL 2K3TA 2NXYB 2PR9A 5DJDB 4AGOA 3WSQL 3DI3B 1UWXK 1A3ZA 3DC0A 1T7WA 2WXIA 5HI3C 2HRGA 1KJVA 4NNPL 4YSDA 2XLLA 4CC0A 1TENA 2YZUA 3I84A 4ZL7A 5CGBA 1BGXH 4RRPM 2UX7A 4PBWD 5D5MB 3LS5H 4OW6A 1JRHL 3KPNB 4A6YA 2CMRL 4HUXA 3UC0L 1TOFA 1QPXA 2FECL 2XN9E 5DJ8A 3RA7L 5A2BA 3HFMH 3EYFA 2DQ6A 1F8TL 4BXVA 1ZJBA 3RU8H 4KB3A 1BFVH 1BZ7B 2XZZA 3HUJE 1VADA 2Q8BL 1JHKH 3QUKB 3SIKA 4HKZB 5FYKE 3V9FA 1BWWA 3VXRE 4E9WA 3L3HB 1MHCA 2P52A 5H4YA 2H6YA 4ZFGL 2DJ0A 4GRMB 2Y5EA 3FMGL 2VW4A 2XWDA 5B8AA 1PQZB 2F53B 5I1CL 4P23B 5E6RB 2X4NB 3IFPA 1D6VH 2XV6B 4RGOL 1N2RB 4TVPL 4A04A 3K6IA 2FX7H 4FQIH 3S36X 3VGGA 4D94A 5CF3A 2DLFH 4LQ1A 3DYOA 5KSAB 2EDYA 2DQGL 4LXFA 2EAEA 1GOHA 5DQYA 4Y4KB 2VDQL 1VPOH 2AHEA 5D7KE 1GNWA 1Q0XH 5ELIA 1I7UB 1UJ3B 1G6RA 2IQ9L 3MRGA 4FI8A 4JO3L 4IRZA 4OGAD 1EK3A 1OAYL 3ARBD 4PJCB 5SWZB 3NIDB 3TFBA 4FYQA 3MC0A 4JQIL 5E8PA 1WWJA 2MPAH 4MNQD 5BRTA 4JPVL 3CSYB 1RJCA 3FBQA 3MBEA 3NJNA 3ZZSA 3US1A 4WEBH 3KPRA 2BY2A 3K8LA 5ICZA 1MNUL 1VLXA 4PBDA 5FO8A 4O4YL 1PW3A 4L3EE 5JPNB 4O02A 1RUKH 4AGSA 3CLFL 4XC1L 3OF6A 2A74C 4Y2OA 5BUGA 2G2NA 4CBZA 4HG4J 4Y2DB 4WIQA 1A3RH 4OCMC 4RDQG 5D96B 5TE6L 3KBFA 1KXTA 4G9HA 1L0YA 3WENA 3DIFB 3MLWL 4QL7A 3WNLA 3WUWB 2IPAA 1BG9A 2AVFA 3K2UL 3EYOB 5TF0A 2C1PA 1MAMH 1QASA 2XV2A 1EDQA 2VLKE 3HI6L 1DTUA 1FJ1B 2EADA 1AS6A 3GSNH 3O3AB 5K9OB 4JKLA 1NBVL 5AVUB 2TSAA 2XKUA 5KJ7E 2FWOA 5CP7B 4X7DC 3FZAA 5IF0B 2AJUH 3JV6B 1CYGA 2R2JA 2I69A 1DUYB 3VD4A 1EHLL 3Q2WA 4M48L 2GJ6B 4HUUB 1B6DA 2EDJA 4B3VA 1XGPB 1XH2A 5E0QA 1J1PH 3FQ4A 2C9UA 3IAPA 1FNEB 3HC3H 4AMWA 5KUKA 5JHDA 4PJFE 2LSTA 4BFFA 1HNCA 1FGVH 3FDWA 5CHNB 3NESA 1KGIA 3D0VB 1HDMA 2WDUA 1NCWH 5E00B 1S4IA 3BWAB 4YDLB 2RUFA 2HVKA 1P7KB 2OULB 4R7DB 3RAZA 3WGDA 1MY5A 4WFGD 3JYCA 1T0PB 2YIHA 3M8OL 4XRDA 1SEQH 4R8WH 1C5BH 2BM3A 1BF8A 3SKNB 4WFFD 1SN2A 3HB3C 4PGDB 1OC8A 4AMKH 4O92A 1HOCA 1K5NB 5F7EH 3R1GL 5TE4L 4FC3E 3WEOA 2RFXB 1XOAA 1YKCA 3QC5X 4Z7VB 4DGWC 4Q97A 5IIEB 1EOGA 1H75A 1DJGA 5DJXB 5GS0C 2OP4L 1AG6A 4ALAL 2PNDA 5KJRL 3IJSB 4D0DB 3LZPA 3RNQB 1LLAA 2BVPB 3LCYA 4OSUL 1D5XA 1NCTA 2IEPA 2VM3A 4P2QB 3L9RB 1DVFB 1FSKC 4MAYD 5IB2B 5DWUL 2DC5A 2I3YA 4QKTA 3WE6A 1RJZB 5BV7B 4M7KL 3L4NA 4N0UB 6CGTA 1KF9B 5IT2L 3RZCA 1KTJA 3MLZH 4KZEH 5IBUB 4K2UH 3LPGA 4AENA 4ZOEA 3HZYB 1GPOH 4FQJL 3IJHB 4MJID 2P26A 3EOBB 2JMRA 5D5ME 4TVEA 3BIAX 4FD0A 3HNSL 4KGJA 5JCWA 2VN5A 1WFOA 1S2EA 5E4IA 4XNUL 2VAAB 3E9UA 3UZQB 1W8OA 4UNIA 2FJHA 4LO9A 1NJ9B 2ZWKA 4XE5B 1K0MA 4NKOA 4XWOD 2F1AA 5MI0C 1AG0A 4Q4IA 3V0AC 2V4LA 4KVCL 2LJAA 2WANA 4AGQA 1BMZA 3VD3A 3FFDB 1EEQA 4IKLA 4Y5YB 3Q44A 3P2TA 4EI5B 4Y9CA 4O9HL 1HH6A 5I16A 1C5CH 4XS4B 3ULUL 2YA0A 2IF7A 4ZDHB 5IHBA 4BKLB 1VERA 1TVBB 1ZS8B 1SK0A 1DLHA 2R29L 1PA3A 5DC9B 4EKXA 2H01A 2V7NA 1E7UA 3ZKMC 2NW3A 2F8OA 3M1BB 1YZXA 2JWYA 3CFQA 3FSOA 3GSXB 4L4TE 4XVJH 3UTOA 4GQPH 1CJYA 1S5IH 2DMKA 4MQ7B 3UJTH 1I7ZA 5CJXA 4PJCE 3NIDE 2Z34A 5I1JL 3BAEL 3MJ9L 4ODTL 2OYMA 1A7RL 2ZXCA 3BZDA 4GXUN 3ZHNA 1EJ8A 1FNLA 1DQJB 1Y25A 5ELAA 2Q0ZX 4XRCA 1TKDB 4U1LB 3U48A 1BF2A 2A3TA 2ERJC 4F7TB 3RILA 3O41A 2VH5L 3SDXF 1SK1A 3GK8L 1NDMA 5EZLA 2X2YA 4OD3L 3GLEA 5EC2B 3QUYA 2ZG3A 1UA6H 1YMMB 4WCYL 4XPFL 4Y5VC 5HJ3B 2NT1A 1QATA 2H2PD 2V41A 4KA0A 4DERA 4R96A 3ECBA 1IKNC 3GMNB 3F83A 5DTFB 3Q2CA 4ZT1A 3D4YA 2CDFA 3MTXA 5DT1L 1W8EA 3P7XA 4MMYB 3FB7B 3VACA 4QHNA 2JU5A 4BVXB 2F1EA 4U6HB 3R0NA 3QZNA 3QHFL 2QSVA 4NSKA 4GKZA 5ITBH 1W80A 3BQUC 1G9HA 1DZBA 1QBBA 4OLXL 5IKCB 4KK9C 1KIUA 1FAAA 2OCCB 4Y4HA 2A6IA 3VH8B 4YDKH 4UCFA 1MSPA 4RVBA 1Q94B 5DUML 2Z8WC 4LFHD 4GUQA 4HH9A 1NANI 4M62H 3LMJH 1NLBH 3HZMB 3F63A 2GJ6E 2FNWA 3G6AA 3QIUD 3D50A 4PRIB 5DUPL 3U9UB 3GSTA 4JFEA 5BS0D 1I31A 1CD1A 2CLZA 4K8RH 1WOUA 3X14B 4ZTEA 4PJ9A 2N4IA 3K5RA 3ETTA 3BSZH 5DZLA 2KQNA 2A73A 1NCGA 3PY9A 4XP6H 4R7VA 4YIQA 1LE5A 1QK8A 2YWIA 2HRFA 1P7QB 5FOBA 1AFVH 1GSKA 1NPJA 2AJYH 4X9GA 4PVNA 5I1GL 2ZX5A 2IOIA 1QUPA 5I1LA 5LNDA 3PWUA 1HHGA 2A74B 2FO8A 2VCVA 1ZSDB 4EL1A 2IWTA 5C8JA 4Z7VE 1ZGLM 4GRLA 1JNLH 3VSTA 3P11H 3MX0B 4LQFL 5SWSA 3U0TB 3BUYA 4YL4A 4WF4A 3PP3K 5GGTL 3WL9A 1F2XK 3ZL5A 1MHHA 4GAYA 1FFRA 3BEWB 3GRGA 2IH9A 3LN5B 2NX5D 1IGIH 3IHGA 3LAFA 4DZBB 5A2FA 3EXJA 3OLIA 1AZRA 5E6IB 4Z7IA 1K8IA 1A6PA 4IU3A 4RSYA 4DK6A 2E8YA 3SE3C 4N0UE 3B3IA 4M5YL 2DD8H 4QLRA 4L23A 4S2SA 6FABL 4J56E 5I73C 3G2QA 2CJTA 2ARJQ 1WHOA 3OR7A 5IB1B 2Y6SC 4ISVA 4TKWA 4MAUL 5B39B 4WEUD 1K0OA 5KW9L 4JDZA 3VVWA 3MFFB 2HH0L 5J3RA 1WC7B 2DJ4A 5D2LF 3LNEA 1ONQB 2QGVA 4R3SA 5AW9B 1EEJA 1WGVA 3BDBA 3FNKA 1RPQA 4DN4L 1JNHB 3H6AA 3C09C 3VFWA 3QGVA 1AQXA 2RD0A 3DX0A 4JRWA 5IO2A 4BQBA 1KFGA 4QHUB 2ATPB 4TNVF 4OZFB 3V79C 3SKJH 2DMMA 2HSYA 5FS5A 1VENA 2PTTB 4RNRB 5ALCL 1I9IL 3OXRA 4AMXA 3S35L 4AYFA 5I6KA 3S8GB 1RLBA 4B60A 2K8QA 1NFDB 2VW7A 3N1MC 1J5DA 3HKRA 1R3KB 1IUZA 1GMIA 5HHVH 1X5LA 4HWNA 5FDWA 1SJMA 3IETA 3NJJA 5F9OH 1BWMA 1S3KH 4L0ZA 3FT2A 4K5MA 1BLIA 2WWNA 4JHBA 2JKIS 5BJTB 1GTNA 4RGMC 1A6AA 2UV3A 5T1KB 3GBML 1LD9A 4CY8A 2PR4L 1FSKB 5EWIL 1AR1C 3ZXAC 2HJFB 1J9CT 1OVZA 4U3SA 4NWTH 4WNJA 4E9RA 5IJBC 4WWKD 1QNZL 3PHSA 1KXHA 1IILE 2CDGB 3UABA 2AAVA 4LASL 4RA3A 1FN4A 2WYHA 5ICUA 3LRMA 3BEVB 4XN9A 3C08L 1BVNP 1MCLA 2F8IA 5EC1B 3B9KA 4KK5C 2VGLM 3QCUL 1Y6EA 4FQHB 1F90H 3FULA 4XMKH 2AQ3A 2X8GA 1YMME 3DYMA 4GLRI 4OGXL 2NYYD 1U3HA 1A1OA 1TR7A 2BVQA 3DV4B 1BLNB 3AXHA 4KQ3L 4QTHA 5CU5A 5AW2B 1H0DB 3JVGA 1OW0A 5MI0B 4QRRA 5DZ9A 4XHJC 1JHTA 5K9JH 5JW4N 2HZEB 4Z76B 2VW6A 2W9DH 1YNTA 1G7QA 3EUUA 5J6GA 5AAWC 1OLLA 1I1FB 3II3A 4Y9BA 5I5RA 4LHUD 2YUXA 1TO5A 2ITCB 3B1TA 5ISZB 1ACCA 5D7JA 4DEPC 1YUHB 1IAIH 2OR9L <