3HVNA

Crystal structure of cytotoxin protein suilysin from streptococcus suis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
468
structure length
466
Chain Sequence
DINQYFQSLTYEPQEILTNEGEYIDNPPATTGMLENGRFVVLRREKKNITNNSADIAVIDAKAANIYPGALLRADQNLLDNNPTLISIARGDLTLSLNLPGLANGDSHTVVNSPTRSTVRTGVNNLLSKWNNTYAGEYGNTQAELQYDETMAYSMSQLKTKFGTSFEKIAVPLDINFDAVNSGEKQVQIVNFKQIYYTVSVDEPESPSKLFGTTVEDLKRNGITDEVPPVYVSSVSYGRSMFIKLETSSRSTQVQAAFKAAIKGVDISGNAEYQDILKNTSFSAYIFGGDAGSAATVVSGNIETLKKIIEEGARYGKLNLGVPISYSTNFVKDNRPAQILSNSEYIETTSTVHNSSALTLDHSGAYVAKYNITWEEVSYNEAGEEVWEPKAWDKNGVNLTSHWSETIQIPGNARNLHVNIQECTGLAWEWWRTVYDKDLPLVGQRKITIWGTTLYPQYADEVIELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Hemolysin
publication title Crystal structure of cytotoxin protein suilysin from Streptococcus suis
doi rcsb
source organism Streptococcus suis
total genus 98
structure length 466
sequence length 468
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01289 Thiol_cytolysin Thiol-activated cytolysin
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 3hvnA04
3.30.1040.20 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3hvnA02
3.40.30.40 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Perfringolysin 3hvnA03
3.90.840.10 Alpha Beta Alpha-Beta Complex HIV-1 Reverse Transcriptase; Chain A, domain 3 Thiol-activated cytolysin superfamily/Thiol-activated cytolysin, alpha-beta domain 3hvnA01
4BIKA 5CR8A 3CQFA 1M3IA 3HVNA 4HSCX 1PFOA 1S3RA 1M3JA
chains in the Genus database with same CATH superfamily
4L3AA 4GXUN 1OF2A 4QHMB 3ARXA 2CJUL 3MU3A 1PL2A 2JJVA 3ZREA 2Y07L 3U2SA 2MPAH 2YKLH 1E9PB 1NGWA 3EYUL 4XMLH 4LPWA 1S9XA 4XI5C 3ZZQA 5KVFL 4IJTA 3RVUD 4HK0A 1HKFA 6FABH 4PIRF 1TSHA 4L23A 4B60A 4MA7H 3U48A 3QJTB 2D3VA 1S7UA 2D8KA 4R97B 3BBYA 4WEBH 5I1DB 3WE1A 4O2FA 1NIBA 3MYDA 3HZ3A 3GMRB 1MLCA 1EXUA 1NWPA 3AREC 5C2UB 2J3SA 3DSFL 2WJUA 3A5VA 4JPVH 3IU3A 4QT5A 4X9YA 5GS0D 1AD0A 5C08A 1J5OH 3IAQA 4I18C 1AYRA 3ELQA 2OL3A 3IR4A 4R96B 5CZXC 5E0QA 1FIEA 2Q0ZX 2X4UA 4ISVB 4IU2A 3SZKC 4LMVA 1Q72H 4Z0BH 3LNEA 4X7FC 4JY5H 1MREH 3O4LA 4L4VE 5HDWA 1FORH 4FQCL 3STLB 4BKSC 2LTQB 1TENA 4QOKB 2VZSA 3ZU8A 1E4XL 1Q0XL 1BYPA 4ZPTB 3P2DA 3OKOA 3X2QB 1OKDA 3I85A 3RVUC 2QQNL 2WLJA 3KLKA 4FQHA 1E2ZA 1Z3EA 2K6WA 1YVLA 1P6AB 4OLEA 3D4MA 3CLFL 5EC2B 5F7LB 1U8QA 1BP3B 2AABL 4RAHA 2A83A 1EHLL 1PAZA 4WO4B 1M6OA 2NSQA 4PJFA 1KXVA 5J11B 4X5WB 4PVMA 3EO9L 3NH7L 3H9SB 1AC6A 4HC1L 4OZGA 5D2NA 5FKAB 1ONQB 4G83A 4I1PA 1HEZB 1RK4A 4J2XA 3VH8B 1EAPA 3EFFB 5BS0E 1K0DA 1Q4JA 4OV5A 1Z7JA 3G9AB 3UPRA 4YAQB 4O9HH 3BZEA 4JRXD 2DJUA 1JNJA 2CIKB 4XP4H 4ZS7H 2GKIA 4F8NA 2QMJA 4G1EA 1QLEB 4RMBA 2WYIA 1WAEA 1FZMB 1YNTA 2C9XA 2VCXA 3NPSC 3P4OA 3ARYA 5GS3A 5GGQL 4ZD3H 1JTPA 5D7SL 7PAZA 4X9FA 1DTUA 5I18L 4L29A 3RUGB 4BWQA 4PLKD 3OG4B 1I1YA 1D9KB 3X11B 4MFHA 2ALWA 5CREA 3B43A 5ID0A 1UQSB 2V37A 5ACZA 3BGMA 4RFOL 5JW4Q 3K4ZA 2YZUA 1I7TA 3RYMA 3KHOA 2WXPA 3TZVB 5IEKA 3IAM2 3ZE0B 4B0MB 1UA5A 3ROLA 1AGBB 4MCYB 5JPNB 3BPLC 2GBTA 1G6WA 3V4PA 2HWZL 3H6AA 3G7IA 1MCCA 2B59A 3LYRA 4L8DA 3VXPA 4XO9A 4ZFOL 3D05A 5KVEE 1I1FB 2FVNA 4WDIB 3SEPA 1CDCA 5IOWA 2NT0A 1A64A 4HWBH 4OVUA 3RWIA 5I66A 3Q43A 3N41B 3QWOA 3MCYA 4LNRB 3QHZL 1VF3A 2ATKA 1IKFH 2BHFA 2D4DA 4M6MH 3FFCB 5C6TL 1TVHA 4TXOA 1UM4L 1DVZA 2GSQA 2B20A 4KTEL 2NDFA 2NY3D 3MUY1 5FHBL 3MAKA 3IDMB 4FI6A 2V3EA 5C04A 4PLKC 2GW5A 1BHGA 3EDEA 5F1NA 4AIXA 4LSPH 2JKIS 4Z8FH 4EUPH 1PFCA 1RFDL 1HAUA 3PPUA 4H1LH 1ET8A 2CZNA 4LF3A 4NZ8A 5IB5B 1X7QB 3HAEA 3HN5A 4PWGA 1KGXA 2F7OA 2DKSA 2UWEF 3CSYA 2H66A 1BREA 1PZ3A 3KP8A 4PJAE 4PTSA 4X5RA 3GMPA 2N01B 2OXHB 5JOPE 3ZITA 1QUPA 5DAKA 1TQWA 5CNHA 5AQ0A 5LBSH 3VYNA 4D94A 3L8QA 2E86A 2Z8VC 3P4MB 2CMRH 2O89A 3IFOA 2XPYA 4Z3IA 2DM2A 3TBCA 2LTQC 5GS0H 4XMWA 4UILH 4HEMA 5KBLA 3ZKSD 2FEDD 3L1GA 5E8EA 2PCFA 2ZX5A 3SYCA 2Z91B 4POZD 3LV3A 1HHHA 1HWGB 1FOHA 2GJ6B 4EIBA 4JDZA 2NY3C 3MDKA 2GEQA 4B97A 2AGJL 3AXHA 4OZHA 4HU7A 2BRRH 3JXAA 5D7KE 1RURH 3RWEB 2H3NA 5CD3A 3CZSA 4KXZH 1U8LA 2ZP9A 4LVOB 3FSOA 1LK2B 5CEZH 4HJEA 1IEAA 5J11C 2VQUA 2JKRM 2A38A 2XFXB 5B3NA 1W6LA 3X14B 4PJHE 2CWRA 3K1KC 4NCC2 3L4UA 3QNFA 4NNXB 1G7JB 3GJFB 1HSBB 5FLVA 2KMWA 2W0FA 2EDHA 3L3JA 3OX8A 3HY2A 5FUOL 2L5LA 5F8BA 1AR2A 5I23A 1ACYL 3NEEA 4PWJA 2AQTA 1BQRA 1GGYA 5B1JA 2HN7A 3WJLC 3QH3B 2X1PA 2XVKA 3QXWA 1G0TA 4OLVL 3QNXA 4PJCA 1HHGB 1I3GL 5IZ7A 1OHQA 5EIIB 3MMEB 1MF2L 5E5UB 2FEDC 3ZL5A 1B4LA 2BDNL 3OMAB 4POZC 2GC7C 4FQXA 3QEQE 4JUTA 5E2UL 1EO7A 1ZOXA 2BZCA 5EB9A 5A4UA 5DT1H 5FFLA 3MQIA 5AVQB 1W80A 1K0MA 4L8EA 5JQ6H 4Z9KB 2CQ9A 2DSAA 4AG4L 4XNYL 4UTAA 4LGRB 3TU6A 4MDIA 3VXME 1KCUL 2D31A 5DDLA 3F3RA 4LLVB 3JVGC 5FS5A 4Y4KA 1A8ZA 1BXVA 1RJYA 1F1AA 2L0DA 4IP6A 3BFWA 2ZG2A 2ZOWA 2YGQA 2IGLA 4XTRC 5J89A 4FG0A 5FGBC 4R0LA 5AYTA 2BSRA 5LXGH 3GMLA 4KDYA 5DD5H 4HZAA 4AJ6A 3MRFB 1GAFH 3ILDA 4ZAKA 3C8EA 1FVEA 4EN2A 1DBMH 1FZJB 2ARJA 1NGXA 1NGYB 3IPZA 3M17B 1WRFA 3QJXA 4JG1L 3G5VA 2GTUA 4EO5A 3L2NA 1KELL 3JVFC 4DERA 2O6PA 2AHIA 1WD8A 4UTCA 2GJ6D 4AMKL 1K2DA 2I07B 3MV7E 4PD4K 4Q74A 5AVWB 4YWGL 5I76B 4X1UA 4AXWA 2ZXBA 4W1TA 1FV1B 1NFDE 3FTGB 1CLZL 2V5YA 1A7NH 3H6JA 2YEZA 4EPSA 5KJ7E 4HKZB 1YECL 1UH4A 4Q56A 1AP2B 5K9JL 3CBJB 1O6VA 4BSWA 1SXSA 3T71A 5F7EL 5JTWA 1QLEL 3QUMH 2GQHA 2R9HD 3DPBB 1DQMH 4G9HA 4XE5B 3HE7A 1BYOA 2UVEA 4HS3B 2NT1A 5D93A 2X9WA 3PWPA 3SCMD 5AWNL 2MOQA 3CZFA 4IMKA 4FMKA 4OUOA 5CZVH 2EYRA 2VT0A 2B1LA 1JCVA 1RU9H 3DIEA 3L9RA 1EZVX 1NTDA 4QKXB 4CMMA 5AD0B 1KCRH 4PH8A 3SY6A 3OB0H 4MMYA 4J4PD 1TPXC 4GSDL 5L8JB 1IBBA 5DK3A 2W9EH 2WXHA 2OMXB 1TO4A 2APFA 2UY6B 3IXTB 4AYGA 2DQHL 3DUSB 1UURA 5DD0L 4EI6B 2F58L 1G7HB 1IGIL 5DWUL 4JG9A 5DF0A 4HISA 5F3BA 2DIZA 2H2PD 2WIIA 3RTQB 1YEWA 3HW7A 4URTB 5B7FA 1AS8A 4OB5L 1GW0A 4Z5RB 1ZLSH 1WA2X 3NCEB 4JZOB 4JY6B 5CS7A 1RZ8A 5FYJD 3ZOAA 2XIIA 1D5IL 3PV6B 4YDLB 2R9HC 3SOBL 5JHDE 2X64A 2Q8AL 5D7JB 4JJOA 3SCMC 4IHOA 4NQUA 3LZLA 5AYQA 4NC2B 1VGKB 2AQQA 3EYQD 1YDPA 3SE8L 5DJCA 1CGXA 4XP1L 1JZRA 4HJMA 2EDOA 4M7ZB 4J4PC 4YSCA 2IGFH 3CX5J 4M4RA 1TTGA 2R4RH 3WLBA 4CW9A 1CC3A 1I7UA 1NEUA 3PJSA 5E9DD 4HU8A 2CK0H 3QJFA 4PGZA 1QLFB 1S2EA 1SQ2N 3TO2B 2IL3A 2ODIA 1IARB 2CIIB 2Z6FA 2H2PC 2P31A 2VABA 5JHAA 4E41A 5FA3B 2WCSA 3KCPB 3MGOA 1WZ1H 2YPVH 4HIEA 4KZ0A 5HGHB 1NPUA 1LQBC 5ECKB 4Y7OC 4N6RA 4YDJB 5AOIA 2ZXEB 2Z9SA 4JR9H 4IBPA 1O75A 1JAEA 3G2QA 4XMKH 3ERXA 4JS7A 4CILA 5AFAA 2R0PA 2F7PA 2ZUQB 1ZGLA 3T0VA 3K71A 1YC8A 5BRZB 1MHPL 4ZFZA 2EDEA 4ODXA 3WNLA 1DTDB 2BIPA 2WVUA 3MV8D 1FVCB 4M62H 4X6BA 1SM3H 3D8MA 1D7CA 1HNBA 5AAWC 2IMDA 1FH5H 1L4IA 4F9PA 5GSVB 5EZPA 2H6PB 1OKEA 2BSSA 5A5KA 1UJ3B 3GMQB 4G59C 3TCLA 2WBJD 3THMH 3CMOL 4TVPE 1H3PH 3DX8A 4JM0A 4BA7A 3MFFB 5ITFA 4KX4A 2CALA 1JMXA 1JS4A 1SVBA 4YSAA 1T1ZB 3QZWG 3FT2A 2XT1B 2V3DA 3Q1EA 4G7QB 4GAYA 5EBWA 4H0GA 4CVXB 4QRFA 3ILQC 1M2VA 3V7AE 2TRHA 1DN0A 1R3JA 4ELMF 4ZXBA 4KJPD 1RZPA 1TYJA 1NBZA 3QDMD 5AOMA 4QL9A 4JLRB 3SKJH 2KC0A 2OMUB 2HMID 2YSSA 3M7FB 4OU3A 2PW1A 4N2BA 4PJDA 3EJPA 3APMA 3GC3A 3UZEC 4AI7A 3EW3B 3L6FA 3BUIA 1EJOH 4NI3A 3QFBC 3BZ5A 3RWCA 3SB3A 4YHYB 1PZ5A 2VDRB 1ACZA 4CY6A 5E6ID 4P06A 1BEYH 5DK0A 1QUNB 3WNKA 1KTCA 2M1KA 4PJFF 1U41A 5DURD 3KDPB 4EF0A 2WBJC 5FYJL 2VCOA 4GIPD 2IWFA 3KPSB 4OZGF 4JREC 4EZLA 3TF7C 1O6TA 1PVHA 3TPUA 4BWWA 4RMUA 4KZEH 5DHXB 3VXUB 1HNAA 1JGEB 1FE8L 1R7HA 3U6XS 4BZ1H 4AEIL 3AU0A 3LS4H 5C0CE 5TFSH 4I77L 3P3UA 2XG5A 3WEXB 2IWTA 2AXFA 3Q06A 1J9TA 2BXYA 3DSNB 4KJPC 1YNTF 3OLDA 4J3UA 4BH7A 4D0DA 3GKKA 2EXSA 3QFDA 2HMIC 4UM9B 4QYOA 4Z95L 1RZGA 2ICWB 1JNNH 1S7RA 3PU7A 3V0FA 1UD3A 1QKZH 4CN1A 4D9QD 2XZAH 3EFDH 1C7TA 1DEDA 1WBYB 1XH3B 3HA0A 5KANG 3MNMA 2NW2B 1VZGA 5E6IC 4BSJA 3NSDA 4MD4A 4R7DB 1GTNA 3ORJA 1KTKE 1M42A 3MGAA 4JB9H 4JKNA 4AOFA 3GUTA 1XB8A 4QRTA 2JXMA 4DQOH 1X7SA 1H3XA 4K5RA 3F4RA 4ACPA 4ZQKA 4ORZC 3HE6D 2FD6L 3I9IA 1ZLVH 1FW1A 3RZCB 2CRIA 6TAAA 2E59A 1P7KB 2C3QA 4HF5H 4N8VA 1FIGL 1FLTX 3CFBA 4BRJA 1UFUA 4HWNA 1OT1A 1NAMB 1NIFA 3L3OB 1A0FA 1KPRB 4NBZB 5KS9A 1PLCA 3L3KA 4PGDA 3VXNA 4PJ7E 3O6FD 5F9OH 2ZUQC 5BUPA 4NZFA 4YZFE 4IM8A 3GBDA 3ARFB 3NAAL 4U3CA 4WNSA 4D2NA 1GSSA 2PCPB 1EOHA 2F1AA 2XZQL 3DYOA 4OCRH 3QG6B 5HHME 5HHQA 4PJGE 4CADB 4JHUA 1UJ3C 1AZZC 2R1XB 3QJHA 1PPIA 5DQ9B 3TBYB 1WHOA 2BIOA 1X5FA 3EHBD 5I16B 5DD1H 4FE9A 3UL4A 3MLRL 5C0AE 1OZTG 5FA4B 1U30A 3HE6C 1WBZA 3GIVB 5AKTA 2YJHA 3QFJA 4FNPA 1BVKA 1VF1A 4WEYA 3BKJL 1DVFD 3V0IA 2F08A 1PD0A 2GY5A 3KBEA 1I9JH 5L7XL 2AEIT 2HUEA 3NOIA 3OF6D 4L8SA 3CE1A 4GRWB 5F3HA 5JXEA 4DZ8A 1SK1A 2WXLA 2HPOA 3FN3A 2VL2A 4UM9D 1WIPA 4S2SA 3O6FC 1MCHA 4U1KA 2CHZA 2P42B 3B2UD 2YD6A 5DUBA 2X5PA 4QHUA 2UY7B 3FT1A 5F1IB 3T5WA 3TYFB 1ACVA 2FO4A 3VG9B 4J3OF 3SPVB 3UVHA 4J23A 3WSQH 5LLIC 1UG9A 4P9MH 2ZWKA 1A4KB 2JCCB 3GSWA 3JUZA 1JWSA 5E4EC 1ON4A 3VFPA 2B1AH 1OC8A 1FFQA 1KBGL 1X5JA 3MCLL 1Y18A 2XTJB 4MD5B 2E2GA 2IPKB 2WNXA 3L1OL 4AM0A 3EHBC 4QLRA 4HG4K 5HYJA 4NO0A 4HMDA 3GO1H 4K3JL 3NFPA 4FQ1L 2F54B 3GRBA 4EKXA 3ZZXA 1S7WA 2XWBA 2YQBA 4J2FA 3CV5A 5TF0A 3VTAA 4CSTA 1DVFC 3QIUA 3OR5A 4FZEH 1BFOA 3QPMA 4AQ1A 1S8DA 5C8JA 5ELGA 1CXHA 2XG4A 1E27B 3GMMB 4PHXA 4NQDA 2W9DH 1TW9A 2K8SA 5DJAA 1JRHI 3FFDB 1ORSB 2BWIA 3B2UC 4Y16A 1F37A 1P2CA 2FSEB 3GL5A 4W4OA 4Z3TA 1M4KA 2JJWA 2XRAH 3SPGA 3IGKA 3QXUA 4PRHE 5C97A 3BH8B 1M9BA 1QPKA 1CTNA 4FA6A 2BMKB 3LXAA 5D1ZB 5KVGH 3QEUA 3I6LD 1S7TA 1JZHA 3FCTA 5GS1B 1FO0B 1GJUA 2C26A 2VLJE 2WUCH 1W8OA 3REVB 3LPFA 3AABA 3T4YA 4Z76A 5FYLD 2PP8A 4UDUA 3GA4A 2B0SL 3HI6L 5KSBA 1Y1DA 5MENE 3BVTA 3SQRA 2VDRL 3RKPA 4OF7A 3P30L 4U6HB 4XC3L 3GSNL 2V7NB 4OTXH 3E3EA 1UA3A 2NY0B 3E9JB 1CFQB 4J8RB 2FX7H 2HZEB 1IU1A 4Y1AA 4PR5B 1OSPL 3LZNA 5B4MD 1FZOA 4UQ2A 5K9KA 3F64A 1ZSDA 5I1LA 4I2XB 3JTTB 4WW2A 3UTTD 2E7LA 1RUQL 4F1ZA 4X0KB 2DLEA 1OAZH 5HVHC 5D4HA 2NRDA 4FGMA 4Z18A 2COVD 1BZQK 2WM0A 2D7NA 2IC2A 5CZKA 4TQIA 4JG5A 4GSQA 1LP9B 3ESOA 4KI5E 2VDLB 4WF4A 5F7AA 3HZYB 3ZJAA 4A63A 3D25B 2F54D 1DE4B 4M3HA 3VXQB 1CK0H 1Q9KB 3DJSA 1QXHA 2Y1VA 3M8OH 5C09B 3UABA 1VADA 3C75A 1AXTL 2XV0A 3DX3A 2D9CA 3IE3A 2YMOA 1YRKA 2R29L 2NXYD 3SYAA 1HINL 2Q86B 4QRBA 3RLSA 4U1MB 1QO3A 3VI4B 3DMLA 1NCTA 2RA1A 4FFWD 4HJ1A 4Y2DD 5B4MC 2Y69B 4KO7A 5DHDA 2PO6D 1T5WB 1FDLH 3MXVL 1VRSA 4OZFA 4J3OH 2VW4A 4MB1A 1IC5L 2A6DB 1QI4A 1NIAA 3RWGB 1CBVL 1A0RP 4E9QA 2VYRE 2EKSA 2QSQA 3SGKC 5A43C 3GINA 1HTYA 1X5LA 4TF4A 3SO3B 4LSTL 2FWUA 4Z6AT 1UT9A 1PQNA 3ISYA 4OH2A 3B2VL 4CJ0A 3VU1A 1MDTA 3I50H 5FOBB 4C56A 2FUQA 1SJHB 4G11A 3HG0A 3A5IA 1CTMA 2AXWA 4GXVH 4Q6IB 2EC4A 5J7CC 2LQOA 5F89B 4RVBA 1YMMA 1K5WA 1VEPA 1Z3GL 3DXAB 4GQ9H 2B7JA 4MNQA 4R9HA 2NXYC 3BJLA 3WFHA 3P9LA 5C6WH 4M7LL 1R75A 1DSFL 5EO9A 1RULL 4PJ8B 2BVQA 2XY2A 1MCNA 5MP6H 4Z3FA 1TQBB 3ARGB 4FFWC 4AYDC 4Y2DC 3G08A 3K5SA 1G7PA 2HVKA 5FYLL 3HI1B 3DBXA 1U92B 2PO6C 1QI3A 4ODHL 5ILTL 3SKMB 3EJYD 4KTGA 3GSTA 5K9QG 2CXKA 1MJUH 1NDTA 4KY2A 2IFFL 1QSZA 1DQQA 5H94A 4AYID 3QYCA 2ZKWA 2BP3A 5C7ZA 5ICYB 2RM5A 4UV4H 2D2ZA 3MV9E 4G8FA 4ZZFA 2X9XA 2LSTA 2CPCA 3CVHH 4OAWA 2WO4A 5AW9B 1HK6A 2IDQA 4N85A 3GMFA 4GUCA 5E00A 4P46D 5EZJA 1OTUD 3TURA 1A66A 1YG9A 5C09D 3RPPA 1IFGA 4K7IA 4KGJA 1ETB1 1FSKC 2GZYA 3VMOA 4QRSA 3RVWD 3LXTA 3PH9A 2O72A 2JJTA 3QJSB 1I85C 2GEEA 3FR6A 3BX7C 1A6WL 4PTTA 2GGTA 3ALPA 2YGOA 2WJ7A 4R8WL 4GFXA 3L17A 3D39D 2CGRH 2CR0A 4NFCA 3AZUA 4KRLB 4N0VA 5CBEB 1AGDB 1PZ2A 3EJYC 1UADC 2X28A 5DCGA 3NGBB 5MI0C 5KYXB 1GH7A 2DBLL 3L4YA 3CVIL 3D3VA 3FB5A 5BZZA 5H35A 2E9JA 3LS5H 5EU4A 4NUGL 2GT9B 4NRZB 5KBPA 3DX6A 3FF8A 1E7UA 4LL9A 5DALB 1GIGH 2QPDB 3EDKA 1UM6L 43CAB 4APQB 3GV1A 4IJIA 2H41A 3H79A 3F12A 1Q0EA 4P46C 4Z7UE 1OTUC 3C08H 1X5CA 4YH2A 4H2CA 3M1OA 2XX0A 3ZR6A 2XN1A 4J1UA 5EUKA 5GAND 5BV7C 4EDWH 3NN8A 8PAZA 1JGVH 2J1XA 2OK0H 4X6CE 2ZWSA 3RVWC 5HVWA 3NVQA 4XP6H 2FQFA 1FNFA 5FF6B 1LD9A 2HT4D 3KPMB 3P4LA 4AT6B 5CJ5A 1OLZA 5KZCD 2QPEB 1SL2B 1KJVB 2X7LA 4IRZH 1OCRB 3B83A 1EHKB 5HJBA 3TVMA 3ZDXE 4KW6A 1SFHA 3P69A 4RQXA 4KDVA 2MCG1 4HCRL 4RISL 1C12A 1N5AB 1ZS8B 4JU5A 5DEGA 1EGJH 4WU7B 4K55A 3GTUB 1B0IA 2JJUA 1XSKA 5PCYA 3F63A 2X6BA 1KXQA 1SY6A 1BVOA 2VXVL 5GGTL 2ETWA 4N1HB 3S0PA 4K3EL 3FZUD 4Q6IC 3P3TA 1TEFA 2OA7A 1Z2KA 3MOAH 4U7SA 1LEIB 1JF1A 3BP5B 1Y07A 3KPRB 1SKWB 4Z7QE 1MI5B 2EKJA 5FW6A 3OKMB 5DJ8B 1UWGH 1JPGB 1GA2A 3UEQA 3DX7A 5IMFA 2HT4C 3SBQA 2VDLL 4AE0A 4U6VH 3VU2A 4MS8D 1QFNA 1X9WB 1MZYA 2CKBA 5IPGA 3MUZ1 4KKZA 3NUKA 4IKIA 3IETB 2OTUA 5J4UA 2Q3AA 3QJRB 4N2EA 5ANME 3W0WD 4D9LH 4BUGA 3F7RA 4UOW0 1JHKH 4IHUA 3QSKB 4OM1L 2N7BA 2DC5A 1A5FH 2HFFB 1X7TA 3K6SA 3LNGA 4UYQA 2WINA 4XP9H 5DDHB 3L3IB 3RJDA 4RUVA 3LJ3A 4MF5A 3FZUC 2DQIH 3UMTA 5I75C 1NAKH 3VYPA 1MFCH 3EJZD 3DVFA 4F2FA 3QIBD 8FABB 1XR8B 3D2TA 5CP1A 2EECA 2Q7YB 2X1OA 3RWHA 1KPVA 2P45B 3L7FA 5D7HA 1MDJA 2P3YA 4L9LB 1PJ9A 3PGDA 3QQ3B 2WYHA 5HDQH 2XPGB 4ZO6A 3V6OA 1E50A 4MS8C 4UU9A 4ADGA 5MEQB 3DJTA 4OMVA 2BHUA 3IRPX 5E8DH 2BSED 3KPNA 5KVDL 1O9VA 5B6NA 4BFJA 5HI4D 1OP4A 1PNDA 5AZ2H 3QB7C 5LBGA 4Z7XA 2XPEA 2H5UA 5G5DB 2RHEA 1N6QH 2LRNA 1ZXKA 5CRGA 3BDBA 4N0UE 3T2PA 1O7SA 2VJXA 1T66D 4HXAH 3UTPD 4KXDA 6PAZA 4I97A 4OQ1A 3EJZC 2A74C 1AIFA 2C9PA 4M8QB 5C2BL 3QIBC 3VFGL 2X2YA 3BGFC 1XCQA 1UA6H 2Z31D 5T3ZH 2H0IA 2O6FA 3T08A 4ETYA 1M05B 4HUCA 1DLFH 4N0YL 4W6XB 4KZDH 3LN5A 3MJ7B 1V9WA 4JJ5B 4LFHD 2BHYA 1QRNE 4ONHA 5IV2A 4UOW1 5HQPA 3CPUA 3SJVA 1A14L 2NOYA 4ZMXA 3UOAB 1U0QA 2AP2A 1CG9A 1A6UL 1BJMA 3QI9D 3RL1A 1BQHB 4B5ZA 4JRYE 2K3TA 3IVKB 2BERA 2P8MA 3HTLX 2V6HA 4LK4A 3LH2H 4MXWH 3C5JA 4MMZA 4RIRB 5DVOA 5HI4C 1LO2L 2H1GA 1B4JH 2VJ0A 4IBLT 3W2DH 1EHNA 4DKTA 3OC5A 5E94A 1SOSA 2J7LA 3LSOA 3MRRA 1ZV9A 3MSPA 4GI6A 1AIZA 5I6NA 1AYOA 2V3FA 4U2YA 2FWGA 1T66C 4BE5A 2G9KA 1CXLA 1T3FB 3ZSSA 1OB1B 4P5MB 3FH8A 3VSVA 4O02L 3LZOA 2OMZA 5IKCA 4P3YB 2Z31C 3O11B 4Q4EA 4UF7C 3CFCL 4NNYB 2LNSA 5KSBF 1PZDA 5FUZH 1X44A 2WWNA 3QJUB 4WTWA 3OVUB 4K7PH 2YK1H 3BMWA 3LKRB 3EURA 3RDWA 1OE8A 4MSWA 4NOFA 1PX3A 5EZOH 1PLGH 3KL3A 4L37A 1W72A 4B9CA 4XPAL 3N1QC 2FGZA 2BNRA 4AIZB 1R5PA 1S7XA 1PG7X 1QSVA 4PRIB 3E9TA 4LPYA 5C0IA 2WLZA 6GSYA 4WW2F 1YEJL 1EWXA 4RX4A 1FNEA 3FB6B 4B9IA 4XBGA 1U8OA 1PZAA 2EICA 2XNAB 4H4NA 4WK4B 4AQEA 1X6LA 3Q6OA 4LE8A 3MCG1 4M5SA 3BAYA 2FJSA 2MWCA 5D7IF 4X5XA 3BOAA 2FT7A 1D6EB 4LRIC 4LXFA 5DC2A 2WRTA 1XGQB 4A7SA 1KFAL 4NKOA 2EUZA 1YY8A 1CGWA 2WZ0A 3BT2L 3AM8A 4OSUL 1JN6A 4Y19A 1C8QA 1II4E 1ZIAA 2DBJA 3ROOA 3TJEH 2VSCA 1EXHA 3BUPA 4UWQB 5DHEA 1UH3A 2CGYA 7FABL 2RM6A 3NCJL 1V98A 1T1XB 3UP6A 3M46A 3QQXA 4JPSA 1LVEA 2A4EA 3MNVB 1ASQA 3O8XB 4ZSOA 5AVXB 4A68A 3OAWA 5EWIL 1AQWA 4FMVA 4AJYV 3G5ZB 2KDGA 1TYEB 4OLWL 4X6DB 2BS71 5TH2B 2XWJA 3TH3T 4YZWA 2RQEA 5ISZA 3ZE2B 3BQUA 4IOIB 5G5EA 4HJUA 4HUWA 4HKJB 4IEFA 3ISOA 3VM5A 3CU1A 1B4QA 1MHHB 5FHAL 1CFSA 3HD5A 3ED3A 5HFKA 2NZ9D 1IIKA 2KPWA 3LZRA 4EO3A 1T5XB 1OE1A 2P8PB 3HZKA 4M4PA 4WAFA 4NC1E 4NKIL 3ZO9A 2CBPA 4JO1L 4BCZA 1SOQA 1FGNL 4Q7DA 2Z64C 4HH9B 4QRAA 3N3EA 2J4WL 2ZP0T 3B8SA 2JIXD 3CWGA 1IC7L 2AEWA 3R06A 4MA1B 2X3CA 1QSEB 1Z1WA 2KLRA 3MRBB 5ENWB 1G94A 3WDHA 1KIQA 4MNGB 1O6SB 3DETD 3P0YL 4B96A 2AJSH 3UJIL 1QG3A 4KVNL 1NSNH 2DH3A 25C8L 4ZUSA 2BCKB 4JM2B 2QHRH 5A2IH 5HPMB 4GG8A 3UDWA 1MWAB 1WE0A 2W07A 4IRJB 9PCYA 1RUPL 5IUCA 2OE3A 3QAWA 5IOPB 4B9JA 5DMYA 2CA3A 2K45A 1BBJA 1QLRB 3PL6B 1EV2E 3KZQA 5HYSB 2NZ9C 1YEFH 3MJWA 4KJYA 1BCIA 2DQUH 2QQLL 1CD1A 1EEUA 2OMTA 3FT4B 4MJJA 4TUKH 3I6AA 1T0PB 3HNTH 5F9JA 1AQDA 2IAAC 5CINH 1LMKA 3WL9A 1IX2A 2FEEL 4GG6E 2K1MA 1CURA 3V0GA 2AV7B 2IANE 3M1CA 5J6HB 2PTUA 1J88A 3QQ4B 2D03L 2WWKO 5F06A 3PHQA 4Q0XH 1N10A 4K2XA 4MMMA 1S7QB 2KHAA 2PLTA 4MWFA 4OJCA 4FHJA 3DETC 2VXTH 1AE6L 4KBPA 2PN8A 4LCWD 3ZVJD 1R3KB 1HI6A 1JZFA 3C6LB 3FRUA 5F6IC 3D07A 5ECOB 1UD2A 3FONA 1B9XC 5F1SA 4NO2A 4YGVA 3IPFA 1SLVA 2A6KA 5GRZA 1OP5H 1T03L 3ZTJG 4M5ZL 4PJIA 1I3RA 3HZVB 4ZI8A 2OS7A 2F8VA 5SWSE 1AQ8A 1B8XA 3TP4A 2C9VA 1YJ6A 1UB6B 3U4BL 4OFMA 2VL5A 1GYVA 1YAZA 1QBLL 4PUBH 1UEMA 4FQ2L 1ADQA 3DIFA 4PQ1A 4P3WA 3IDYC 4PJ5B 4NEHB 2P5PA 1IGJB 5A6MA 1DTVA 3L4NA 1SJZA 1RMFL 2IFQB 1CYGA 1MRDL 3DWVA 3RBTA 5AEAA 4HUVB 3RGVD 4PJXA 1NMCC 2IH3B 2RIKA 3UTSD 4DCQB 3SDAB 3L4WA 1KZQA 3FMWA 4QF1A 1BZ8A 4JM4H 1NIEA 4H25A 1U8NA 4CBPA 2C8UA 2R2BB 4ZFQA 4U4IA 3HC0A 2YA2A 2BIMA 3O6TA 3T6QC 3R7RA 5EF1A 2DN7A 4ZW7A 3ZL4L 1DUZA 4QTHA 2XLLA 5GGUA 1JV5B 1R5VA 3BCFA 4ZFGH 3DRQA 1C08B 2DF3A 1M71A 1A6ZA 1KEMH 1JHTB 4NGHL 4YIQB 2AJVH 5IY5B 2C3XA 1KFGA 4HV8B 5LO7A 2I32A 4HQQH 2LFEA 1HWHB 4YS4A 1IM3A 4MA1C 1SJEB 2VISA 5H37A 1PL3A 1X5ZA 1J8HA 4FTVB 5DFVD 5EZLB 1YDKA 3F9UA 1O7VA 2GCYB 3RGVC 2WCGA 1T7YA 3D34A 4L4TE 1MW1A 4HLZG 2R23A 5I17B 3VM7A 1ZLEA 5HHOA 3TESA 5EA0H 5AOKA 1R0AL 1KACB 1CCZA 1ORQB 4PRPD 3QG7L 10GSA 1RK7A 4QUOA 5DUML 2OSWA 3GKNA 3J07A 1AHWB 2PETA 2JSYA 3GI8L 4E9WA 1M3JA 1G9ML 1PY4A 1T89A 4Z78B 2AV1B 1XIWA 1TDIA 2IWKA 4M1DH 5EOTA 4M7JL 4JO4L 1NBVL 3Q48A 5C3LD 2WKOA 1T04B 3WMQA 1DSBA 3MNZB 3C60A 1UD8A 4I3SH 3LIZA 4LHUA 3KH4A 2F61A 3BKCH 5IVXE 3OHXA 3STZB 3UPCA 3GM0A 1D5ZA 5DFVC 2WPGA 4HSCX 2FT6A 4N8PA 5DHMC 2F0CA 4BK5C 3DTXA 3HZMB 1ES0B 3HC4H 4GKOA 3TOUA 4F2MA 4WXTA 3V52L 1ZZYA 3KXFE 1AZCA 2HKAA 2IDSA 4PRNB 2H8PB 4HFWA 3DX9A 1MJJB 2EDMA 1TTUA 2VO4A 2AKRA 1IGCH 3HBGA 4DPAX 1HC1A 4HPYL 1DANU 4LVHC 2VDQH 4A6YA 1E5CA 1MCOL 5CSZA 2IXQB 3T65A 3BD2A 2G3ZA 1GC1H 2A9ML 2CNZA 3QPXL 1OO2A 4YXLH 3T3PE 3HNSL 2KT6A 4FQPA 3INOA 5AAMA 2EADA 1M1XA 4GP5B 4NM4H 4PGBA 3STBA 3QQ9D 3DD3A 4GH7B 5DJLA 5L4MA 1U6AH 3DROB 1MWAL 3LQMA 2IG2L 2WB1A 2VDMH 1ZANL 4FL4B 4PI0A 1KB5L 2DS4A 4F7CA 3JCML 3EUUA 2P4AB 4DFIA 4MDJB 2NY2B 5FO8A 3KYMB 4LPTA 2NCEA 3VFUB 4OIFA 3HHRB 1Z9NA 5CUSL 1P6WA 4I0KA 2RFXB 3DVGB 3PNWA 4OBRA 2REMA 4M93C 1I9IL 2DQTL 4X8JB 1DE2A 4MB3A 1QNZL 1IBZA 4KAQH 5I26A 1G4MA 1KTBA 1LMIA 2CLZA 3GXNA 5D96B 2VM1A 1BG5A 2XA8H 5I1KL 4LU5H 1KG0A 2IJ0C 2X9YA 4JN1H 2P52A 4PJAF 2I4AA 2DQDH 3D4CA 3Q5TA 4DN3H 4X99B 1B0WA 2YWYA 1U8KA 5BVPL 3KLHD 1U3HA 3IMWA 4NUMA 1A8YA 1PD6A 1KIUB 2B1OA 1T4KA 2CCLA 3MCKA 3PE9A 3QQ9C 4GW5B 3RAJH 1GGCH 1WP6A 1FC2D 2NLJB 4L5FL 4XNAA 4UINH 4ZNEA 4QL7A 4DT2A 4C59B 4TV3A 3L1EA 2MNJB 2X4TA 4GQQA 4LKCA 4Q8BA 3T9WA 4AKPA 1YYLL 3DHJA 2IAMB 4WW1B 1N5YL 4QXWA 1HAWA 1HJCA 1RK1B 1JK9A 4PCSA 2CJ3A 1YF0A 1AS6A 1A3QA 2BP0A 3E1F1 3WNMA 4OCEA 4OCFA 3B37A 3NYKA 3PDOB 4OLZH 4MPFA 2EAEA 4P2OA 3WGXA 1VFBA 1K8DA 2G0LA 4GQZA 5IBTL 2JK5A 4OUUA 5EBMB 1R1CA 3OAZK 3BESR 2DJ2A 3OAYK 4WWKA 2GJZA 4O2CA 4TUUA 5DD3H 4ZNCD 1WS7A 1SMOA 3W39B 4GEJA 3W57A 5BMUA 3F7LA 4NZDA 3KLHC 3ASNB 2VWEC 4ATWA 5IB4B 2CDEA 3VXMD 1DQDH 3WOVA 2KH2B 2Q6WA 2C7FA 3MBXL 4MJID 5E8OA 3AXLA 3MO1B 5TE7L 4X9IA 4G5ZH 3ZKXB 4M1CD 1P4LA 1M99A 2ZCLH 1IBHA 3VI7A 5IMAA 5IW6B 4CDGC 2X4PB 4FKHA 3SDXA 2XYBA 2E56A 5I5RA 2E7MA 3TM6A 1W0VA 2SEBA 1EMTH 2A2QT 1U33A 1PGRB 5EBGA 2HFTA 2FBJL 1MAMH 2FL5A 2J5LB 3P9MB 4YPGB 3SPIA 4PRDB 5FYKE 2HRNA 1SN0A 4LRNH 3KVDD 5KOWA 4KZCA 1T80A 2I27N 5BZWB 3MUJA 3MV7D 4Z0XA 2KZWA 3RY6C 4O9HL 1NFIB 2AV4A 2XPZA 4I3GA 4MBRA 3ASOB 5EBLB 1T1YB 5BQ7A 5KVEH 4DKFL 5CO3A 2XQBH 4BRVA 2OBGA 2UWEB 1TU8A 1QBML 1CU4L 4AGNA 2IALA 1WTGT 1A6VL 3S37L 1CQKA 1BECA 2GJRA 2MTAA 2NY1B 1WV7T 3EYVB 4JFEE 3VFOB 2DLTA 3MUUA 3QDAA 4M1CC 4HX1A 2BNQA 2X53A 1GR7A 1NFDF 4QWWD 4TN8A 4OIAA 5ECGA 5D6DA 4KUNA 4KUCF 2VLKA 4LCIH 2UX7A 4MDRA 5D7LA 3FUKA 35C8H 1PSKH 9GSSA 5D96C 2ZKHL 5BVJB 2GTZA 2P7TA 4WSJA 3WXVL 1LILA 2PXYA 1ERWA 3HG1E 5I30H 4FYCA 2VC2L 3LNHA 2OMWA 4EKJA 6GSVA 1SHWA 4I9WE 2F8OA 3UJTH 8CGTA 3FCBA 1WTLA 1SMAA 1F4XL 4RDQG 5I71B 3ARPA 1YEHL 4NZRH 1DVXA 2DKMA 3QORD 3QDGA 2AS5M 1JHBA 2W65B 1ZKAA 2APSA 1IC0A 2AJUL 3EBAA 3VGAB 4FHKA 2QR0B 4KKLD 1XH1A 2YGNA 4OD1H 1GP1A 3P8WA 8GSSA 1B9KA 3TASA 2YN3A 2GBVA 4QWWC 4KTYA 4DEPB 3CLEL 4ACTA 4K3DL 1ZMYA 5EPMA 1KCWA 3EF4A 3CXGA 3ZRFC 2WWOA 2MCAA 1XF4A 3HS0B 1EUTA 2C3NA 2VLLA 3SZ6A 4IW4C 1H3UA 3R0MA 4WI3A 3K6OA 1EJ8A 4NXSA 1TJGL 3RIFF 3ECBA 3HS9A 4M43L 1HH6B 3F6FA 4OLUH 4YBLC 3K7UA 4PU2A 5LG6A 1MVUA 3GLEA 2HTLD 4X4XB 2J8UA 1R5WB 1LK3H 4JO2L 4Q2ZA 5E08H 1VERA 1E4XI 1H3GA 1P9MC 1OQOA 1WJ3A 2WVVB 3TKSC 5HGBB 4HGWA 4PJIF 1SYSA 1X5YA 2AJZB 3QORC 5TDNB 4ZPVA 5LQBH 5E56A 2JCWA 3ZQWA 3GT6A 5GRYA 4CW1B 1JUFA 1MFDL 5GZOA 5JORA 3LKPB 1KN2L 2Z3FA 4YO0B 5E51A 4DW2L 1JFHA 4KKLC 1QYGH 2I69A 1RZJL 4V11A 2ZXQA 5C07E 2NTFB 2DM4A 3OKNB 1D6VH 1QMVA 2P26A 3ZYJA 2FYYA 1INDL 4TVPD 2X38A 3PCYA 3ETTA 4H13C 1QFPA 4HKBA 1GMIA 3DUHA 5D55A 2WD0A 3FQUA 4UQEA 5F9DC 1URIA 3VFMB 5D9XA 3TN0B 4K94C 2HTLC 3UC2A 3ISWA 4F15C 3T1FB 4EUPG 3UC0L 5D72L 4Z7WA 2A73B 3VD0A 1RK0B 4H1LG 2R2JA 2FX9L 1BD2E 1VLXA 2ALBA 1AIUA 4XVUD 1A65A 1ND0A 2ZCKH 4FFZA 1ODUA 3RI5K 5BPPA 5C0GB 2Q76A 1MFAH 2OV0A 3CYNA 3LQAC 1BFVL 4S10A 1CLYL 4NAXA 2DI8A 1IC4H 1WFTA 4NQSB 3EWLA 3KHQA 4GSNA 2AJYH 1JXDA 3GDCA 3QC5X 1JNLL 2HRLA 1EO8L 2W60B 4EZKA 3I43A 4WY7L 3FTUA 4TUOB 4JFFD 3EBGA 1U9KA 3O0LA 4EN3B 3GSXB 2ZYSA 4KVPA 4XHMA 1I3VA 2I7SA 2FT8A 1EK3A 4YN3A 2AF2A 5I1AB 2GPZA 1ID5I 3L3HB 4GW1B 4D3CH 3OKKA 1EJFA 3CD4A 4FXGB 5B3SB 3JWOH 4ZODA 1BZEA 2QFRA 3T2NL 4AC2A 4ZDHA 2BH0A 3CHRA 5C0BE 4ATTA 1CLOL 3SDDD 1ROCA 5DQDH 5GRUH 5E2VL 4XVUC 3QULB 3VGAC 1J9RA 3B7SA 3AS3A 5J9BA 3MLYH 2H45A 1U93B 1U8HA 5LD0A 1A6AB 1JNHB 2WKOF 1E6OL 2V33A 4JFXB 1K3YA 4YPJA 3TA3D 3H0TB 4NX0A 2F53B 1QSFA 3O9WD 5E5LA 5CGTA 2NY4B 1L0QA 3PJLA 2IH9A 2ZOKB 3BN3B 3DUUA 3MODL 2YPKA 3SDCA 1EANA 3EOAA 4M7LT 1LNUB 5B1AB 4UQ9A 1OF2B 2O5XH 4CDHA 5CCJA 1NUNB 1UN2A 4PLJD 3DI3B 5SX5K 3B4NA 2EO1A 2WW8A 4ZS6D 2NPBA 1MCKA 4WQOA 1TZ8A 2XJKA 4LVNC 2MOGA 1JBJA 2XWZA 1NLDH 1PDKA 3PREA 4HK0B 4MAUL 2C9SA 3QCVL 3SDDC 4ADJA 3BLPX 1J5IA 1S7UB 3GEFA 1FYTD 2Y06L 4MTMA 4K94H 4I1NB 2YPLE 4LOEA 1MLCB 1EXUB 1O0VA 4BH8A 2X4SA 4DK5A 2VIRB 5KAQG 3HNVH 3IU3B 14GSA 4BJLA 2FX8L 1AD0B 4WHDA 2F18A 4XXWA 5HHMD 2LLGA 3TA3C 1UTDA 2OMVB 4NCC1 3O9WC 1BF5A 1YYML 2X4UB 3B9KA 4PJ7F 5SWZD 4IU2B 1QBAA 3ZYOA 5I6MA 3LQAH 4B3VA 3NJGA 3O4LB 4WUUE 2GY7B 4ELMB 1JGUH 5J6GA 2OA9A 3INUH 5L2KD 3MGTA 3BSZL 2D7OA 3QO0A 2WCPA 1CVRA 5ECNB 4HK3N 2QKIC 2AQNA 4PLJC 4KV5E 4PJGF 4ZUWA 1ASOA 4TVPH 2FJFB 5C0RH 4PS4H 4ZS6C 1GSKA 1F1GA 2R69A 1MDIA 2XN2A 4H20L 1J8SA 4AGMA 4XMZA 4FQHB 4OQTA 3UYPA 2GSRA 2AZUA 2M83A 3ML9A 3O3DB 4NQCB 1J8RA 4BKTC 1W0WA 3KGUA 4YQXH 1U8QB 1UA7A 3E3QE 4Y2LA 5A2CA 4L8CB 1TMQA 2EIBA 3UAJD 2WY3B 1KGWA 1N7ML 4PJFB 5DJDA 3RPKA 2DQEL 1I8KA 4PQIA 1U42A 1TEGA 2A9NL 4OZGB 3V4UL 3CFTA 2GSTA 2LAAA 2MRYA 1Z7RA 3WTVA 1EAPB 3GSOA 4WI0A 4Y5XC 2WWMD 4OKDA 4AEFA 4OV5B 1T00A 4WEEA 5CMAA 4FP8H 3GH9A 3BZEB 1NSWA 3OZ9L 5ERWA 2WLIA 5BZXA 2KL6A 2XVLA 4KROB 1BZ9A 4WGVB 3NSFA 13GSA 3WV0A 4G1EB 2XWTA 4R90H 4AJ7A 1YNTB 3CC5A 1BQKA 2GFBA 2LAGB 2ADJA 2ZWNA 1C5BH 1HHJA 2AEQL 2ZZUT 1UZ8A 2WTRA 5F7HA 3G6DL 3BVNA 4UBDD 4OJYA 4L29B 1AH1A 3VXRE 5C9KA 4RGOL 1I1YB 1NGQL 1GGBH 3CVDA 1RIUH 3J7Yb 1UKTA 2IQ9L 5ID0B 5CJ8A 2X12A 1JWMA 3P7XA 2FY6A 3BGMB 3UAJC 2B2XL 2VLRE 4G80B 4I13B 5FR3A 1D5MA 2WNKA 3OQRA 5M95B 5C08D 3KG5A 2HG0A 4NZTH 3RPBA 5IEKB 1J9BA 4PRHD 2V5TA 4KK5D 1UKSA 2NY4C 2DMCA 2IPTL 2K8QA 3ZHNA 2WWMC 3V4PB 2OP4H 5F7DA 2B59B 1ZDSA 4L8DB 4RFNC 1TQVA 1UVZA 1QFWL 1DFBH 1OGAE 4FI8A 1E6JH 4BWTA 5A2FA 3IV4A 5MEND 3RWIB 3GSVA 1PG7H 4GRMA 5DZ9A 4P5RA 3BN9D 2JQAA 2EYTB 2ATKB 4JQIH 2E9WA 4TXOB 4K9EL 5E5MA 5IGXL 3DTDA 4UBDC 2R39A 3RGBA 4HS8H 5I8KL 1QNIA 3C09B 3Q5OA 1YO4A 3RX9A 2OFQA 3BE1H 3QIWA 3Q6FB 2GVPA 1ZLDA 4YE0A 3VWKA 1FRGL 5TDPA 4NRYA 4EVMA 1PMTA 2NY7H 3GMNA 1WCQA 3GMPB 3AC0A 2WQAA 4WR5A 1WVZA 4G2AA 4KK5C 1N0LA 3IJHA 1TETH 4NN5C 4XAWH 3J7Yk 5HSFA 1KF9B 4YQUA 3IFOB 12GSA 1LO4H 3FHQA 2C4XA 1RI8A 1KN4L 2M80A 2PCFB 1JPST 1N8ZA 4LEOA 3BN9C 2ISDA 3TIDA 3X3FH 5C7XH 3CMIA 5L88H 4PTUA 4OZ4A 2IADA 4GRLD 3D2UA 1INQA 4JDZB 4KX9A 4R7VA 4XS4B 2YOCA 12E8H 4KI5F 1TRSA 4FULA 3EJCA 1OOAA 3S35X 2B1KA 3MRGA 5CD3B 3IE4A 2VZOA 1JDDA 4KUZL 4ADIA 4NQEE 2P1YA 1IEAB 2Q5BA 4C55A 2EDWA 2YD2A 4K5LA 3QT2A 2WB9A 2VQTA 4JPWH 5D2NC 3SQBA 2WMPA 3W1ZA 5IHWA 3V10A 4FQLL 5I73C 2HUHA 3LD8C 4LDEB 1U8JA 3D22A 2W0FB 3F00A 3L3JB 5JIHA 3ULUE 4JFYB 5C0ND 4BK4A 1T7WA 2EH7L 2FLRT 2Y6SD 2YD7A 4Y4HB 5E03A 2HN7B 4M29A 2CK2A 5IG7B 1QZ1A 3VX0A 5K9OA 1H9VA 3AGVA 1VJSA 1ZCPA 3QNXB 5JHBA 4N8CL 1WBXA 5EEUA 3H56A 3MRNA 1YMHB 2DJ1A 4ZUTB 3NJFA 3OD3A 5LWYL 3GBMH 2IMFA 2D3LA 2KHPA 4GRLC 2PVQA 3WIIL 2OL3L 1P5UC 1TTFA 3T0EE 4LSUH 2FCHA 4OT1H 1I1RA 1MJ7L 4UZSA 4MDIB 3PFQA 2J8UF 1HXMB 2G0KA 3DA0A 3PXHA 3KWUA 4PB9L 4Y7MA 2FNBA 4Y4KB 1JYWA 2F8XC 2BX5A 4RQQB 2N59A 1ST9A 3MX0B 1IEBA 3FOLA 1MZZA 3CVHB 4AK1A 1JVOA 1WGVA 2FUTA 4HHGA 2BSRB 2OR9L 3GMLB 4R0LB 1F86A 2P46B 4ISVA 5C0NC 2DJ4A 5L9DH 4XS1A 2Y6SC 4ZAKB 1FVEB 3FYEB 4WF5A 5JR1H 3KEDA 2ARJB 5T8IA 4IDLA 1PIFA 3V5HB 4G3YH 3DGQA 3F3QA 4L0UA 1KGUA 5F9AC 2WOBA 3IGAA 3WLWD 4AXWB 3T77B 5DD6A 2CR6A 4KCEA 4QGYA 1B3IA 1WISA 1G1KA 5AVVB 2ZOOA 4DKAA 5EC2A 1OPOA 5GJTL 4XAKE 4JFTA 4U1LA 4WO4A 4NIKB 5B8BA 2AAVA 2J6EH 2N1KA 3HE7B 1XVQA 3H9SA 5GS2D 4OI7A 4JAMB 2OXGA 1HEZA 2V17H 3CZFB 3VH8A 3WFCH 3O2DH 1BOGB 2EYRB 2I9LA 3EFFA 1EOGA 3L9RB 2CAIA 2H73A 1SVZA 4QO1B 4MMYB 3X1BA 2CIKA 3MRJB 5JNYA 1SYVB 2DLFH 3GF8A 1XAKA 4ONGL 3FQTA 1ZEAL 4FQXD 5CJBA 2VAAB 2WNWA 1HSAA 4LA1A 3WLWC 4M48L 4MAYD 5F3BB 5KVGL 2WIIB 2WQVA 3L5WA 3FN0H 1D9KA 3V4PL 2FJGA 2NQDA 5MHSD 2OMYA 1RZ8B 2EDNA 2YZ8A 4LDLB 3CLWA 1UQSA 4GS7B 1WCBA 2ZWLT 3D12B 1ZGNA 3D85D 4F37F 4KDXA 4X6CF 3VD3A 2C9QA 3CK0H 1BSIA 4TVSa 3O2WH 1AGBA 4TLSA 1PTZA 1WZMA 5JPNA 2W95A 4ZAKD 4HYTB 1YDPB 2WXGA 5DMGD 2I26N 3ZDXF 1V7NH 5EF3A 1BDYA 1A3RL 1SUJA 3G5YA 5DJ2A 5IFHH 3GKWH 4YKGA 4M4RB 1X5HA 3WLBB 3DGGA 4K7NA 4IGBD 1I7UB 4E36A 5E8PA 3L0HA 2LU5A 3PJSB 4XO5A 5DRXA 1TFPA 1SU9A 3QJFB 3ATBA 3BWUC 4FQXC 3HBZA 4V1DE 4MAYC 5FM8A 2O30A 5D1XA 2VABB 2OKMA 1BPVA 4L2LA 4E41B 2DYPA 5GGVH 3MGOB 4HIEB 3TIEB 3APOA 3K0WA 4P2CG 4MH3A 3UJJL 3BVWA 4EXJA 1KNOB 4KTDH 2F5AL 4N6RB 2JELL 1Q9LA 4UV7L 2Q8BH 2OE1A 1OP3H 1ZGLB 5IB5A 1THCA 1X7QA 3K71B 4ONFL 4KX8A 2FLSA 4ODXB 4TRXA 2ZUWA 3PWPD 2PU9C 4XX1G 2APWA 2YMXH 2OXHA 4X6BB 1G7QA 1CYXA 5TQ2L 5LGYA 3OKYA 4PD4J 3C87A 3LIUA 4ANVA 1IM9D 2AK4E 2BSSB 4ZAKC 5DMGC 3TCLB 3P4MA 5GRVL 3SQOL 5ITFB 3S36X 3HVSA 4WK2B 3KS0J 1AI1H 4QXGH 1JLWA 2GBUA 4IGBC 2Z91A 1ED3A 5EBWB 4OCYH 4HBCL 3KCWA 1I9DA 5TF1H 4WETA 3BDYH 3L4TA 1DN0B 1R3JB 3BDXA 3RE0A 4ZXBB 1JHLH 4ECJA 3RWEA 3BLKA 1QABA 4P59H 4QTIL 4NN6C 3UXFA 1IFHH 2DLIA 2KLXA 2YSSB 4I1RA 4YL4A 1QFUL 2PW1B 1SF5A 2YMTA 2XFXA 3NBNA 5JW3L 3LZQA 4XN1A 2DQGH 1FA4A 4E5XG 5D93C 1G7JA 3GJFA 1HSBA 4F7PA 4XNQA 4RNRA 5L6YH 3DKSA 3TT1L 3Q19A 4PBXA 2HFGH 4UTBH 4P3CL 4JY4B 5DK0B 2Z4QA 4UTAL 1DBKL 2X44D 1EIBA 1HHGA 2IBZX 3HN8A 3TPUB 1I8UA 4RGMB 2LJKA 3T4AA 3JWDC 4QI3A 1GUKA 1T0NA 3FQRA 3N43F 3US9A 4Q9QH 1FBIL 5LXVA 4PJBA 2FATL 4XPFH 5EU7E 4X4MA 2YWIA 4NV2A 4MCMA 1RW1A 2VRKA 1J0IA 2XG5B 3F6JA 2IOOA 4E41D 1SL0B 1W6WA 2AXFB 5GIRA 3X1GA 1JF6A 3EOBB 2JFCA 2I25N 4LSRH 5LN4A 4TULH 3CIQA 4HJTA 4J3OG 1QRND 3QFDB 3IRCA 4LLVA 4P99A 3BHBB 3HMXH 3N9GH 4QYOB 3IDJA 3G3LA 1RZGB 5ALBH 1U8CB 3DNKA 5I0WA 1S7RB 3EOYG 4POYA 1GS8A 5CCKL 4XNBA 4L48A 3B2PA 4XCFH 4MD4B 1MKFA 3MRFA 1L9QA 1TDQA 5ALCH 4F80A 1I4FB 3GUTB 2NX5E 1HYUA 1NGYA 4QRTB 3V9EA 2ZXGA 3TTSA 1CFNB 2GZPA 1WAAA 4TYUA 1CE1H 3IN0A 4PWHA 3ESNA 4IDJL 5I76A 4N8VB 2NW3A 3LKQB 3CFBB 3FTGA 4ZXBD 4TSBL 2B14A 5K9QI 3KVQA 4OGXH 1H75A 2UZ8A 1DANT 3L3KB 4PGDB 1N0XL 2F15A 3UMNA 3VXNB 5HDLA 4F7KA 5DCCA 3DPBA 4U2ZA 2ZAIA 1ERVA 1E42A 1R34A 3ZYZA 4HS3A 2EXWD 1JFQL 2D3NA 3EGDA 4UT6H 1NQBA 7TAAA 3P2AA 3SGDH 1YZXA 2OULB 1F41A 1YJDH 2P5WB 3MRPB 3V4VH 1SXCA 4F9PC 1ZYEA 2EZ0D 4HXBL 4R84A 1XD1A 2XN9E 3GDBA 4TLTA 3LEVL 4ZO8A 2OMXA 3IXTA 4M5YL 1OPGH 3MACH 5EU5B 2P48B 4G7RB 1WBZB 1TZOA 3QDJB 1EGJL 1J0HA 3NSYA 3QFJB 4G6KH 3TBBA 2MNWA 1JZGA 4NLHA 3N55A 3F8UA 2A2PA 2P5EE 5B7CA 4D7PA 4ZXBC 5H2BA 4G0LA 1YA5A 4Z5RA 2YARA 4JZOA 3HIZA 4L8SB 4KWUA 3WY4A 5F3HB 3JWDH 4DZ8B 1QTYT 4XXDB 3C2SA 3CXDH 1MIEH 1WRYA 3BFQG 3IC4A 2DWTA 5DUBB 5IMLA 5JOEA 2YGPA 2W0PA 4FFYA 1CXKA 3TKPA 1HILA 1XDTT 2EXWC 4DP0X 2W59A 4C47A 4LIQE 2QADB 4BD4A 5JPMC 1VGKA 2EIDA 2FIKB 3GSWB 2EZ0C 1JWSB 2EQDA 2NUPA 3C5ZA 3AWGA 3VFPB 1DQLL 4P5TB 1G9NC 1Y18B 3MJ9H 4AM0B 4CU6A 3OGOE 5HYJB 4NO0B 4CU8A 2GI7A 3R8QA 4CSSA 3NFPB 1QLFA 3APSA 4NJ9L 1H0DB 3IDGA 5DI8B 3HOGA 1S7WB 1ZTXL 2XDHA 2XWBB 3ATDA 1A9EB 1XOAA 5KG9A 1IC1A 3OKDB 4WUKL 3ZTDC 4TNWF 1BFOB 4ML6A 2FHFA 3R4RA 2BNUA 4JFDB 2COQA 1S8DB 4P2QB 4YDJA 4AQ1B 3WO3B 2CVDA 4X8CA 4PQXA 4XWOD 5TD4A 1OANA 3RB5A 4FXKC 4NQDB 2JTYA 1PYWB 1D2PA 1TJIL 3EGSA 5I15H 5BRZA 3UMAA 1P2CB 1T0MA 4X83A 3AG3B 4YDIL 3US0A 3VNZA 4C4KO 1RIVH 1AACA 1WK0A 4JGMA 1KT2B 5GSVA 4QRPB 2H6PA 4J3SA 4XRCA 1SZNA 3UJ1A 1P4BL 1KOAA 3VB8A 1WA0X 3MFFA 1V5JA 4EVNA 3RNKB 4N90E 1T20B 4Z76B 3FT3A 1UUSA 2R0WH 3HG1A 3HKZA 4DP9X 5KSBB 3ERGA 3U6XA 19GSA 4CVXA 2ENJA 4JQVA 5D1QE 4LASL 3HKRA 4J56E 3PNRB 1YNLL 1QI5A 3EZ8A 5J1TC 1LO5B 3ZMRA 5JXED 3U6VA 3LRMA 1EV4A 4JLRA 3DHPA 3NJKA 2OMUA 4XWOC 4Y1AB 1G9NL 1MW3A 5D1ZI 4L0ZA 2L04A 4I0CC 4XCEA 5K9KB 1JZEA 1ZSDB 3O81A 2FNWA 1FFNA 1FNAA 4WW2B 1GTIA 1Q98A 2ED7A 2FZ3B 5TPWH 1QATA 4AWJC 3NABH 3HRPA 5IVZB 4BQ8A 1FG4A 1UD6A 5KTEH 1A7RH 2N5AA 3UH8A 3GK8L 1QUNA 2PYEA 5A4WA 4HDEA 4IRSB 3KPSA 2FQDA 3ZKND 5D7IB 5L4FA 4URKA 5AYUL 5FOJA 4GAAA 3VXUA 4AUYA 5SWSD 3CCHA 1BQ7A 2WCIA 4ICYA 3P11H 2XXMB 4KKRA 3VPQA 2P28B 3AMLA 3NZHH 5CJXA 5ICXB 1ZT4A 3QIUD 4BFOA 2LU3A 1OZUA 1PEWA 3U79A 4FRWA 5CILH 1AFVL 4L8SC 1P53A 5JXEC 3PQYB 3B5GA 1I9RL 2VL2C 2VUYA 1KUMA 1OM3L 3D30A 4UIMB 3FUJA 1NOLA 2OMNA 4Y16D 2X40A 1L9RA 3PJNA 1XT5A 4B5EA 4HG4J 3LG6A 1CPUA 5FGCB 1I8IB 4HIJB 3QUZD 5ID2A 1WBYA 4QAMB 5EMYA 4LO9A 2G3XA 4N4YB 5GRXG 3CTFA 3ARBB 2R0ZL 1F0LA 3G2OA 2EVGA 2QJDA 3A6CH 3U9WA 2L59A 4Y5VC 3ZKNC 2XHNA 4C56B 3AS0A 1FB6A 3CC1A 1OGTA 4FYTA 3H3KA 1OKTA 3ZRSA 2AQ3A 1T7XA 3Q2WA 4PVNA 3GUFA 4NUPA 2G2RB 3DGCR 2FTAA 2VR9A 3QIUC 1YMMB 5J12B 1NAMA 3B34A 3NIDE 4IBZA 1HCVA 4BWUA 2J44A 4AQ1C 1AXSB 1KPRA 4MNQB 4ODUB 3WFHB 3P9LB 3HG4A 4AJ8A 1CWVA 1Q0YL 1JZDA 4X42A 2ESVB 3ZMEA 1RUAH 3II2A 4JFQB 4FYRA 3ARFA 2RB8A 4Y16C 3G08B 3TEWA 1NM3A 1G7PB 2HVKB 4EJ1C 1LE9A 1KBBA 4OGYL 1NEZG 4YLBA 1O8XA 3LQZA 3NJMA 3QCUL 2NSMA 4RSYA 5SWQB 4PJEE 5G30A 3QUZC 1JPTH 3CHQA 4WGKA 4RESB 4CADA 5E99H 1VF2A 2R1XA 1Y6NR 4LLWB 3PXJA 5DQ9A 1VFMA 3F7KA 3MC0A 3OV6A 5IP4A 4F58H 1EEJA 5E4WA 4PJ9A 4ALAL 1HZHL 2J88L 4DO4A 2WLHA 1LM8V 5DXWA 4OFQA 3WJJA 5GISH 5I16A 3ECUA 4GSSA 3O6LH 5TQ0H 3FUIA 4Y5YA 5E00B 5HY9A 3GIVA 4JEDA 4KCAA 3R8BB 4BXSV 2F5BH 3EO0A 4R2GB 1JZ6A 2BO0A 3MLZH 2Y5QA 1K3OA 4QRSB 4KC3B 3WYWA 3S4SB 4PW9A 4PTTB 5EU6A 1XCTB 5A1AA 1QVOA 1AQKL 1GLQA 3WAKA 4LCVA 4YQVA 1VRSD 1CR9H 1DL7H 4WW2C 5F1IA 4D8PB 3C8DA 4XGZB 5CP7A 2E7LC 3MLXL 4HZ4A 4E8HA 2H8LA 4TSCH 4ODSL 1A4BA 1W2KT 2HRHA 2WQWA 3KXFD 5KW9H 1THAA 3FB5B 4QHNB 5H35B 4QRQA 5EU4B 4IGJA 5IVXF 1GZPB 1IFRA 4XBEL 2HYXA 4JRXE 2EE9A 4MD5A 2IPKA 3T0BA 1IKNA 1MCFA 1WSST 3KH7A 4OD3H 1MSPA 2FBRA 2WBWB 4Q9CA 1AUCA 1T4WA 4AVIA 4M03A 1NM9A 2GSIB 2OZNA 2RCSL 5JUEH 5AOJA 4J1UB 5EUKB 2R0CA 1MVYA 4AV4A 1OCCB 1VHPA 5JHLA 5EORL 1T6BX 2ERJC 1WWAX 1S78D 2Y5EA 4UQDA 3PJVD 2QELA 1LD9B 3ZY7A 4PJBF 4P2RA 1XF5B 5ICZA 1GY2A 4ZBBA 3FFDA 4TQEH 2X7LB 5E70A 3TVMB 1RV6X 1YEIL 4Y8AA 1X5GA 1EUUA 2FSEA 2VXQA 2VQ1A 5F1OB 5I74C 1A6TB 1QQ2A 3RDTB 4Z1PA 2LU4A 3ZZ1A 2VL4A 4RA0C 2EEAA 2VXUH 3IYLW 5DK2A 1TP9A 1C12B 3HPLB 4PV8B 4TRPL 1PKZA 5DEGB 2CBTA 2JQMA 3QUXD 1FO0A 2QZ5A 3UCQA 3VXOA 4G71B 5I6XB 4L4VB 1C9SA 2QVTA 5H5SA 4MMXC 3RTLA 2Y4SA 2XQYA 5F0JB 3PXLA 1NLBH 2JV6A 4U6HA 4MF6A 2HSHA 2I5YH 3LKOA 1JF1B 3T0WA 2NZIA 5B1CA 5EEWA 5E24E 3L78A 1MELA 1CFQA 1S78C 4J8RA 3U9PL 2HZEA 2V2TA 2BXZA 3VAEA 1AQVA 4YKFA 2CO1A 1XWVA 3UX9B 3D0ZA 3D0VA 2FQGA 5I5IA 2ZJSH 3Q2NA 3ZRCC 1ZHBA 2BJMH 3OAUH 3DOIA 4L1LA 5KN1A 2AYTA 1SRDA 4ZB9A 1PD21 4LFHG 1P7HL 2OJEA 2OTUB 1LDPL 3VFVA 3OJVC 3DDGA 4DGVH 3FUNA 3H4HA 3D3VD 3KMDA 2DI7A 3CHSA 3G04B 4XVTH 4NQQA 2YRBA 5BS0B 2HSYA 3LVTA 1LP9A 1CD9B 3K6SB 3QUXC 2WINB 4YL9A 1U2CA 5E59A 4Q9RH 5HR0A 4JM4L 5DJZB 2OZ4A 1I3UA 2ADFH 2J5WA 4JG0H 2E7BA 3PGTA 2JJTC 3RUGE 1MCPL 1NPJA 4R5VA 3RWHB 2Q86A 3L7FB 1P7BA 3BIKA 4AQOA 4S1QL 3VI4A 4CVZB 2X8GA 2UUDH 4NJAL 3F7YA 5AKSA 2DYRB 4YFLI 1JG9A 3D5JA 4MDCA 4UU9B 1J87A 4JVUA 4XCCH 5GXBB 2BW5A 4DN4H 1PEZA 3V0WH 4JFSA 5BW7C 5DUPL 1VF5C 3ZE0E 1TG8A 3KPNB 4ZB6A 4S0HA 5FHIA 1PW3A 3U6RA 2YD1A 3QHFH 5H4ZA 1H8LA 3QAZC 1KSRA 3IU4H 1FZKA 2ORBL 1SJHA 3D50A 4OFIA 3F5WA 4NIYE 4LEEA 2MH4A 5FT3A 1JP5A 1ZA3A 2GQKA 1AIFB 3SE9H 1QEWA 2DV6A 4KQ4H 4ECIA 3LFLA 3O6KL 1A8JH 2YQ2A 2Y5TA 4RRPG 3DO3A 2AK1H 1DO5A 4UANA 3KGTA 1YSOA 3KM6A 4PW4A 1MFBH 1F1DA 3MJ8B 3D87B 3LN5B 1J1OL 3MXWH 4ONHB 2DJMA 2O6CA 2FEEI 1KXTB 4PFEA 3SKMA 3U7AA 3SJVB 2R4VA 1UWYA 3WD5L 3TT3L 5ECMB 3S35H 3SPHA 1CG9B 1IGML 3FHEA 3RL1B 1VPOH 5ICYA 4PJAB 2V7HB 3X1FA 2K6VA 1TQCB 3C5JB 2HZHA 4MMZB 4PBVC 1DBAL 3CUPA 1OCZB 1SMDA 3UGEA 4F57H 2JKJA 5E94B 4LAQL 3MRRB 2L4QA 3KBFA 1MWOA 4JPKH 1MQKL 4ZBJA 4Z7OF 3ULSB 3LRLA 3PF2A 3D9AL 4HIXH 5D8JL 3F6DA 4BFNA 3BIAX 4D9RD 2JZSA 2GJ6E 3HS8A 1CDUA 3L5XH 1DVQA 3GBLA 1LO3H 2OMZB 4K23L 5IKCB 4G9DA 4WV1C 2F8FA 1IEHA 3GHBH 1G87A 1UYWH 1JRHL 3TGXA 1KJ3L 2X89A 3TOPA 3Q01A 1EZKA 4USSA 1A25A 1FYHB 2YAFA 1NHOA 2ZYHA 4L37B 5EFIA 4A2HA 2PERA 1AGDA 3TYGH 1W72B 2A77H 2NQCA 3BI9X 5EN2B 3JYCA 5E5RB 3ZT5A 1S7XB 4H8WL 3VCLB 2AXGA 5AW5B 4M3KB 2J12B 1XL4A 1H15A 2GT9A 4NRZA 4WCYH 4A7QA 1CL7L 1JERA 5DALA 3ALWA 5J5NA 3HUJA 2FH6A 3NRPA 4JFHD 4M5TA 4P8QA 4FABH 2GAZA 1J12A 5D9WA 4KKQA 2ZKMX 4AQEB 3NRFA 5I1JL 4A37A 2B4CC 3QUYA 1RP8A 3QEQB 4K4KA 4X5XB 2A1WH 1T6WA 5IR1A 1OSZA 5FF6A 4X0NA 1NC2B 1YY8B 3KPMA 2VSMB 2ARWA 4OR1A 3C9NA 2XKNA 1JN6B 2F2HA 5FYJE 1KJVA 3V6OC 2XWEA 3QEGL 4BE6A 1SY6L 2C3VA 2Z0UA 3CFNA 3ROOB 1GRWA 3ZW3A 4C8XA 4IKNA 1VKXA 5JZ7D 1ZS2A 1RUML 15C8H 1RY7B 4NWTH 2YAOA 1N5AA 1JI2A 1ZS8A 4FZ8L 5KYWB 4G6AC 3OXRA 1JWUB 4WU7A 4R7LA 3A6BH 2BPBA 2ZX7A 4BZYA 1I1AB 1JCKA 2XWJB 1TKDB 2EYSA 3FO2B 1Q4NX 4KKCD 1R24A 3ZKQD 2CLVA 2H0EA 5L4IA 2XSKA 1YEEH 3B8YA 2CKBL 1RLWA 1H9DA 1CFSB 5E9DE 1TZHA 5J4MA 4ZFFA 3HZKB 1TQUA 3AY4A 1BD2D 3MUGA 5FYKH 3WKMH 1DVUA 5FCUL 1JPGA 1NFDB 3EOTH 2VLMD 1WPCA 3FU0A 4K8RH 4NHCL 4EI5D 3S9FA 5FC9A 4AYMC 3FRPG 5JIKA 2WP3O 2XJLA 4ZTOH 2VRQA 1F02I 3R06B 1OAUL 3SE4A 5JZ7C 1I7ZA 2JVUA 1MEXL 2BNRD 3EJSA 3MV8E 3NCCB 4NKMB 2B4CL 2HI7A 1LQSR 4DGYH 5KN2A 1D5XA 1N2RB 5T5FH 4JDTH 1OAYH 5CGBA 4GG8B 3KYKL 3LRGA 4HJSA 4MXVF 2W07B 4RX4D 4KKCC 4A5PA 5I1EL 4JGNA 1XWAA 1FAIH 3BZFA 3GSRA 1GKOA 5KSVA 1I9EA 1E7VA 1YQ2A 3BAWA 3G2PA 5ABRA 3TFBA 4GSUA 5DU7A 2VSDA 4CGTA 1XIYA 2A9BA 2VNCA 2YEVB 5C0BD 1XGTA 3NDZE 1QHQA 1UCBH 3ESVF 5EO1B 1S4IA 2R0KH 3B1TA 3ARSA 4YXHH 4Y19D 5F9JB 1AQDB 1GPOH 3QQ3A 1Z7PA 2KOKA 3WL9B 3QDME 2F74A 2ITCB 2WAQA 3V0AC 2O5ZL 1ZFLA 1JZOA 1BX2A 1RZFL 3H7BB 1FHEA 1YUKB 4G6JH 5KSUB 4K2DA 1EAOA 3H9HB 3Q5YA 4WWPA 2XX1A 3VSUA 4DKEH 5DEZA 3K2MC 5JHDB 4UIKL 3F0IA 1J05A 4UT9A 5C0DB 4XPTL 2A5UA 1HI6B 1HKLH 3FRUB 4F8QA 5ISZD 3WUWG 3FONB 2ED8A 2H3KA 3BQUD 1IJ9A 5AL0A 4CMHC 4NO2B 4MZWA 1JXKA 4YGVB 1W0YT 4YUEH 4HOWA 5L2JB 3IRAA 3I9GL 2A6KB 1GMEA 4GBXA 2DTML 5DQSA 3O2VH 3SBWA 3QAVA 2B3IA 4XC1H 2G2QA 4PJIB 1I3RB 4L0PB 1AHMA 4YSEA 2YD5A 4GSRA 2VDKL 3S36H 1IB5A 2VL5B 1AC1A 5T33H 5HYQA 5DA0B 2RLIA 1M05A 4PB0H 5EUOA 3AM8C 2UZYA 4N0FA 3WD6A 1RZKH 1N68A 2XKUA 4JJ5A 5E2TH 4PCTA 1SK0A 4XMTA 2ZXDA 3ATAA 4XX1E 4KO6A 3NTCL 3OBAA 3ZR5A 4D9QE 2EDRA 4HETA 1L5GB 5INDB 5DCHA 4BQBA 4H25B 3IDNA 4NP4H 1GTBA 1NCDL 3BQUC 3R2QA 4WR4A 4E9RA 4WKZA 2NY5H 3U1PA 2FA8A 2VDNH 3HMWL 1E28A 2LEGA 4KRPB 3HC0B 2F7QA 22GSA 2H9GA 5B6MA 1E65A 4FNUA 4HQSA 1DUZB 1W72L 3KS0H 4QTHB 1R5VB 3BUDA 3DRQB 4P5MA 4CKVX 4HU9A 2BSBA 4N2HA 3V5KB 1ABAA 1M71B 4D8OA 1A6ZB 4FYBA 2ED9A 3O11A 1DBBL 4NNYA 5JA8B 2MBSA 5DJXB 3LKRA 4LLDB 4LSVL 3S88L 2YP6A 1QAWA 1IM3B 5CAXA 3ZLPA 2VISB 4KV5F 2NSXA 3GHEH 4ZQTA 5HVFB 2Y72A 3TWCH 3GS7A 4MA3B 1X5AA 4AIEA 2HAZA 4DVBB 2XQ0A 2R23B 4K7FA 4IS6A 4UQIM 4GJTB 1UKQA 4X6FA 3UDWC 4G7VH 2WULA 2VW6A 5F7UA 5F1KC 5DGRA 4AJ0A 1IE5A 4I2UA 3TKRA 1E9QB 4LLUB 1TJHL 2XXCB 4UT7H 4UQBA 1ZLWK 3TDGA 1SJ6A 4P9HC 4FC3E 3UROR 1ILOA 3QJZA 3O6ML 4GQFA 2HJKA 3IFLL 5EOTB 1D6EA 3CG8A 4GNKB 1XGQA 1A47A 3DMMA 4JZNB 2G5BA 4W9JC 4Y4FA 3IK2A 1KIRB 4WIQA 4K2UH 2DWEB 1C1EL 4HUKB 4LHUB 4M7KL 1IBFA 3U30B 3OHXB 2LRTA 3M9KA 2ZX8A 1NCCL 1XH0A 3F65A 4JCMA 4DTGL 1W16A 5F93C 1KCLA 1CF8L 1KJ2H 2HKHL 4XHJD 2H32A 3IFNH 1O81A 2WHVA 5E7BA 3VRIA 2PMTA 3ZTCC 2PPCA 4LVEA 4F2MB 1N3NA 3D4ZA 4JRLA 3SYOA 3MIXA 2AMUA 4X6DA 1MNUH 4MJCA 4YX2H 3DX9B 2YAHA 4IKJA 4IOIA 3RG1C 2AKRB 4HKJA 1OAKH 2X49A 2OTWB 1G7IA 1J0YA 3ZSTA 3CBRA 3EO1A 3LPWA 4FLHA 4XVJL 4AEHL 2OBIA 1CB4A 3P40A 4GAFB 1T5XA 3DGDA 3MLUH 5CYYA 3FT0A 4EEEA 1M1XB 3GM8A 1N64L 5C0EA 3WFBH 3GNML 4L05A 2JE8A 4F7CB 3T04D 1J8HD 3UERA 3ZDWA 4OJDH 1IE4A 4NPJA 1QSEA 4PJ7B 2R4SL 3VG0H 5FO8B 4IW9A 3MRBA 5ENWA 4PNGA 1SVCP 2JKXA 4KVCH 4FFTA 1O6SA 2EDTA 2PP9A 4XHJC 5E6SB 3LKSA 2OM5A 3PNWB 4O5LH 5HHOD 1TI3A 4E9YA 4U4BA 4JM2A 4LKXA 3WIHA 4DUWA 3JZ7A 5IJKA 1B48A 3LEFA 4PJGB 3I3DA 2FGWH 1S7SA 2CLZB 4AW4A 1G6RH 2NNAA 2W5PA 5HHVL 3I6LE 3DJRA 3GRWA 2WUBL 4XVSL 4FNTA 4F93B 1GS7A 5FYLE 3PL6A 1XIWD 3UBXB 1SK2A 2P9RA 5C0AB 3IC8A 4QMEA 3J7HA 1XSOA 4BZ2A 1ZVSB 1U8KB 1SBSL 1A7QL 1U3HB 3FT4A 5DLLA 2L8AA 2OCCB 3C60D 5E2WL 5AOLA 3GLAA 1T4KB 1IAIM 1MRCH 5D71L 1V54B 2EIKB 4CN6A 4PWFA 3MA7A 1B4TA 3OR7B 2DQFA 5CP3A 4WTZG 4FG6D 4P9HH 2Y25A 5J6HA 4NQED 4OIBA 4OI8A 1R5AA 1WOUA 2R0LL 2JL4A 3WBDA 2X4TB 2R56L 4LKCB 2EE6A 1IAIH 5HHPA 4BFIA 2IOMA 3UTTE 2WAHA 4ABWA 3ULUD 5E4IA 4JRRA 1JK9B 1B2WL 1G43A 4HPOL 1R3KA 4KFZC 2BP0B 3C6LA 1ADQL 2JSFA 2JCCE 4BELD 1LO0H 4KXZI 4P2OB 2XTJE 3N06B 1UUNA 1PNCA 4KO9A 1VFBB 1K8DB 4M61A 1OV8A 4ICXA 4Y1TA 1I8MB 1T3BA 1ERTA 5GRVK 4KDTC 3WEBA 2R2EA 3NFSH 4KKPA 1T89C 1CQYA 3VFSA 4Z77A 4WWKB 5LUMA 1XIWC 2F54E 2GJZB 2H26B 4BVYA 1OSEA 1V05A 1UB6A 2PVOC 1Z6JT 2JB5L 1FGVH 4G9FA 1JGLL 1H8SA 2O1AA 3T0ED 5LDUA 3HUJF 2HYMA 3C60C 7GSSA 4WEUD 2VCZA 3G2MA 3G5WA 3VW3H 2DL2A 2WB7A 5E8OB 2IFQA 4FG6C 3AXLB 3LVEA 4N86A 3M3MA 5ADOL 3GX0A 3GHAA 4HUVA 3GTTA 3WY1A 3U0WH 2E9BA 1OAXL 2WC7A 4XT1C 5BMFH 2M26A 2ZG1A 1CS6A 4NM8H 1W0VB 4ML1A 4YQXL 5J0BA 2SEBB 3WY3A 4U1SA 1B2YA 1I5GA 3BPCA 2FL5B 4NQXB 1F5WA 3UACA 3IMUA 4KH9A 5G4OA 4TOYH 1UCTA 5C0JA 4GXUM 1P4IL 1JV5A 4Z0XB 4ANXA 4X43A 5C0FB 5AAMC 5BQ7B 1JHTA 3OPZL 5CU5A 4MZ2A 1MFEH 5T1KD 3T0EC 3FCSA 3GURA 2B5EA 2FWLB 4HV8A 5T5NG 2L7QA 5J57B 1S3KH 2IALB 4E0RB 5D9VA 1SJEA 3MAWA 1BX9A 1JPEA 4FTVA 5EZLA 4DGUA 5KBNC 1E0OB 5CLZA 4F33B 4RWYL 2CDGA 4HX1B 1WC7A 1UACL 3U82B 1YN6B 4YC2C 4G8GA 1YQVH 4R4FL 4AGQA 1ORQA 2Z7WA 2DYSB 4P2OD 5AB1A 1BQ5A 4K5MA 4F1SA 2MJWA 3J27A 2P7TB 3LIZL 2B6MA 2X0WA 1AHWA 1HN1A 4DPRA 2Q7NA 3IKKA 1KWKA 2ZPKL 3ABGA 4KQ3L 4HEA2 1OP9A 4Z78A 2AV1A 1Z5LA 1VFAA 5IWLC 4FNLL 5C09E 1JV2B 2X88A 4XXCA 3ECVA 2BK8A 2G5UA 5CN1A 4RCAA 5LDSA 5D4IA 4GAGL 2WTOA 3SE3C 1ZLUK 3BOVA 2DKIA 2V1MA 1JGDA 4AMWA 4AENA 3QUHA 1ZAGA 4NMUA 2DMKA 3STZA 3SKUD 1GYAA 3HR6A 2QKEA 1E5ZA 4WI9A 3UZQA 4A6YL 5J56B 4J5VA 2GS3A 5SX4H 3HBPA 5EL8A 2VDPH 4GTUA 3RJQB 4LDOB 3U1QA 3VI3A 2DLXA 1X9UA 1FVDB 3AREA 5EPMB 1VEMA 2A0LD 3LRKA 4HWBA 1PY9A 3WNJA 1QFHA 4JCWA 2H8PA 1A3LL 1F2QA 2VLLB 2VTFA 4QRUB 4P2OC 3RA7H 2EUWA 3F58L 4M6NH 3QVAA 4KY1H 3ECBB 2BVYA 3BPNC 2C8NA 3SDYH 1A2JA 4KK9D 2E6PA 3ULUH 3K46A 3QYNA 1AJ7L 4V1DD 4A2FA 2VAFA 1MVUB 1JJUA 2J8UB 1XOBA 4Q2ZB 4EUPA 3DWTA 5DVMA 3DXAE 3CSTA 3GI9H 3MRHA 4H1LA 5KVDE 1IGFL 3B3IB 1RVFH 3S2CA 3DROA 1PBYA 1ASPA 4L8BB 3VWVA 1SYSB 4AL8H 3FZAA 4ZPVB 3IJYA 5JORB 1JUFB 5E7FA 4HFUH 3VK9A 3KYMA 4O58L 2BNQD 1HL9A 3I3BA 2IJYA 3ETBJ 5HHNA 1A7OH 1CFVH 2BINA 5KN5A 2RFXA 1E4WL 5EUOF 5LBSA 1PZUB 5D7LD 1OARL 2VLKD 3CXHK 3D5OF 1E30A 3WNOA 2AK4D 2A0LC 4AITA 3WTYA 2OW6A 4B9ZA 3H42H 4GKZB 2H0JA 1UB5A 2BOCA 3BKMH 1CTOA 3MV9B 2PXYD 5DC0A 3NA9H 3WN5C 4J6RL 4KK9C 1LJRA 4ZL7A 1JSYA 5CIPH 1F56A 4WSKA 1ZRUA 4FQIH 3KJ4C 5F6HI 2R37A 1RQMA 2HKFL 3BYYA 1EHAA 1O7DE 2ICEB 2NCMA 1FNHA 4LLAA 4P5SA 5B1BB 1KIUA 4EQ3A 4HSQA 4XPGH 3QDGD 2R27A 4KXBA 1I75A 3MNWA 4I0PB 5HXMA 3MA9H 1EGOA 1ND0B 1NKGA 1F9MA 3FUEA 1HHIA 3Q6GH 3A5WA 3NFNA 1DVSA 3E2HB 5GGRA 1C5CL 2CDFA 2YV7A 2IAMA 4WW1A 1KV3A 1VDGA 1X4XA 1REIA 1RK1A 3W0WE 3Q8FA 2K70A 1AGCB 4YHML 2E27L 2AVGA 3FTSA 4J27A 1E5YA 1RD6A 2WXFA 3PDOA 5D70L 1MCEA 4GMTH 2BP5M 2PXYC 2IWEA 3QCTH 4LHJB 3LN4B 5EBMA 1DBJL 2X6AA 3PWUB 2C0GA 3KWVA 2HXKA 1CZ8H 3OKKB 2MMAA 5T1LB 3E8UL 2QSTA 2A6JB 1KCVL 2FQEA 3SGJA 5ITBL 1B90A 5C6PB 2CA4A 4X6CB 2DEYX 7PCYA 5CJOL 4N9GA 3B2MA 3MO1A 3A67L 1T2QL 4JHAL 2CBQA 1KEGH 4G2EA 4A7TA 1D3CA 3JT0A 4JBSA 4ZOCA 3V1WA 4P48A 5IW6A 3ZMLA 3ZDXB 4RDBA 2QVFB 2XZCL 4KMTH 1CDIA 3N0PB 3WFEL 4W9EC 5LCVH 2ON7A 2QA1A 3L3DA 1OWWA 4RMWA 3MKKA 5JYMA 2NX5D 4KNSA 2O5NA 3KEHA 3P9MA 5A7EA 4NPYA 3DUUB 3B6SA 3SDCB 2DQJL 3EOAB 3NK3A 2HFDA 4RAUA 5C86A 5I6PA 2O87A 3UTPE 3CTTA 5CM1A 3RZWA 3J2PA 1SDYA 4DOHB 1FJ1A 1X9LA 3VX1A 5EBLA 1T1YA 2N1TE 5IFAH 5J3RA 3KPRE 4J6IA 2I81A 3WO4B 1IJNA 2HLFD 1MI5E 3QUMA 1NDMB 4QHPA 2UWEA 4MK3A 1PDKB 4E9SA 3F62A 2LT9A 4HAGA 4L1DA 1XWKA 1Q94A 1IQWL 3PHOB 4CA4A 4YSTA 2X87A 4BH8B 1XL6A 1R3IL 1ET7A 4KHTH 2FB4H 4EOWH 3MV01 3V5DA 4MCUA 4ODBD 5DWPA 4OM0L 1E8WA 3S3CB 5ANMB 2H1PL 1GGIL 3NOFA 3VWJB 2G5RA 4HJJL 2JTDA 4FQJL 5BUGA 2CZ3A 4K73A 3MN8A 1H8OA 1XFPA 1EA9C 1VIWA 5J6GB 1HE8A 2DB8A 1BMWA 1QGVA 3MGTB 3GSSA 1MJ8L 5HTSA 3QO0B 1HT6A 4AMXA 4JL2A 4ZMAT 1CMOA 4GKSA 2A9DA 1UGNA 4YHZL 2CUMA 3JUYA 2V9QA 1E5AA 4HOZA 2DQMA 1L9NA 1OM9A 2HLFC 3WGVB 4QD2E 3W9DB 3UYPB 3MLVL 2W65A 2ZCHH 4KNTA 3GTNA 4I3RH 1W0WB 2DL9A 5HDRA 2QR0A 2IF7A 2BJXA 2VKWA 4U3SB 2GI0A 2DDQL 1UWEH 4X80H 5BCAA 1OAQH 4Z2UA 1I8KB 4UB0L 4ZMQA 3ARZA 3W8JA 1QSFD 1X5EA 3S34L 3HS0A 3PP3K 3N43B 4WI0B 4U1GC 3QYMA 1DR9A 5ERWB 5I0VA 5B8AA 1IRAY 5D5ME 1BZ9B 1WHPA 4N2AA 5HDOA 3GJEA 2XWTB 1CGSH 5AUMB 2X0UA 3CC5B 4XR8C 3BPOC 2YPVA 2GFBB 3NSJA 3PP4H 3H9ZA 1R5WA 2ZG3A 3BQVA 3CVCA 2NNRA 5FXCH 3VGBA 5IVOA 1UZ8B 2WTRB 3ALXA 3N85L 3QFAC 3BVNB 3KLLA 1NGPH 4OCSH 2BVTA 2WVVA 1S5IH 2IMMA 2WZ6A 3N04A 5HGBA 5FFOA 1WPIA 4BL7A