3HVNA

Crystal structure of cytotoxin protein suilysin from streptococcus suis
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
468
structure length
466
Chain Sequence
DINQYFQSLTYEPQEILTNEGEYIDNPPATTGMLENGRFVVLRREKKNITNNSADIAVIDAKAANIYPGALLRADQNLLDNNPTLISIARGDLTLSLNLPGLANGDSHTVVNSPTRSTVRTGVNNLLSKWNNTYAGEYGNTQAELQYDETMAYSMSQLKTKFGTSFEKIAVPLDINFDAVNSGEKQVQIVNFKQIYYTVSVDEPESPSKLFGTTVEDLKRNGITDEVPPVYVSSVSYGRSMFIKLETSSRSTQVQAAFKAAIKGVDISGNAEYQDILKNTSFSAYIFGGDAGSAATVVSGNIETLKKIIEEGARYGKLNLGVPISYSTNFVKDNRPAQILSNSEYIETTSTVHNSSALTLDHSGAYVAKYNITWEEVSYNEAGEEVWEPKAWDKNGVNLTSHWSETIQIPGNARNLHVNIQECTGLAWEWWRTVYDKDLPLVGQRKITIWGTTLYPQYADEVIELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of cytotoxin protein suilysin from Streptococcus suis
doi rcsb
source organism Streptococcus suis
molecule tags Toxin
total genus 98
structure length 466
sequence length 468
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01289 Thiol_cytolysin Thiol-activated cytolysin
A PF17440 Thiol_cytolys_C Thiol-activated cytolysin beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1430 Mainly Beta Sandwich Immunoglobulin-like Perfringolysin, domain 4 3hvnA04
3.30.1040.20 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3hvnA02
3.40.30.40 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Perfringolysin 3hvnA03
3.90.840.10 Alpha Beta Alpha-Beta Complex HIV-1 Reverse Transcriptase; Chain A, domain 3 Thiol-activated cytolysin superfamily/Thiol-activated cytolysin, alpha-beta domain 3hvnA01
1PFOA 1M3JA 5CR8A 4BIKA 1M3IA 3CQFA 4HSCX 3HVNA 1S3RA
chains in the Genus database with same CATH superfamily
1TJXA 4DCQA 2N7BA 3E1ZA 3GZKA 2EDDA 2HAZA 3UYPB 2ZX5A 1C5DB 1F4HA 5BPPA 5B7CA 5DDHB 3CSYB 3SKJH 5EIQA 1KBPA 2GTZA 4PJGA 1XOBA 2DY2A 2BSTA 1ZYQB 1NQBA 1AG6A 2UY6B 2O30A 1J1PH 3D85B 4AE0A 2VISA 4PI0A 3WHXB 1D5ZA 3F6FA 2VWEC 1FG4A 4XBGB 5IJKA 3ETTA 4P9MH 4L18A 1MCQA 4XO8A 3SZKC 1L7TH 4XX5A 5HFIA 2HKAA 5D7IB 1F1GA 1WZLA 4L1TA 3RHWF 3Q13A 2CWRA 5I74B 3HS0C 5JNYA 4LPYA 4PS7A 5JPNB 2E3VA 2X99A 3T0BA 2BNQB 4CDGC 2XJKA 4JDZB 4NQCA 3BBYA 1G87A 1QRKA 2XXGA 4IRZA 4Y4FD 4ZSOA 3SE8L 5KN5A 2FYYA 2EIBA 4WWKD 3AROA 1J1XH 1XSOA 4NZ8A 4Z2UA 2BIPA 5J4MA 1RZ8A 2GTQA 1I8MB 2OMTA 2D7TH 2MCMA 5DALB 2E7DA 4Q58C 2LQOA 1J9BA 4WV1B 3BVTA 2B5IB 3L2MA 3INOA 3U36B 2H26B 2ZP0T 4LXFA 2C8UA 2C1YA 12E8H 2IMMA 5HDBB 4KY2A 4LKXA 4HEME 1P9MA 5B1BB 1VFOA 1DBML 2DLHA 4XCSA 2BRQA 3H85A 4G9DB 3MI6A 5EA0H 1SXBA 2WP3T 3MLZL 4KO9A 1TDQA 1WTLA 2D31B 2LU5A 1AQHA 5B3JE 3PPEA 3ATDA 4OCYH 2YKLL 1EEZB 4X8XA 4NPJA 3BMWA 1WFTA 5E5MB 4EF0A 2ZKWA 2QGVA 5FAAA 4Q6IB 3BUBA 4OLUH 2LVCA 1PCSA 3KWVA 2WXPA 3F8UB 4QR7A 2CLVB 4QRUB 4M56A 5E0FA 2HG5A 4LSQH 1W72L 2G75A 2Z31A 1X5EA 4LHUG 1F37A 3BKYH 2OI9C 3T08A 3PV6B 1CD9B 3ECBA 5F0JB 2LTKA 4BRJA 3GRGA 5CLWA 4QHNA 5AVZB 4XZUB 1LK3L 1Z5LA 2V17H 3VTTA 5IW1A 1X9WB 2GJZA 4G7SB 2E7PA 2J1ZA 5HI3D 2AERT 5FA3A 1N64H 3WY2A 3OB0K 3QEGH 5F1IB 2E9GA 3CXHJ 1HAWA 2EDYA 3K7UA 4EN3C 4G9FD 1NSNL 1PNDA 3IGAA 3BN3B 1PKZA 4U1KA 4FA8A 3EYQD 3D52A 3MA7B 1RZGB 1CD1B 5K1NA 1AANA 1J87A 1S7WA 5LQBH 5BNXD 4LK4A 1OT4A 3KYNA 4HG4K 3T71A 1AS7A 5HJ3B 1ZHBA 1SD8A 2VLRA 4YE0A 3ZR5A 2EVJA 1CLVA 3PABA 4HUWB 3TYGL 4ML6A 3OKKA 2VM4A 3QZWG 2VL2C 5D8JL 3QQNA 1R3JA 4ERSL 2HFDA 1JF5A 4Z2TA 1CFTB 3W8JA 2E76C 1C72A 1TR7A 3GMRA 2A9MH 1NHOA 3IGLA 1A7NH 5DJ8B 4L1HA 2XIDA 4AMKL 3G5VB 2LRTA 4G43A 4P2QE 3CLFH 3QT2A 5LUMA 2BP8A 5HHOB 3WTUA 3LEFA 3QDGA 1M2OA 4ZB8A 4U05A 4FTVB 4Y16B 4A6YH 5KVGL 3NFPB 4NZUH 3E38A 4NKOB 1DBAL 1BGXL 4RGND 4R97B 3T1WA 4W9JC 3DDFA 3OTTA 3WY1A 4Z77A 2P8PA 5CCKL 1KELL 1T1XB 4N4YB 5DTFA 1NTDA 5C86A 1MFUA 5K5YA 5DQDL 3DX8B 4OV5A 3E8UH 1PX7A 1OQXA 2HVKA 3MLSH 1IC7H 3F3QA 1KBBA 1JZGA 4MHHI 1U8HA 1VEMA 2ITEA 3O6LL 5AW5B 2MMZA 3DVIA 2E27H 5ESVB 3NIVA 5GSVA 3RDTD 2W60B 1B3JA 1C5BH 3O3DB 1TRWA 1DJZA 1PD0A 2E0QA 3IXTA 4O58H 4M1DH 1D5BB 5IZ7A 3BPNC 2FB4L 2NY4C 3IETB 3IDGB 4RMTA 3UPCA 4MQTB 2HMID 1RUPH 3NCYP 4R84A 3S35H 4H8PA 3PPSA 3SZ6A 3NZSA 2GJPA 5C0RH 1RUKH 1T66D 2ICWA 3QISA 5J9PA 4J3OD 3V4PL 3MOAH 1OP5K 1I9IL 4Z7NE 7CGTA 1M71B 1A5FL 1XSKA 2ZNMA 2CLRB 3MO1B 3NACL 3T0EA 2HKFH 1MCWW 4AW4A 1J8SA 2YBRA 4K8RC 1MVUB 4NXIA 2VLKD 4XAWL 1CI5A 3WNMA 2FH6A 3FRPG 1XR9B 4JJ5B 2J44A 4KQ0A 5I73C 2BP5M 5AKRA 4EBQL 1OT1A 3ZQXA 1DZ0A 3CFUA 5FV1L 1LP9B 2GY5A 2D8KA 3GSOB 2IMKA 3D3VA 1KYOK 2VUOA 1ZOXA 4XHJC 4XNXH 2IGFH 1KB9J 1ZHLA 5C92A 4FYCA 1DEDA 5KJ4A 2JJVA 2CO1A 2QFPA 3IDMB 4YDNA 1GA2A 2YN5A 3MRPB 4L8SA 3VYOA 5TQ0H 2MQGA 2AQ2A 2H7WA 4HH8A 3FKUS 3CCHA 4UQDA 4ZO9A 5INYA 1KJVA 2OJEB 1D7FA 3IFOA 4G0LA 5CD5D 1F2EA 1MY7A 2W07B 3ASOB 4HP5A 2BNRA 4LDOB 2V2TB 3L95A 3UJ1A 1XEUA 3BOAA 1NCCL 3SGKC 2WKOF 3W11D 4J3XA 3QO0B 4PJAB 3B7SA 4WFGD 2H19A 3MFFB 2QHRL 2NOYA 1AMYA 3K46A 4HEA2 4JO4L 1W0WB 3AS0A 1OXYA 2CKNA 3KEBA 1KIPB 3DV4B 1AGCB 5TE6L 4TSCH 2VB5A 1ESOA 2IIJA 3PNWB 2IFGA 5FA4B 4Z7WB 1RZKL 2WQAA 4FP8H 4NO3A 1F58H 1I3RA 2CGYA 4IRSB 1IB5A 4YDVB 2UXFA 1WZMA 3BGMB 1DTVA 3VDBA 4G3YL 1QFWL 3GSNA 3MYDA 1X9LA 4OFQA 1C8QA 2BJML 2IANA 4G6KL 4IGBC 3OJDB 1AFVH 1V27A 4FJYA 3UYRH 1WP0A 1NFIB 4HU9A 2ZOOA 2R83A 2PMTA 5IVZB 2F1AA 3H9SA 3BPOB 3FTZA 2EKSB 3JVFC 1WISA 4H8VA 1BDYA 2B14A 3VAEA 2DYRB 1AMXA 2B15A 2OMXB 1CD8A 5ISZB 4R7DA 3ZKXC 1IV8A 1LQSR 5IMKA 1K0AA 3O6FA 1A2JA 1FFQA 2QL1A 4RA0C 3C9NB 3UOMA 2X9YA 2J25A 3P9MA 3L54A 1HSAB 2FZ3A 1AIFB 3BEVB 1DVZA 3QNZA 3K72B 3SDAB 5GRXG 3SYCA 4F93B 1EK3A 4MWFA 4XPBH 4EZLA 3QORA 3RUGE 4G8FB 1F86A 3MOBH 4M7LT 2B1HH 1MCEA 4HGKC 2VDPL 19GSA 1N6VA 4NIKB 3S37H 3GI8H 1MCPH 3L4VA 2FQDA 2J73A 3LRSB 4AXWB 3GGWA 1G9NH 1Y18B 4GBXC 4JFEA 4LCWD 5F0MB 5BS0E 3GBML 4ETQB 4XP6L 5F3BB 1U2CA 1IGTB 2H1PL 3GIVB 2X05A 2NY2D 1TKWB 1ITBB 4LQFH 3WLBB 4YDLB 4PD4K 3KPPA 3L3DB 4MQ7A 4W9HC 4LSPH 5D70L 5GISH 4HGWA 3P0YL 2LU7A 4IM8A 2VH5L 4OTXH 5BOJA 1QFWI 4IRJB 4KDWA 1SYSA 4PFEA 3OAZK 2WCIA 32C2B 8GSSA 5D7JB 1EZLA 1ORQA 1SOSA 2JWYA 1B6DA 4PBVC 3FFDB 5PCYA 2DLGA 4K3GA 4BINA 2CO4A 1G84A 5GJSL 5C2UB 3K5SA 35C8L 3BVXA 2DBCA 3C2AL 1I82A 1KCUH 1KOAA 2RHEA 3I6GB 3QEQA 3ULUF 3D4MA 4MNQB 4MAYA 4UTCA 1MI5B 5BRTA 1XO8A 2WCPA 4YBLB 5GJTH 4MMMA 3HZ4A 2LLLA 1XGUB 3NRPA 4EAEA 5IFAH 2VW4A 1I3VA 5D2LB 1R3IH 2R9HC 2XBDA 5IVXE 2YPVL 5E9DD 2YZ8A 3HKZA 2RB8A 1U42A 3O3EA 3U9UB 3H93A 4BVYB 3VFUB 3QPKA 1ZLVH 4M8QB 4ZBJA 1MFDH 1EO7A 3CHOA 1ZS8B 3GRWL 2FNWA 2J72A 2B1LA 3HG1D 4WRLA 2VCZA 2DQHL 3C12A 3KDPB 1N6QL 1IGMH 3C73A 3X14A 2FIRT 5DO8A 4JFZL 4ZBDA 4HAFA 1XH3A 3FONA 2YUXA 4C55A 5E1IA 3IDVA 4BFJA 2UZXB 3LEYL 4EEEA 4FZEH 4HDIB 2BOBA 2DH3A 3QHZH 5AYQA 3SIKA 1G6RB 2J1WA 3SGEH 4IK6A 3GHBH 3MRCB 4X80H 2CK2A 1EZVY 1X3DA 4W9KC 5FM8A 2E75C 5TDNA 3L2NA 3TIEB 4BUQA 3FEUA 4YSQA 1PS3A 2FYVA 5LXVA 5IB3A 1IGYA 2DDQH 1CICD 4FMKA 5ECPB 2XVBA 4P59L 1M0UA 2YAMA 3C6SB 1XF2B 2FATH 4MPFA 3ALWA 3E6FA 4FQJL 5TE7L 3HI6L 2JTDA 4OFYA 4G8AC 5I74C 3CBJB 2DRUA 4QTIH 4TMPA 4ONGH 3VSQA 5JPNC 1YKCA 1F2QA 2H70A 1T1ZA 4DESA 4NM4L 2E0PA 2QPFA 4EIGB 1AHWA 3AVEA 2YEVB 1QI3A 2ZOKB 4E9WA 2F18A 4EF3A 1TTFA 4M00A 1RQMA 4I0PA 3B5TA 2AI0L 5JHDB 3BKJH 3TPUA 2F53E 5J11B 4XVTH 5I1HH 1F13A 3H4FA 3BVNA 2JL4A 2G0KA 3BUTA 4HKJB 3MLUL 4JY6B 1EFXD 1U6TA 1FFOB 1R3LA 4WV1C 2X44D 2B5IC 2VJXA 5EDSA 2P31A 4JHUA 1KLUA 5FCSH 3ZX1A 5D55A 1HN1A 2F08A 1HH9B 1K8DA 1H5BB 1E28A 4UV4L 1ODAA 3AJ7A 1QLEL 4KQ4H 1ES0A 1IAIL 1EDYA 2QA1A 1TUPA 3B8SA 4JR6A 1ZANL 1JWMA 1WO2A 3APFA 4A7TA 5CD3B 4ZXBC 1S9WB 5H5SA 4EXPX 2VZVA 1SFHA 2PYEE 2Y7QA 3WXWL 3F5WB 4GG6A 3DROB 3TDGA 4APXA 1BZ9B 4WI3A 4X0NA 3W6GA 2E8ZA 4Y4HA 2YEZA 4K7PX 4Q6IC 2XWBB 2A5UA 2ZXGA 2YMXH 1OSEA 3AT8A 4FNLL 5F9AC 5KVEH 5C0JA 2O5YH 3W39B 3T6XA 2B08A 5D71H 1YPZF 3MFGB 3T3PE 2EECA 3ILQC 4W4NA 2O4EA 1AGFA 4K71B 4E41B 1P4BL 4KJYB 5IKCB 3I02B 5FHBL 5FYKH 3U25A 3ZE2B 5IB2B 3KNBA 2FD6H 4GJTB 3WTXA 1FIGH 5F0GA 2VDOL 5AAMA 1OF2A 1KPRB 2EVIA 4HIHA 5D5MF 5C2BL 4OQTA 4HS6B 3SY6A 1DVFD 3IKKA 4HWBA 4QMEA 2H0FA 4X98B 3X13A 3VG9C 3D0VA 3ZT6A 1NLDH 3GF8A 5C6WH 1YMMB 3FT4B 1SOQA 1T20B 3FNKA 2FX8L 1OP4A 4FLRA 3P0GB 1IBYA 1UD4A 1NKOA 2CALA 2WBJD 3PJNA 5F7EL 4ELKB 5E08L 2HSMA 1SKSB 3SPGA 2EKJA 2LVEA 3UDWA 4Y5XB 2MCG1 3SOTA 4WFFE 1IAII 2Z1PA 3TCTA 2JIXA 3W0WE 4D7BA 5HHVL 3QD9A 1JVOA 1NMCB 3DXAE 4IHOB 4IJ3C 4XMPL 3VQ2C 5INDA 3CFJB 2F5AH 4U6YA 3FB6B 1OE3A 5EORL 1AGBA 3WL9B 4HUAA 2P5WD 3JTSA 5DWUL 2KZWA 3E3QE 4KKCD 5E2UH 4KK6C 1A2LA 1FFPA 3L1EA 4MD5B 4ZUUB 4QOKE 3NCBB 2BINA 1KG0A 5DD0L 3I9AA 3P40A 1ZFIA 2EILB 2WXOA 3IRCA 1RURH 3NJMA 4HA1A 3CDYA 4K9EL 4NT6B 1BBJB 3TBTA 3WEOA 3ZTJG 4KZDH 3CRUA 3TBYB 1BAGA 3GMPA 5EEUA 1OCZB 2IPUG 2D03H 2PTVA 3G08B 1X4XA 2ATKB 1TZIB 1P2CB 4PJ7B 4Y16C 2VIRA 1TYJA 1CVSC 4MDIA 5AB9A 1KXTB 3L3GB 4HUXA 4NMUA 3LZPA 4R97C 2Z93B 3UPAA 4GI6A 3MQIA 1H3GA 2OA9A 3IU4H 1OM3L 2GJ6A 2C3VA 1VJSA 1Q94A 4LLQA 5C09E 1I7ZA 4HGMA 1OP3H 5F7WC 1U3HB 1BQHA 1PZSA 3IXAB 2EIZA 2BC4A 1I9DA 3MRHB 1PAZA 4LU5L 5MEOA 1EPFA 4AE1A 5IPGA 3HE6D 4BZ1A 3M88A 3F7KA 4AKOA 3D39E 4XP4H 4JM2D 5EZOH 1K5NA 1OAQH 3EYVA 3GT6A 1J11A 3P73A 1SJHA 3QC5X 3FTGB 2V2XB 3GNMH 3ISRA 5MHSD 2DQTH 4TVSa 5J06A 2YPLD 4YFEA 2QJDA 1W8OA 3FQWA 4XMXA 1PKQB 1S7XB 3T6ZA 3CX5K 5GGQL 1T7WA 1DJSA 3DRTA 3F3RA 2IGTA 5KVMC 4N28A 6GSUA 2YUWA 2DWEB 2XN9A 3DWTA 4UQ3B 5J3HC 1IEHA 4MX7B 2A9NL 1ZXQA 4N2DA 3AW5A 3SGJA 2H1BA 3QDMA 4NENA 4JFHD 3OF6A 2CKBA 3C8DA 4YSTA 4G42B 4YDZA 5I16B 5MEPA 3GKMA 1YEEL 1NWPA 2H4EA 3ZYIA 2J5LC 5HGHA 4J7RA 1IX2A 3BOVA 1LE5B 4L5OA 3IDXL 3M3MA 2IALA 1GYUA 3MBXL 4OZFB 1A6UH 3AM8C 2J12B 4QHKI 5CCHE 3WTYA 1DQQB 4GW5B 4FQCH 1DUZA 3KHOA 3P30L 2A6JB 2DQCL 1FDLL 4IP6A 4PJBF 1CFMA 2ZKHH 4TUUA 4XMWA 1WTGT 4P4RB 1EZVX 3K71B 3TTSA 4R0LB 4Z0XB 4S1DD 3UZEA 3GLEA 4XNQA 2BXZA 5INCA 1UJ3B 4GAJL 4K3EH 5HYQB 4R90H 1RXLA 3HUJE 1MCWM 2FCBA 1DBBL 2ITCB 1VADA 3GKWH 4O2FA 5LCVL 4P3DB 5IFHH 2Q5BA 3VSTA 5EWIH 1E7VA 4ZMPA 4NQCD 1URLA 2VRQA 3VFIA 4NFCA 4PJCF 2LJAA 1SOXA 2VQUA 4DKDC 1AS6A 5JOPD 5HDRA 1UD3A 4HFWB 5SWQB 2EDHA 1WSST 5JOFB 4OZIA 4G7QB 1NHYA 1HVXA 3CU7A 3UO1H 5HPOA 2QEJA 4FYRA 4JM2F 5DURB 2WLLA 5GRZA 1QWNA 4HV8A 4JPVH 3NGBB 2YQGA 1TDIA 5DYOB 2R69A 4H25A 2VZSA 4X7TA 2C4FT 1E9PB 2Q8AL 1AJ7H 3MACL 4IRSC 4LOVA 4XMZA 5E2VL 4PGJA 3HFMH 1AXDA 2IPKB 1T0NA 3ATAA 1RP8A 4YQXH 5DMJB 4KJPD 2OXHA 5A3ID 3VI3E 3VXOB 1H3TA 5AZEH 5CEZD 2BY0A 2X4PB 4DP1X 2AJ3A 1DJXA 2EINB 2X8HA 1UB6A 4OZGA 3T09A 3BPOC 3O2DL 6GSVA 1FL6B 2EDEA 2PCPA 5ENWB 43C9B 1FVCB 3GKXA 1VZGA 1CFNB 4XS4B 4D8PB 2LV4A 2NXZD 2XN0A 3QWRA 5DEFB 1ZOFA 2ZAGA 3Q8FA 4AKPA 2WJUA 3LQMA 3D2UA 1ON4A 3G6JF 3WJJA 3KVPA 3SDAC 4KCAA 3NTCL 1M1XA 3L9SA 5D93B 4HKBB 3OQRA 1TVBA 4OCRL 3ZO0A 3P02A 3WHE1 3OLIA 2J8UB 2JJUA 5TF1H 1KEBA 3U6VA 1C8PA 4AIEA 3JV5A 3S9FA 1FHNA 3U5RE 2VXTH 1ETA1 2HX9A 5FDWA 1RK0B 3B9VA 3ESUF 1ET5A 5F7DA 3L1OL 2D4DA 2FCHA 1JGUL 2VUPA 2Q1EA 1D9KC 2VLMD 3K6FA 4FHJA 4ZMTA 4U6TA 4YDLC 1KXVC 2VLRD 3GEFA 4WJKB 5GGVY 3DO4A 3WUWB 1Z9LA 2QTEA 5B7EA 5DUBA 3S36L 4LCYB 5ECJE 1MFMA 3FYGA 1BYNA 4WBJA 1GC1L 3NSXA 4GKZA 3MV8E 1JZ5A 5J89A 2MZCA 2IMFA 2IQAB 2ZXCA 4IRJC 1ZE3C 3QXAA 1ZPUA 1IT9H 4R4BB 4RZCB 5D7JC 4FXKA 5AB0A 1QFPA 1RAMA 2D4FA 1OTUD 2YC1B 5G4NA 2AQNA 1EH9A 4X4YB 2FA4A 4L8EA 4LSSL 5CJXC 4HFUH 5DRXA 5ACZA 4U7MA 3B83A 4HU2A 4WAFA 3TCXA 2B9BA 4M6ML 4O51B 5HD8C 3FK8A 2Y3AA 1MWAB 2EZ0C 1MIEL 2VDLH 3QDGD 4OGYL 1BX9A 4HIEB 4QRPA 1PFCA 1Q9KA 5LWYL 3NJKA 2GZPA 3ZTNL 3BD3A 4AQ8C 1N0XH 3H6AA 4YHOH 4F03A 2DEWX 3G2PA 5E5UB 3O3AB 2K8MA 2WVUA 1JYWA 5IGXL 4KFMA 4CY8A 1I8LC 1IEBB 4OT1L 3EOBB 4MMZB 5I75B 3IJ8A 4KOCA 5JIQA 4ZNEA 4E36A 3U0PA 4V1DA 4CGTA 1JMZA 2W9DL 3FO1A 1CBJA 4YR6B 1INQA 1KTLB 4X5WA 4OGXH 2XYBA 3RVUC 3FT2A 4P2QB 4K2UH 4HT1H 4XIHA 1RZJC 2QQNL 4UIMA 3WENA 3GH9A 1SVCP 1HZLA 2IC2A 3X3FL 5C07A 2YWIA 1CD0A 5HHME 1EV2E 2Y1AA 3B1TA 3NYKA 1MELA 2YKKA 4KXZH 3ZIVA 2VABB 4NP4H 1N19A 3GV1A 4PJIA 1JJUA 4GKNA 3VXPB 1PL2A 4OGAC 4MBRA 3MRKB 1WS7A 3LYRA 5JXEC 2DD8H 2LW3A 5L2JA 1RW1A 2FGZA 5E1QA 5FHAL 4KDXA 1ZVHA 5A2FA 4YO0A 1Q9WA 3L9RB 5EUOF 2LTQB 4NC0B 3Q6FB 1IE5A 2XPYA 1HQ4B 1DJIA 1OGTB 2FEDD 5T8IA 3NP4A 4PJ9B 2UXVA 3BSZL 1ERNA 3LSOB 2EH7H 1WBZB 5I1AA 1T22A 2DZEA 3IOSA 2WXMA 3RNQA 3IJSB 3SKOB 5A2BA 1LVEA 2WK2A 2FD3A 2BDNL 2JVUA 4M03A 4Z3IA 1UD8A 4LLMB 1VGLA 5GGSA 2P0GA 2VXUL 3HRZB 4MHHG 3L16A 4YDKH 2EDBA 2J2ZA 5CJOH 3HNTL 2YD8A 3D3VD 3OHXB 5JLZB 3HI1A 1S3AA 3TOUA 3MJ8A 4NX0A 5JPMB 2H73A 1RZKC 2BFVH 1JPST 1PEZA 4V2CB 2F7OA 3SHSA 5I1KL 5J11C 4OBRA 1J5OH 3AXLA 4NZRH 3I3DA 3ERFA 4PTUB 4XHQA 3LEVL 2EDXA 1BZ8A 3QNYB 5EU6A 3I43A 1NPNA 5IMZA 5D1XE 4Z7NB 4IMKC 2EXWC 4KTDH 3NESA 4XRCB 2PR9A 4U2ZA 4ATTA 2BNRD 3M07A 2YD9A 4R8WH 2EC9U 3HBZA 4P2OA 3AZUA 5B38B 1JZ3A 2NCEA 1ZRUA 2AMUA 3GSUB 1RLBA 4LGSB 4UDUB 1MLCB 2FWOA 2XICA 2MMAA 2Z4QA 1FQ9C 5I2IB 4EJ1C 3N5AA 1NAMB 3CFKB 5KSBA 1NINA 1DQVA 3WJMA 1Q0XL 1ED3B 1VERA 5DU7A 3RBGA 2IH3A 1IM3B 1P5UB 3VGHA 4P3CH 4UM9B 1ZHNA 4WVRA 2I32A 3I2CH 1JRHL 4NJAH 4ZMNA 4MDCA 2GTWA 3CN2A 1P7QA 1AC0A 4MJ5B 5EN2B 1T2QH 2CK0L 3G2OA 4F1ZA 4FQQA 5AQ0A 4XTRC 4YSEA 5AVXB 5CBEB 3HC4L 3BP7A 4Y8AA 2IAND 4K71C 1J0JA 4UT9L 3WSQL 4LCCB 3H9SD 1FZMB 3K4DA 3PWJA 3TH2T 4BE5A 3UTSA 4KDUA 3BH9B 4YLQT 5DA0B 5ANMA 1GIGH 3QZPA 5HHPB 3RDWA 4OVVA 3V6ZB 3OZ9H 3QEHB 1AGEB 1XT5A 4IIQC 5EOTA 5H37H 4B27A 2J6EA 3V8CA 4LE8A 3FO0H 1AG0A 3O6FD 4NP9A 4OFIA 4MD0B 2DQUL 2EDLA 1Z9NA 4AYFB 2Y72A 4HSAC 4G6JL 1YMHB 4DP5X 4HJGA 3P2DA 5I8KH 3QORD 4TTDC 3NIFE 4X6FA 3M17B 2V9TA 4GRWH 4HJ1A 4NQDE 4XI5C 3FN0H 2L4OA 3NVQA 5JQHC 2VDMH 1BFTA 1SNRA 1NIAA 4ELMF 1HL8A 5DT1L 4TF4A 2BX5A 1BBDH 3WE1A 4JK0D 4D73A 4POLA 3MRGB 1G7HA 1BM3H 3UARA 4L23A 2R0CA 4CSZA 1JRHI 3ATBA 3WKNA 4MJEA 5T5NG 1KJ2A 1RJZB 1YEJH 5J9BA 4HS8H 1NW2A 2HKHH 3BPCB 3HHSB 2HJKA 3PWVA 5HQPA 3UPRB 2YRPA 1LD9B 3CK0L 3RG1C 1ADQA 1F3JB 3GMNB 3RUGB 3WBDA 1MCKA 4GQFA 3QJUB 3OKLB 4U3SB 4QKTA 3BJ5A 4PXOA 4BH8A 4K2XA 2X2YA 3BD5A 3GJFH 3QEQD 2PERA 1R4XA 4BIKA 3DVFA 1XZ0A 2K8SA 4MAYD 1MFNA 3FRPA 3FU7B 3TO2B 5AOLA 1U3HC 4U1JA 3U9PH 2TRCP 1DJYA 2H6OA 1CYXA 3AS2A 3DUUB 1SEQL 1NFDA 2MSPA 3C1SA 3MBWA 1KIRA 3OAWA 3C5SA 4JRRA 5JW3H 2ESVE 3G5ZB 4Y19E 3FZ4A 2OQJA 1KC5H 3BWAA 4KUCF 4MASA 2L6DA 3RBSA 3CYNA 1UD2A 5DR5L 5ENUA 1FHGA 1S7QA 4FNUA 1UZ6F 2ERJB 3DRQA 5ILTL 4ZMVA 1G7PA 5KVDH 1IARB 3OPZL 1TTZA 1NCAL 2PVOC 2H3KA 2LABA 3U7YL 1IGIH 4NNXB 2H32B 4LKCA 4KH7A 4HBCH 3LNHA 5D73A 5F89A 1YEGH 4Q0XL 2FAUA 4MJIE 2DJ4A 1XCCA 3J7HA 3N6YA 4UZGA 4OCFA 2FH8A 4ZOEA 5B6MA 1TSRA 1GGCL 3KPRA 1XCXA 3ET9F 4JX0A 5L4MA 5F72S 2ALAA 4H2CA 3CFBA 3ZHKA 3GXPA 1JWUA 3RWJA 4TVPH 5EU4A 1O9ZA 2P5EA 3KCMA 2GKIA 1EEMA 2VL2A 4G8GE 4GSDH 4HIJB 1CXIA 2AV7A 3K1DA 1FYTE 4R0LC 5C6TL 1A14L 1UJ3C 4UIKH 5FF6A 1OCRB 4OFYD 3TEZA 5IF0A 3GMFA 3HMWL 5DD6A 2OZ4A 1GUHA 3AREB 4QEGA 3CSPA 4UB0H 4C4KO 2N3JA 2ORBL 4GKOA 2H0GA 3SYPA 3T0DA 1A9BA 2O6DA 2CGRL 1E4WL 1A1MB 4AUUA 5MENE 1WE0A 4IOIA 3V0AC 3WLWD 4ISDA 5I6MA 4IBWA 3BP5A 4V11A 5DK2B 4MZBA 2R2BA 2WN2A 5HDOA 4I0PD 1MRCH 1M53A 1CQYA 3VFMA 3HN5A 3VFGL 4EOWH 4J2XA 3IN2A 3VU1A 3FTYA 4TOPA 4IYKA 5BZXA 2F5BL 1SN5A 3CJJA 2FBJL 2AEPH 3W2DL 3ABLB 5I0WA 2CVBA 5F7YC 1H15B 4LFHD 5FKAA 4XCYA 4ZO7A 3VD5A 1JHTA 4QHMB 3FB8B 3NGBC 4NN5B 4XP5H 5HDQH 2UWEB 4QXTB 2NY1B 1Q38A 1U8JB 2WZ6A 4P4KB 2DIBA 3VXQB 5DJAA 4Y7MA 1HH6B 3WKMH 1G7MA 1GR7A 3ULUE 1EV4A 3WN5B 1QHOA 4PB0H 3R1GH 3EOAA 3IS1X 4NNPL 1CU4H 1WE5A 1BCIA 2JACA 5EF3A 4YHZH 5JMOC 2ZWSA 5D7KE 4UZSA 2F53B 1Q4NX 2KLTA 4Y4HD 2OAAA 3GMQB 1JLVA 1OGAD 1ORSB 3S0PA 1SENA 1NMBH 4J5VA 1GGBH 2X2IA 2WQXA 2JCCA 3HEIB 4U1GB 3VFSB 3DJTA 3DWVA 5A1AA 4HC1A 3D18A 4FEIA 3LS5L 3K6IA 2PR4H 2R29A 3WS3A 3GD1C 2P47B 2WIIA 1KCWA 1Q72H 2ZZUT 3GMLB 2IADB 3LPGA 5E8DH 4ZDHA 2EDNA 3KGSA 5D93C 4A7GA 4ZUSA 5I66B 4MF5A 3VRLF 2DMCA 4TNVK 1HXYB 3KWUA 1PZCA 2VRKA 3L5HA 1NCJA 4HAGA 1MAMH 1NCHA 5AOJA 1X7TA 4O92A 3TRQA 3PWLB 4PCSA 2PYEB 2WLYA 1XXUA 1MOEA 4JKNA 4GSQA 1ZY9A 4U2YA 1ZCPA 1EEUA 3ZHDA 1SLUA 2F6AA 4LQ1A 2VCVA 5BVJB 4IP1A 2KMWA 4ADJA 2VDNL 3EVIA 4U1HA 1GGIL 2JIXD 5KN0A 3HY2A 2KUTA 2X3CA 5H5QA 1FFTB 1WQVT 4K55A 4NAJA 1NLBH 2IXQA 1X5MA 4OD1L 2FWSA 2QPUA 1SYVB 2I69A 4OJFH 5DVKA 5A2LH 4KMTH 2CRYA 4ZYKB 2IDUA 4AGQA 2F7RA 2BXYA 3WGUB 2Q9OA 3CZKA 3BVWA 1TPXB 1VCAA 2XQBL 3SGKA 4XBPB 4A38A 2P45B 1F6FB 5DO2D 1Q4JA 1SJZA 1DQJB 4M7LH 2E56A 2DF3A 4OZFG 3G6DH 3ME8A 3TF7C 3SE4C 3DDGA 2DEXX 1WIUA 4XAKD 3W0WB 1WHPA 3BZ4B 3O6KH 4U3XA 4NQVB 3DXAB 3U48A 2E7HA 5E9DE 2GJ6D 3NZ8A 4XTSA 4DERA 4GUQA 1C7SA 3MREB 1JFUA 4MMZC 1QGVA 5I75C 4MZCA 4GAAA 4XH2B 4OUUA 4KI5D 3KWTA 5J56B 3V4VH 2AXHA 3A5VA 3RWEB 2BW4A 4JG0H 2VXQA 2R1YA 3FULA 2KKQA 3NRFA 2IQ9H 4IU2B 3TIDB 4AGOA 2WY3B 5BW7C 3B1UA 1TU2A 4FCHA 4PJEF 1JGIA 1IQWL 4FIWA 5GIRB 4PTSA 1GVIA 5T3XL 5C0CD 4LMQE 4QYOA 1FWXA 3F01A 4U1SB 4XXWC 2Z8WC 3UCRA 4DO5A 5JHLA 3RURA 1TJGH 5CZXD 2NY6B 3DVGB 5F3HB 3QUZB 1PDKA 1I8IB 5DDLA 4FQPA 5DLML 3V52H 3FMGH 1BQ5A 3LKQB 4FQLH 4DOHE 2CIIA 3P3RA 2DJ1A 2XN9D 5D72H 3T8XB 1HDMB 4KJQC 4BKLB 4G9HA 3VXTA 1A1NB 2ZE0A 1YPZE 1HILB 3QDMD 2F8AA 3OF6D 5ABZA 4G8EA 3BZFA 4QHPA 4PJ9C 5IBLC 1D7DA 3INUL 2EO9A 4GBXA 1KGCE 4LF3A 3NAAH 3CVHA 4I3RL 2WQ8A 3ZZXA 4QRRA 5D5ME 5A43C 3ZDYF 2HVJA 3IGKA 5F7KC 1E67A 4NS0A 5ELGA 4WUKH 5AW9B 1YJDC 5TF0A 3LY6A 2OMNA 3HRZC 4R3SA 1JTPA 5DD3L 4BXVA 3O45A 4X9FA 3W9EB 3RL2A 4TNEA 5DI8A 1CE6B 1FV1B 4LSUL 1BLIA 3OX8A 1E5CA 2NY0D 2D0GA 3RGBA 3OHXC 3FW2A 3ZT5A 5ID0B 1SQMA 4QHLB 5JPMC 1F3BA 5C08A 4PRBB 2NUTA 1KGWA 3CC5B 4GQRA 5CYYA 2DLIA 4BE6A 1KCSH 4AYEC 5DGQA 5IUCA 1GSUA 3WYRA 3DJRA 3LNDA 4APQB 4PRPA 5EUKB 1NM9A 1GZHC 2ZF8A 3L4YA 4JKKA 3EYSH 3HG5A 4KI5F 3FKFA 1GZQB 4UBDC 1LJMA 3MRNB 3ERGA 3LKPA 1G0TA 1A6ZB 1MH5A 1UVQA 4AOFA 2OYKA 4HJJL 3S3DB 3UGEA 2O7KA 1BQKA 2ATAA 5CILH 4OIFA 3UVTA 4CADA 3PAYA 1KPVB 5LG6A 4XE0A 5ALBL 1FNEB 1L9TA 4OLEA 4XVSH 2WO2B 1QSEE 1DHKA 3HUJB 2YOIA 2Z65C 3VDAA 1P5UC 5BRQA 4QRSA 3WUWG 1QK8A 5I8CB 4MKTA 1A7BA 3HNVL 3WD5H 3QULA 2W5PA 2QV4A 5A2KH 4OAWB 1ADWA 3EO1B 3CSFA 3KW7A 3RPKA 3KXFE 4ANUA 5AD0B 1M9WA 2DI8A 3MGAA 4UV7H 3RVXD 1JV5B 3UYPA 4LCCC 5DDHA 4I1PA 3M1OA 5HPMB 5HI5D 3BPLB 3GB7A 2UY6A 25C8L 3RL1B 2VGLM 1M42A 1CCZA 1L9PA 3QWRD 1EWHA 2FUQA 3APNA 4KHTL 1EAPB 3E0GA 5EO1B 4XNMA 3D2UD 2WLJA 1JFQL 4BSWB 4C47A 1AQMA 2NYZA 1JDAA 4GLRH 4NWUH 4WSJA 1LM8V 4HMDA 1E7UA 2X2HA 2WYHA 2K45A 3MLYH 5D7IA 2CA4A 4G1EA 5JPNA 3VI3B 3K6NA 2X8CA 3NMEA 4JPWL 1XTMA 1JPGB 2BNQA 4H8WL 4JDZA 2WM0A 2P5WE 2YUZA 4XN9A 5C0AE 1D5RA 1WIPA 3HCZA 1BHGA 1W9XA 2K8VA 4XMKH 2DYSB 2VMFA 4MB1A 3W8SA 1XGYL 1JNJA 4ZIJA 3KBHE 3EDKA 1I8MA 2X4SB 1KCVL 1XGQA 4ONOA 1XW6A 4PJBE 4YK4B 2ZUYA 2WMPB 3L5XH 4RFEA 3U36A 4PV9B 4CRPA 4AENB 3OAUL 1J8HE 4YHKL 1P7KA 5ESAB 3ZE1B 1PVHA 1R6VA 2JI1A 4UI2A 4FJ6A 3KP9A 3OJMB 5DVBA 3HS8A 3K8KA 4NQUA 4CVUA 4XMUA 4CJ1A 4G9DA 2AJSH 1ZEAH 1ODUA 4Z6AT 3BXNA 3FQYA 4I8DA 5CZVL 1BXVA 1KT2B 4EZKA 2W81C 3V0JA 4F2FA 4FC3E 4ZXBA 3O4LB 4PJCE 2XV2A 1MHCB 2HFGL 1EEZA 2V0AA 4QRPD 4FG6C 3TL5A 2FLRT 3KLHD 2C1PB 3EGXB 4I13B 4KH9A 5E5MA 1NDMB 3Q5OA 1BX2B 3QWNA 4OLWL 4L8CB 2UXGA 4JQIL 4L3EE 5FCUL 3M45A 1WG3A 2WYTA 3RZWA 3FZUC 2W80C 3VWKA 1ZGLB 1AZUA 3RX5A 3GZQA 2CLVA 1F4YL 4GH7B 3V0IA 1TU7A 4XB7A 1OTSD 1UN2A 3FU9A 4I97A 2YQBA 4OUOA 1ML0A 3L9UA 1MFCL 2PYFB 5DHDA 2ERJC 1K3ZA 1T0OA 2OMUB 3O76A 1BJMA 4PS4H 3PV6A 4JFDE 5CNWA 4AQEA 2ZOLB 1N5YH 4WETA 2AAWA 4V1DD 3PQYE 4XZUA 2VD0A 4UTBA 1BQLH 3U6XS 4Q52A 4E0RB 5DQ9B 3ZQ9A 4ABUA 1OOAA 3Q2VA 2VMEA 4XNAA 1YYMH 5KEJA 3BUYB 3ELQA 2MBSA 1J5DA 4KAEA 3MGTB 5F1IA 5IB4B 4CNIB 3ARGB 4FFWD 4RISL 1MQ8A 5IHHA 5C07D 3OKYA 3P9WB 1X7QB 1OP9A 4JFHE 2GUYA 5E2TL 1ZT7B 4N22A 3G04B 1Y6EA 1RZGA 4N11A 4Y2OB 2Z8VC 3ZT7A 4Z3FA 4AV5A 1A3RL 5B38G 1PZ3A 3TEYA 1VACB 5C0GA 4L5LA 3TUEA 5GGRB 5GRWA 4DN3H 3C75A 5HJ3A 2BVOA 3G9VA 3BQUA 4HUWA 3EJZC 3HHRB 3QE5A 5ALCL 4IJ3A 5IHUH 2H8LA 3J7Yk 5KS9F 3EH2A 3QJFA 1OP5H 3SBCA 3QPXH 1OEZW 3G6JE 3DBSA 4LCUB 2VLTA 4B9GA 1YHPA 4NC1E 2L4CA 4WI0B 3RZCA 1GTIA 2QGDA 1YEKL 3MCLL 3PJLA 2X0UA 2HFFA 4N6RB 3AREC 5GRVK 2XTLA 2BP0A 3ETBF 3O0LA 2GPZA 4PS8A 5DJ8A 1JZ8A 4H8UA 5HHMB 3NQKA 3QFJE 4YDKL 4F37F 1NUFA 3G5YA 5E7FA 2Z64C 3C5JB 2YFOA 3AS1A 1C12B 1U91B 2A0LC 4FTVA 1WT5A 1OOWA 2DBLH 2HT3D 1BZDA 4GMSL 4DP4X 4GRWF 1ZLDA 3ARWA 1MAKA 2AABH 1AO7E 3VXNB 3L3IB 1QYGL 5E1HB 3WMSA 4D9LL 5EU6D 1T1XA 4NO2B 5TDPB 5ICYB 1CLCA 2G3ZA 1FGVL 3MUHL 1XWVA 3OGCA 2OTWB 3D25B 3F84A 3QIUD 2HX7A 4RMUA 1HJBC 3DX8A 3H3PL 1FC1A 1SEBB 4OO5A 4WF5A 4P4KC 1QD0A 4P2OD 5E70A 3CUPB 3MNVB 4JPIA 1V7MH 3N42F 1R0AL 5C8JB 1ASQA 4Y5VB 3RGVB 1SY6L 4BRVA 4JM0A 3WN5C 1S8DB 3VFRB 1T2JA 1DQLL 7GSSA 1JXJA 2ZAIA 4GFXA 5EZIL 1TTUA 5FLVA 4WWKB 2GY7B 3ULVD 5ECNB 1T2XA 3H7LA 5G2ZA 3IETA 5E8PB 4I0KA 2ZCLL 1K6QH 2Q20A 1P7QD 1IJ9A 3UG5A 3VRJA 4ZFOL 2ADIA 4UMGA 4U1GC 3ARVA 2MPAH 3OWRA 4PR5B 3DPBB 5B1CA 5DEJA 4MJ6A 1O8XA 3BDYH 1NGZB 1M71A 3HI5H 4TNWF 4OLYH 5CP1A 1KENL 4OFKA 2CLRA 5CJQL 5T1LB 3UTSD 1SZNA 2ZWLT 3APCA 4Z7UF 5F6IB 1XEDA 3AM8A 4S2SB 4X6DB 5FUCE 1BQUA 5CSBA 3SBPA 4H1LG 4L0YA 2C3WA 3FHAA 2F58H 4Q9CA 1BG5A 1V7NH 4TUJB 4LEOA 3MCYA 2GZYA 3JWOH 3MNWA 1A6TB 1A47A 4MB5A 4YBQC 3GTUA 1Z5YE 1CGTA 3GS0A 5EUOE 2ITDB 1ZLEA 1AXSA 1G9ML 3MRPA 2JB6B 1ZT1A 3GK8L 5GZZB 2IDQA 3SEPA 1NKGA 3TJEL 1PLGL 3K2UL 3O9WC 3TM6A 3E6HB 4B60A 1FZOA 4LP5A 1OAZH 2W07A 4IU3B 5JA8B 3GL5A 3T2NH 5AW8B 1HHJB 5I1IH 2IPUK 1MCOH 2WCSA 3ULUL 3MRJA 4TQEL 1X9MB 1TPXC 1YNTA 2Z92B 3WYWA 4YDIH 3QO0A 4POZC 1UOLA 4O02B 3DYMA 2QT6A 2UXTA 1GL4B 3D5OF 1KGUA 1SBSH 4FX5A 3QR1A 3DV4A 1MJJA 3OAZH 4KU1A 3NIFB 1CQHA 1M1SA 3U4KA 4NQDB 5FA4A 1UZ8B 4LEEA 2VM9A 4WW2F 4PWKA 2DH2A 3WN6A 1UA5A 1F3RB 4IRSA 1KZYA 1L6ZA 3EO9H 3O6MH 4WY7H 3QAZB 2ADYA 3BGMA 2DKHA 4OFTA 3RJDA 3BCKA 1XF4A 3IF1A 1A21A 2XA3A 3E3QC 4AGSA 2RBLA 3EF4A 4AM0B 2CE6A 4PUAA 5B1JA 5ES4B 6GSTA 3Q8CA 1MCCA 1K3YA 2CM6A 5IQMA 2CZNA 2EKSA 2Z34A 4LNRB 3UMNA 3EU4A 5IB5B 3GINA 5D2NB 4XVJL 3WFBH 4K0GA 1LXMA 1E90A 5ISZA 2WYIA 2W0FB 1QHQA 3QUZC 4ZTPH 3T3ME 4MJHA 3EJTA 4CN1A 1KGYE 1F6AA 1MFAH 3P0VL 5D9SA 1AIFA 1UWEL 4MAUL 3R0MA 3K72A 4RGNB 3SDAA 2YWMA 5AVUB 1NKRA 1HQRA 1QUPA 5D1ZI 1OE2A 1NBCA 2WPGA 3SDCA 1INDL 1ACYH 1G0DA 4NM8H 4PYGA 4DW2L 2PPTA 2EEXA 4GRLA 2VT0A 3LRSA 2CO2A 1UH3A 4DIXA 4AXWA 2QADD 4Z7XA 1B6UA 5F3BA 1LNUB 1OWRM 1D9KA 1EA9C 1F97A 2ESVB 3KPRD 2L5LA 1IGTA 3QXDB 2FWUA 4L4TA 4Y19B 5AYTA 1QR1A 3FCTB 1TKWA 3RDTB 2NNAB 1KXVA 3AFLA 4DVRH 4ZFGL 2P5ED 2DQIH 2ZYRA 3V55A 2F9BT 4YFDB 2KBGA 1YDPA 3OSKA 3BDXA 3ZK0A 4A68A 4IRJA 4NRXB 2NY3C 4HSCX 4Y89A 1ZKAA 32C2A 1LO5A 3WNNA 5KAQG 1R5VB 1R5PA 4PLJC 5DD1L 1T5WA 1CR9H 1WEJH 2HNLA 1D2PA 1QBLH 3MOQA 3LJ3A 5CSZA 1RK4A 1AYRA 5AISA 3QHTC 4XCFH 4LVNB 5GGUA 2DQJH 3BP4A 3I6GA 5LJYH 3ROOB 5IMLB 4MNQA 2ZPKL 1TYEB 3BMVA 4KNUA 4ELME 3DNKA 4F7MB 4APQC 3FT3A 1QLFB 1NBYA 1OO2A 3SE8H 4PJHF 1M2VA 3MXVL 2F1EA 2R1WB 2WGXA 4G7VH 5K9OB 4GQZA 4AQ8A 2XWXA 1CQKA 4LASL 5G5FA 3MX0B 3KR3H 4HD5A 1EWXA 4BVYA 3VFUA 1AH1A 5I26A 4ZL7A 3I6KB 2VDQH 4M5YL 4M8QA 2M72A 1X9QA 3S34H 1ZS8A 2VMJA 1O75A 2OPCA 2YNXA 1OGSA 2C9PA 2YQ3A 5I30L 5HYSB 2XT1B 1OKDA 5LBSH 4HF5H 4PGBB 1BLNB 1WVZA 1XGPA 5JUEH 4MJBA 4ZJ9A 5DS1A 2NPBA 2UZXA 3OVUB 2J8HA 3T4AA 1JPSH 3VTMA 2PLTA 3R8QA 4F0CA 2EXYC 2HN7B 4WCYH 4DUWA 1J1OL 4TLSA 1CXKA 1YNKH 3BEWB 4JQXC 3BPLC 3MRCA 5JXEA 1GKOA 3HC2A 1SJVA 1B2YA 3WV0A 1Z7RA 1MUJB 5F8QC 3DGGA 1JI2A 1S7VB 3NJFA 5FGSA 3CVIH 3SKUD 1UZ6E 2B4CL 1R47A 3UBKA 1INEL 2CDEB 1II4E 2WQRA 5HYJE 2MMNA 4PJXF 4HJIA 5GS0H 1YY9C 2R2EB 2UY7B 1ZLSL 2CUIA 2WTRB 5D1ZB 17GSA 5EF2A 4K8RD 4CUCA 4IMLA 4Z7OB 5FFLA 4RMSA 4YHPB 4BD4A 1V10A 2XBIA 4LMQI 1KXHA 2FWHA 4HOJA 4NFBA 1VKXB 3FYEB 3A24A 1SLXA 4QWWC 2ZOKA 5T33H 4EE0A 4M1GH 1J1PL 4PTTA 5KANG 4AJ8A 5JHDA 4QT5B 5TFSH 3IU3B 5KVEE 4GNKB 3IFPA 4HKJA 4P9ML 4FLOA 4YK4C 1SMDA 1U3IA 1DANU 5FYKE 1WBXA 4IMKA 3DVWA 3G9AB 1XBSA 4BL7B 1HH9A 4F92B 2YXFA 2HZHA 2TRXA 2X4UA 4PCKA 4XPTH 4XT1C 2IJYA 1R33A 4J8RB 3WFEH 1VENA 5CXPA 2H0IA 1AKPA 2SEBB 2AJQB 4CY6A 1RZIB 3OPUA 1S9XB 4X5PA 4AIOA 5I1GH 4FXLA 2F8IA 3KH9A 2RAMA 5H5RA 2ZYHA 1JG9A 2A2PA 4Q8BA 1J1XL 1S9WA 2HYMA 2APXA 4LCWB 1ZHKB 5DMGC 5GGRY 1NCTA 3CD4A 4UT7H 1I8KB 3OKNB 4FAAB 5JYLA 3AB0B 2UUDK 1MWOA 3F5WA 2NY2B 3LN9A 3FCSA 3P4MB 1JZDA 5EDXA 1BF2A 1AUCA 1ZVSB 2XWBA 3BAWA 2PETA 4F24A 3ZE0F 4GO9A 1Z9SB 3EF7A 4OLVH 12E8L 4HMEA 4D9QD 5TH2B 5KN1A 2WGNB 5T1KA 3V5HB 1WS8A 3FY7A 4Z7VA 1KELH 1LMKA 2P3YA 2AZUA 2QSIA 4E41A 5EA0L 1KCKA 2EUZA 2GIXA 1XIWD 2BCMA 1QXHA 1KPRA 4I5BB 1JXGA 4OCYL 3LMJH 1UURA 4GY4A 1DSFH 4PN6A 4BWSA 2X4OB 5F0LB 4IIQA 1FVEA 3MRRB 5FYLD 4OF8A 2P46B 2Q8BH 2QLVB 3FT4A 3BWSA 4OLUL 1T20A 4PBWD 3JWDL 2XWRA 1D6EB 3VGAC 4HLEA 5DC9B 4LSQL 3WNJA 4NXKA 3GBNH 5E9DB 3BKYL 3CN0A 3V4UH 2CU9A 4H20H 2BSEA 4IHOA 3C60B 4M1CC 4QHUB 3FB6A 2IH1B 2A4ZA 4PLOB 4O32A 4GBXD 4JFXB 1N64L 5JW4M 3S97C 4EDXA 3QEGL 1DDTA 4QRRD 4ZUUA 3VRLE 1EXUB 4RAVB 2YPVA 4XMVA 3HBQA 1XZOA 5FYJH 5KBPA 4NJ9L 1BIIB 1I53A 5LQBL 3RAJH 5F1SA 1TKDB 3MDKA 4EBQH 1NEZA 2AXGB 3G08A 1WZAA 2ATKA 3UBFA 1TZIA 4ZW7A 5JW4R 4DZBA 4YSSA 3N9GH 3W56A 1BF5A 1EEQA 3KH3A 4YSAA 2WQUA 2FSEB 3LXAA 1YPZB 1K0OA 1IMHC 3EUUA 4ETYA 3OLDA 1TQCC 3F6JA 1U3HA 2A9ML 4OFDA 5GS1C 3MRHA 1A7NL 1NBVH 5D5MB 5FM5M 3T8VA 1UXSB 3MRMB 3QUHA 4PJFF 3CLFL 4LL4A 1W8EA 4L1BA 5KYUB 1Q8MA 2R9HD 4CN6A 2C4JA 3K81A 3P4NB 3RGVC 2WNXA 5I0YA 4A6YL 1NCCH 1JK9B 1TTRA 2AQTA 2V2XA 3ZW3A 4WWKC 5J8OA 2ZD0A 2E5EA 3FQTB 1PKQA 4JG5A 2JI3A 2K7PA 3AS3A 1BXXA 2P7TB 4YIQB 1OGAE 3BAKA 2CQVA 1J88A 5T3ZD 2WW8A 4PHZA 2NX5E 3BQVA 1EFXB 4UQ3A 4EUPB 2R23A 4MX7A 1HQOA 3OAYK 3E8UL 4F7CA 2D0FA 2Q7YA 2XFGB 1SMAA 3MLSL 4OF7A 3B8YA 1J8KA 3RFZA 4G42A 1QR4A 3OJVC 1SVBA 2E27L 2EE6A 5IR1B 3ARDC 3FQUA 1LE5A 3K80A 1N9PA 2G0LA 4PJEE 5F6IC 4JKMA 4OZFA 5C00A 4O58L 4GW5A 1WCQA 2NZ1A 4M1DL 1D3CA 3EXLA 3NCMA 2K4AA 2EVGA 1R34A 2A6JA 4QO1A 4N87A 5I82A 1KIUA 5ICZB 2P42B 3WKQA 3M46A 5ELAA 4ZZKA 3I9PA 5DJ2A 5T5FH 1RUPL 3K71A 1OE1A 4Z0XA 4D9RD 6CGTA 3S35L 4L29B 1UJ3A 5F1NB 2K70A 1RUKL 2VL5A 1IBHA 4N2CA 1H4OA 4YAQB 5D8IA 2ITCA 3MOAL 4N90D 2Y7LA 3L9BA 4P3DA 5E4EB 2KYIA 3UBXB 2HKFL 1BYPA 4E9SA 2H1AA 4XWGH 4X6BB 3CDGA 3U83A 3T8MA 3IK9A 5I1LB 1BOGA 4HFWA 5HBBA 2GLRA 4GPVA 3ZDYE 4TN8A 2H1PH 3UBGA 2V9RA 4ZW5A 3S8WA 5CRWA 2PW2B 5I1DB 4I2TA 4AT6B 4GINA 1VFUA 2ICES 3H42H 5CGTA 2HYXA 4UYQA 3P0YH 4XNXL 2IGFL 3WELA 1PX6A 4U0QB 3V6FB 3RBTA 2P80D 1ZA3A 2WBJB 1M6UA 4M8RA 2YGOA 4L4JA 5DYOA 3VFVA 3FT0A 5TQ0L 4PQHA 3G6AB 1E9PA 1CIUA 3KL3A 3QAZC 1GH2A 2IPKA 3DA0A 1V40A 3FUEA 3PAVA 1K0BA 2R56H 1FCGA 1U8IA 3GEWB 4ZXBD 1D5MA 2P5WB 3VXOA 2BNUB 4GUOA 1B9ZA 2CHWA 3OLGA 4KI5E 3D0LA 4KRPB 5FGRA 1JHKL 4X43A 3PRZA 2N5AA 2IDTA 4DP7X 2WRTA 1REIA 5DQJA 3N41B 3EJQA 2A6IB 1PX3A 3VWKD 43C9A 1FVCA 2PTTA 2VR9A 1GL8A 1PZ2A 3A5IA 5D2NC 3O41B 5C0CE 4D8PA 4HJSA 2LKUA 3RB7A 5IUSA 3K4ZA 3UJJH 1J8HB 2BHZA 3GXTA 2V8LA 4TSCL 3ILQD 4HEMA 3ZITA 4FP8L 1F58L 1MNUH 4UQ2B 4WEBH 4A2DA 3QPMA 3GRWH 5D93A 2FEJA 4HKBA 4EQ2A 3QR6A 3KPMA 1DQDH 2IAMD 3IJEA 1AFVL 4NHUB 4PJCB 3UYRL 8PAZA 3QFBC 4MD4A 3NZNA 2CG9X 1JXFA 2VKXA 3WIIL 2AUVA 2HLAA 2MNWA 4AJ0A 4Y2DB 2DJSA 5F70A 3VD3A 1WHOA 3WFHA 4YNYA 1EDQA 1UYWH 4N9OB 4RESB 2A1WH 4JM2B 3FK3A 3ZMRA 3RDTC 1EAJA 2VQ1B 4TL5A 4U49A 3RHCA 2JTYA 3WUWA 4J3BA 3BQUD 1RZQA 4B97A 4NV5A 3FQ2A 1USQA 3FUFA 2G2RA 4ORGB 2YPLB 1PZ5A 4ZL8A 3RY5A 1KCRH 3S3BB 5CU9A 3PQYB 4F57L 5ECKB 2IQAA 3ZMKA 1ZMYA 3SBRA 3MOBL 4JFFD 4R4BA 2B1HL 3C8KB 4FQXC 4CVXB 1CDIA 3RZCD 2HMIC 3RHBA 3M86A 1ZS2A 1IGFH 3S37L 3GI8L 1TEGA 1B2WL 1U9KA 2KDGA 5I71B 4LVNC 3N1FC 2D2OA 1G9NL 1T66C 2CO7A 2CVKA 4B9KC 4DCQB 2ZKXA 4O51A 5DUJA 3U30B 2ZP8A 4KW6A 3X1FA 2ADGB 2P8MA 3IBOA 4LQFL 1EX0A 3GO1H 4FTVD 2GTZB 4PJGB 4YGVB 2BSTB 1WPIA 4LSPL 4YFLF 5ABDE 5GISL 3ABMB 2YXVA 1OAXH 4OTXL 1XVWA 3O3AA 3M1GA 1QKZH 2OTUB 3QOUA 3D9AL 4MMZA 2MQ3A 2WZPA 1E65A 4Z78A 1I31A 4HOMA 4XPHL 3QGVA 5EU5B 2C9VA 5JNYB 4V33A 1KCUL 5HR2A 4JPQA 4MBOA 4TR4A 1KTLA 5BW7A 5F21B 2O85A 4W9IC 3QFJB 5HXMA 1XQ4A 3MKGA 4P2QA 5GJTL 1UKSA 1EERB 4NQCB 2C7FA 4QXWA 2N1KA 2V4LA 4NCC2 4XXWA 4ZSOB 5IFAL 4CBZA 5KN5B 5F07A 2FYYB 2FVNA 4D2NA 5CD5C 1U6AH 1AZZC 4YL4A 4YMPA 4DUXA 1R3IL 2VABA 1HZHH 3OMIB 1RUML 4TKWA 2OZNA 2HE3A 4PVBA 3VD7A 3MAWA 2YPKB 1L9RA 4JDTH 5J3HD 4MA1C 1O85A 2BIQA 1G9MC 1J48A 1MFDL 1KNOA 3IXRA 4FYBA 4DPBX 2WAHA 3TESA 4DEJA 3Q6FA 1F11A 1HQ4A 3BCDA 1MRDH 4YQVA 1IGML 1PJ9A 4XC3L 3FTVA 3VYPA 5JXAL 5FO7A 2MIZA 1P4BH 5D1ZC 3WIHH 1NIDA 3I85A 3SKOA 3ULUC 2M1KA 4FZEL 1EFQA 2VDOH 3QHZL 3BAEL 4XOEA 3AY2A 4I0CC 3EU3A 3HRZA 4J1UA 1TRUA 2CV4A 2WXFA 3A22A 4X80L 4HCIA 2ED8A 1O7SA 5F9OH 3I9IA 4CW1A 1I9JH 1FJ1A 1RI8A 5JLZA 4QXVA 1G43A 1BG1A 1RHHA 1UXWA 2V5RA 2DLFH 2YAHA 1H8OA 2HG5B 1XB6A 2G75B 2R0ZH 2DDQL 2NXZB 4UWQB 1GWCA 2O93L 1TEYA 1NH6A 1M57B 2FATL 3QNYA 4HK3J 1JZJA 5KS9E 4HZ1A 5IW1B 1DQMH 4QHNB 4H0HB 3CPUA 1Z5LB 3BVUA 1UUNA 3QAQA 4N6QA 3ZGHA 4TQHA 1I7RB 4QTIL 1GZHA 4ONGL 4XRCA 4ANWA 3UG4A 5IEKA 4OF6A 2W9EH 4J3UA 1GOHA 3ZMNA 1V3KA 2EDMA 4UDUA 5DMKB 2WCGA 3QRLA 4U1KB 4ZMXA 1N6UA 3MV9E 3BKJL 4UUJA 3CFKA 4XVTL 5I1HL 3IJ7A 3AB0C 1B0WA 1JDDA 2Y25A 3KYNB 4GRWE 2OBGA 2DPKA 4JFVA 1P5UA 2VLRB 3MRDA 1VA9A 2DLTA 3PABB 1C08A 4J23A 3OKKB 4JRXE 3HNSH 3RU8H 4L4VE 2GSSA 4MJ5A 4H88H 2VIMA 1DJWA 4AX3A 1XX9C 3SKNA 3SGEI 1NL0H 3QIWB 1SBBA 2FX7H 3GMRB 4JHBA 4LCCA 4BBWA 4DF9A 2V7NB 2HLSA 3BH9A 1TQSA 4HCRA 4G43B 3V6ZA 3W38A 3QEHA 1GZPA 4PNFA 3DKHA 4IW4C 3QDGB 1IEAB 1CWVA 3LKNA 4MD0A 5HVGB 2OR9H 4AYFA 4OM1H 2YMXL 1LWHA 3SDAD 5J1SC 3TKSE 2Y7MA 4J57E 5KVEL 4MQXC 2DYPA 2O5YL 2P8PB 5D71L 3TURA 1JPTH 5CP3H 5CIPA 3SDCD 2WWMD 3GI9H 3C60C 3SDYH 4OV5B 2FD6L 5DEZA 4GRLD 1FIGL 4QAWA 3BSGA 3SDXF 4BQ9A 1P7HL 5CO3A 5IQ9A 1U0QA 2HVKB 3IGFA 2H6XA 1D9KD 4XP9H 5HYSG 1NBQA 4L4TD 4Z7UE 2IBZY 5GSVB 5I8OH 9PCYA 2ZX8A 5EZJB 1A6WH 4OF3A 3KYMA 2YZHA 1WA0X 3FU5A 1GSFA 3Q7JA 3T3MB 3UIYA 4IRJD 3UZQA 3BPCA 5C0EA 2JKRM 3H2WA 2X41A 3N85H 3BKCH 4CU8A 3UPRA 1LD9A 3RUGA 1M2DA 2Q86A 3GMNA 1B4QA 3TNNB 1R9FA 1TZ8A 4OBSA 2AB6A 3OKLA 2F5AL 1BVOA 5A5KA 2O6FA 4YSPA 1GCYA 2HPTA 9GSSA 5E2UL 5HD8D 1QW8A 4MNQD 2EZ0D 3P3YA 3FU7A 4NI3A 4H1LA 5BS0A 2IG2H 4A7VA 3FTWA 1UWXK 1P0SE 4BH7B 4URKA 1L0XA 2BLFA 2J4WL 2YBRB 3DVNA 4X0KB 3DUUA 3TV3L 1W0YT 3AY8A 1IO4C 3TYFA 4TVPE 4XZ4A 2D03L 3G5ZA 4ANVA 2FJUB 1CMOA 3GMMA 1JF1B 1SPDA 3VSVA 1A2MA 2B4CC 2IMNA 3IM1A 4LESA 1YEFH 3H9ZA 4N1HB 4QTHB 3ULVE 1ZHLB 1MFBH 3QUGA 5DFAA 3IU4L 1G0YR 3BZ5A 4TNFA 4NNXA 3T6VA 1M7DA 2NCMA 4L2LA 3AT0A 4P5KA 5CGYD 1CO1A 4UTAL 4Z7IA 3F58H 3GSVA 1OAYH 1IVTA 5JZ7D 1D5IH 1KJVB 3BAJA 3IFOB 3KCPB 3LN5A 4F80A 2YAQA 3LHAA 2MH4A 4KOBA 2F54E 4XP4L 2BNRB 3L95B 5EZOL 1OAQL 4OGAD 2WTOA 5JXED 1MJ8H 5IVXA 2MFNA 3GNML 1QFUH 2DQTL 2YV9A 4JRFA 5HI4C 2AV1B 2EVFA 3VFPA 2K9UA 5DEGA 5JIDA 3WGDA 4WTQA 2GT5A 5BV7B 2PCXA 4WUUE 3QJOA 1WAEA 4NO3B 1VCBC 1I3RB 2DEYX 1GSYA 3LNFA 4Z3EA 2VO8A 3II1A 2VC2H 3AREA 5KYYA 5G2NA 4X4XA 3LH8A 5MEQA 2PP8A 3GSNB 4TXOA 4YJZL 2FNOA 1A1MA 5E4EC 4A5PA 3DXBA 1PD1A 2GHWB 1ERWA 1SRDA 4G1MA 1A6UL 5HGAB 3H9SB 3SPJA 3WEBA 4D3CH 5I76A 4KTGA 3FU6A 4FQCL 1SKWB 5JHDD 3MA9H 3QXUA 4EXKA 1YQVH 2JV6A 2ZKHL 3IEAA 4L3AA 2C5DC 4R7DB 1O6TA 1QPKA 4JGJA 3CAFA 1E4HA 2OCCB 3FF7A 3O6FB 5F8RC 4K3EL 4R90L 1H15A 2EXWD 2VZUA 4HJ0C 4FYTA 4MWFB 2WBJC 3GKWL 3MLVH 4QHMA 4PP1D 4UT9A 3QORB 1UWFA 3L9VA 3M0FA 4QXTA 5FFOA 4P4KA 2Z0UA 4JFUA 4ZUTB 3IPEA 5EWIL 2HTLD 4PRHE 3EE2A 1K0DA 3TBWB 4JRWA 3WFDH 4GP8B 5GSRA 2I7OA 1ZA6A 3GGWB 3B43A 5FW7A 1ZZYA 4HIXH 4KKCC 2MTPA 1EGOA 3A6OA 2NNRA 4KRPC 4HWEH 1JZ6A 4PJHE 3WNIA 2F53A 1V55B 3X17A 4JZNB 3GMQA 1NPJA 4MQ7B 4M7JH 5H35A 1UOWA 4HGWB 4N2MA 4M6OH 2VM1A 4ECCA 5G1KA 2WBXA 5T1KD 3WMPA 1RV6X 4JPVL 4XTRD 5K9KA 1SYSB 4JRLA 5MP6H 1BPVA 2Z7UA 4AEFA 1ORQB 4E41D 1ETJA 3IDIB 1AJ7L 2XC2A 4FXGB 4WNJA 5ABRA 4XHMA 6TAAA 1JGDA 3HFML 2EEBA 1M3JA 2WUCH 4B7IA 4YXHH 3GMLA 2IADA 4YQXL 1GUKA 2J56A 3QO1B 3X11A 1NSWA 5B8CB 3CMIA 1KY6A 3QEQB 1ZT4A 2ZYIA 4MAYB 1AHMA 1NAKH 5FKPB 2J1YA 3ZPDA 3PWLA 4OZHF 2PYEA 4X7CC 4DQAA 3EG9A 5JIKA 4Y2DC 4WKWA 1LTXA 1W80A 3D33A 4U7KA 4JBBA 4N2HA 5J6GB 5LKNA 1OC9A 1DBJL 2B59B 2IV8A 4JM2C 4S1SL 3RWGA 5BVJA 4XI5D 3O3EB 2E6JA 4PREA 1XWGA 3K0YA 4MA8H 4ZNCD 2BSED 2A2QT 2QGBA 1OAUH 3AQZA 1Z6JT 1WFIA 1TW9A 2X4AA 2BWIA 3HPLA 4XOCA 4PJXE 2JNZA 3O9WA 5IBUG 1QFWM 4G6FD 5TF1L 4K3HA 2XWTB 1SYVA 1O6SB 3X14B 2KT6A 3BSZH 1JZ4A 4LA1A 2VXTL 4ZYKA 4EUPG 3BISA 1EQWA 5F9DC 1XH3B 1B9KA 3FONB 4L48A 2X49A 3IPZA 2H01A 2VE6B 4DQOH 4XBPA 4B9YA 3MVSA 3IPFA 3VQ1C 1A4BA 4KY1L 2J55A 3IMRA 4W9EC 3U30C 3BAIA 4FOMA 2A4EA 2WKGA 3MJ6A 4YXKH 1Z32X 4JZOA 1DQJA 4PVNA 2DM4A 4MZRA 1T7ZA 1WZKA 3HR6A 2BZDA 3W0WA 2AF2A 5KW9H 1X5ZA 2I27N 1A8JH 3WE6B 3DXAA 5I1KH 5CLXA 1FRGH 1IGYB 3C2SA 5IB3B 1WCBA 1IT9L 2CNYA 3MREA 4XO9A 5IJKC 3FAWA 3GXNA 1U3HD 3E6FB 2YZ1A 4NC1C 1TU8A 2H1GA 2IMEA 2QPSA 4HFUL 4QOKA 2F8FA 4F2ME 5KN2A 2B77A 1GPOH 1EZSA 3A6CL 4IU2A 4XB3A 3PINA 3A23A 3TIDA 4GG6F 3K2MC 4V2LA 2VDLL 5DHVH 4JO2H 1L9NA 5G5EA 3UBXG 1BJ8A 4U1SA 3ZDWA 4X4JA 5F3HA 1FO0H 2JF1A 4I0PB 1N0XL 3TPUB 4YHOL 1XSIA 3CC1A 1ZK9A 4I88A 3LKQA 2L4QA 3NH7H 3ZE0E 4WFHE 3H4KA 3MIXA 2Y5EA 1A23A 5LBGA 4BKLA 4HQSA 5E7BA 3T2OA 5EPMB 4BK4A 1KLUB 3HJEA 2A2RA 5C09A 2CIKA 2YWZA 3BE1L 13GSA 4ODUA 2IN3A 2CD0A 1E28B 1T7VA 3TXAA 5BUAA 4IK7A 2GAZB 4OGXL 1ES0B 1U2YA 2Q7NA 4ZOAA 4K2UL 4HT1L 4L0PB 4DK3A 1XHHA 2G5UA 4FYQA 3D39A 1KB5H 3CZFB 3ZUNC 3ELAT 2Y5QA 1Q90A 3AG4B 1FOHA 5TK4A 2QKEA 4IN0A 3H54A 3F4TA 2DV6A 4NQXA 4NQEE 11GSA 4HETA 2EC4A 4X9GA 2YD6A 3UADA 1CE6A 1M7UA 4XX1E 1FV1A 4APXB 2DD8L 3IFNH 1RK1A 2MQCA 1OGAB 3KTLA 5ID0A 4QHLA 3X1BA 3RX9A 4ODBD 3WY4A 4U1NB 4ZMLA 3VYNA 3RWCB 1YEDB 2NXZC 3EFOB 4H13C 1JGEB 1HL5A 5J6HA 4WO4B 2EH7L 4DHLA 2V9UA 4ODSL 4HJMA 1KF9B 1UOVA 1PIFA 3QP3A 2GI7A 4WHTA 3KNBB 3LIZA 4APQA 5EUKA 1O73A 3CBRA 1OF2B 4PJEB 4HIHB 5DT1H 2WANA 4P04A 5DJLA 5FUCC 3QI9A 1A6ZA 3OXRA 2W59A 2Q87A 3BP6A 1UH4A 2VOTA 3D0VB 5FWRA 3UH8A 4BFRA 5DFWH 1B0GB 3FL7A 4XCEA 4DEPB 3NJIA 5F7FA 16GSA 4OCXH 4DGWC 1FNEA 2Y07H 1J5OL 3FFCE 3PIQB 4NZRL 3SQBA 2LAGB 3IKCA 1KGJA 1N10A 2F0CA 1X7SA 3HUJA 4KKRA 3GZOA 5IESL 2H0HA 1B0RA 5AB2A 2JIXB 4OQ1A 4B50A 1WA1X 1KWKA 2R29H 3TJGA 1TJIH 4KTDL 2WN3A 5INDB 4U6YB 4D9QE 2O72A 2OACA 1AGBB 2WNGA 5CZRA 4NNYB 4KXZI 3JTSB 3EO1A 4JCLA 4Y4KD 4R8WL 4Q9QH 1OAJA 3OB8A 3QIWC 1CK0H 1KG0B 4PJFE 4S1RH 5JHAA 3ASNB 1U88A 3ZDYB 3DIVA 3HN3A 4WNQB 3TBTB 4JQXA 3BGFB 5HPMA 2XWZA 2N0KA 2H45A 3GMPB 5A7EA 1ILSA 1A0RP 3PU7A 1WWAX 4L9LB 4K3JL 5BQ7A 1U95B 3CZJA 5FYLE 1EAPA 2VIRB 4P3CL 2F8XC 3I2CL 5EO1A 3UAEA 3FAXA 4HUXB 4ODTH 4BSWA 2Y69B 4ZILA 4JFPB 2GJ6B 5C71A 1Q94B 3JYCA 1G9NC 1O7VA 1T0PB 2ED9A 2AVFA 3VI3A 1I7ZB 1BQHB 3QQ9D 2EIZB 4XNZB 3JYBA 5E1AB 5MEOB 4FKEA 5JCWA 1GIGL 3ZL2A 3LXCA 2W1NA 2X6CA 1K5NB 2W65B 5T1JA 3FO0L 3PHQA 5CRDA 4OVUA 1GGCH 3KPTA 3P73B 1SJHB 5C0CB 3PE9A 3ISOA 4NO5B 3M8NA 4N0ZA 1H75A 2C8NA 2EQDA 3KS0H 2HT4D 4EKZA 1UACL 3DRTB 5I8KL 4AENA 2CDFA 2GDRA 1DE1A 3NEEA 1BOYA 2JK5B 3CN4A 5ESAA 2C0DA 3N43F 4OJAA 2DLXA 1FLRH 4TM9A 2PXYB 4KRLB 3FN0L 3KPNA 2OL3H 3AY4C 5L8KB 5DUMH 3HAEA 3W5NA 3QDMB 2FEDC 4NENB 4OZIF 3IB4A 1BBDL 5MEPB 2CKBB 3KPLA 1HOEA 1EHNA 2CGRH 4BZ2L 3ILEA 1MHCA 1XF5A 1X9RA 2QGEA 3FSZA 1BM3L 3DX1A 2IH9A 5JHLH 4UOW1 4PIBA 1K85A 4FN0A 1NDMA 4UNVA 2BWQA 1YEJL 2XVKA 3ARXA 2PTUA 3U1PA 1GSQA 2HKHL 3LQ7A 2DJJA 3MJ9L 3MV8A 4YUEH 2Y22A 2WZPD 2XUWA 1KCBA 3CFEB 1VSCA 2PYFA 2NY0B 4XNQB 2X28A 2VO5A 1P1VA 4PBDA 3GRBA 4HU8A 1S6NA 3B2MA 3PPUA 4I8BA 1VADB 2E74C 3FDWA 4XNBA 4E0RA 1DCLA 3LVEA 4L1DA 1QABA 3BUYA 3RJQB 2QKSA 3NCEB 2LLNA 2YMOA 2WWOA 3ERWA 4CW9A 2DM2A 1J9TA 4DP8X 3QG7H 2JXMA 3EBHA 4PRDB 2BIHA 5JW3L 3FUJA 4OSUH 1X4ZA 2FY6A 3U79A 1VACA 4D8OA 1LEKB 4KJQD 1BJ1J 5KVDL 3QDJA 2WLLB 5F0PB 18GSA 1TI1A 4HV8B 3FQ1A 5HSFA 2K0RA 2LNSA 1IGIL 1E6JH 2ENPA 2X42A 4H25B 3ZIJA 4LCUA 4X7TB 2EDRA 3LS5H 3SQRA 2VM2A 4WI0A 1K4CA 1PL3A 4HBCL 4YS4A 3BO8A 3LQAC 4N6RA 3WEAA 2X89A 2OXHB 4N90E 5IMMB 3T0WA 4DN4H 2BHUA 2VLJD 2AXWA 4LDEB 3H79A 2AJ3B 3C5JA 4HWZA 1UB6B 4OZGB 1C12A 1EHAA 3VGGA 3GFUA 4TVPL 4W4OC 2R1XB 3LKSA 5F44A 3DIEA 3E3EA 1J12A 1HK6A 2FK9A 2VZ3A 3L3IA 5E8OA 4AZ8B 3O6FC 2VR6A 4UIKL 2PPAA 1EGJH 4NO2A 5TDPA 5ICYA 3D2UB 2XBZA 1YLBB 2OTWA 2D3LA 3G7JA 2LE9A 4UB0L 4UNIA 1ZV2A 1S78D 4M4PA 1KJ3H 1TVBB 3QORC 1SEBA 5GS1A 2FWLB 2K18A 4IHBA 3ZTJH 2HSHA 3CUPA 1A1OA 3MNVA 3QR2A 4JCWA 3WD6A 1R3KA 5EBMB 2UVFA 3GIZH 5EZLA 1AY1H 1UA6L 5FDWB 3VNZA 1M9AA 3RGVA 1TLKA 5F7DB 3GX0A 1S8DA 3VFRA 1MRCL 3L0HA 2ENJA 4MZIA 2VQ4A 2AS5M 3LPPA 1AC6A 2N7SA 1IM9B 4I9WE 4DKTA 2WIMA 3LJRA 1HKFA 5DUBB 2CDGA 1ASOA 4FL4B 1PZAA 2GC4C 4IDLA 5D4HA 4KQ3H 3S37X 1ST9A 1N18A 3DJSA 5FT3A 5D1XA 3BJ91 3DPBA 2B3IA 4XP5L 3T4YA 5HDQL 1PD21 3QXAB 5HR1A 5AW0B 2WWNA 2WSPA 4FXGC 1NGZA 5TE4L 3WKML 1EHKB 3DUHA 1A3LH 5DRXB 3ARDA 1Z6NA 4YEFA 5T1LA 5ACZB 4PB0L 1MW3A 3R1GL 5B8CC 3CLEH 2ZWYA 5ITFB 3LFLA 1CU4L 4S2SA 1EOGA 4PW4A 5B21A 3FUMA 1AQKH 2L59A 2DOCA 3IA1A 5IM7A 3KJ4B 4L8BB 2OX5A 4F8QA 4M3JA 1NMBL 2ZOUA 4GRWB 1FZKA 1GGBL 3IYLW 1PAMA 3WIFB 1IJNA 1FUNA 4JRXB 1DE4A 3GLAA 2DYPD 2WB1A 2VDMB 3QDAA 1U3NA 4OI7A 3G9BA 2A9CA 1U30A 3R2QA 1ZJAA 2PR4L 2BHFA 1Q72L 4HX1B 5E8DL 2YK1H 3U0PB 3DUSB 4V1DB 2DL9A 3FO1B 1RL1A 4JFFE 1INQB 1USZA 3QQDA 1MAML 2C4FU 3WTTA 4UIMB 4UT6H 3EOTH 1T03H 5IIEA 3AQXA 2Z92A 5C07B 3TEWA 4ADIA 4EI5B 3VURA 1GYCA 2AEOA 1XTLA 1XVQA 1K72A 4JE1A 2IPTL 4PJIB 4GKNB 1I4FA 1ERTA 3FU3A 1CDYA 1THCA 4KXBA 3UL4A 5L2JB 3LKOA 4NQDA 4YO0B 1UZ8A 4TNVF 5JCUA 1RZPA 4IELA 1NLBL 2XPEA 2X1XR 2YANA 4CAGA 1TEFA 3L5WA 4J3TA 3X3GH 4KMTL 4M7KL 2FDBP 4PY8I 5BS0D 1T22B 3ZBMA 5I1AB 3CSJA 4CGUB 5FECB 4FG6D 3QUMB 3RNQB 2GIMA 1V3LA 4NAQA 1S7SB 4LLVB 5KSBF 2MKWA 3D4GA 1PLAA 4WLCA 2ZXQA 3DETC 4X1UA 3HRPA 4LNRA 3MV11 1MF2L 4FO5A 4XRAA 4M7LL 4X7DC 1XV8A 4HJJH 5CEXA 3G6DL 5D9XA 3N06B 4KKLD 1UT2A 2ZCHL 2W0FA 4YVUA 1LLAA 2X1OA 4I0PC 3O6KL 1QTYT 1J0ZA 5ID2B 5DA4A 2AXJA 3AXLB 3ETBJ 4MJCA 3S48A 5EU6B 1FBIH 3D4ZA 3GM0A 2FR4B 15C8L 2VSCA 3V4VL 2AP2A 1BEYH 4G80B 1ZTMA 2BMKA 3MROB 1JWSB 4JG0L 3QIUB 4DKFH 4BDVA 3VDCA 1NCNA 4B9ZA 1RVFH 4FHKA 2IQ9L 5E6SB 1I1FB 4GG8B 2IV9A 3RWHB 3NPSB 2ESVA 4K94C 2WKOA 4Y19A 5EEXA 3FCTA 4OR1A 2VSMB 2A4HA 5I8EA 2Z4QB 1PLBA 4TV3A 4PJDF 3EJZD 1S9KC 3WJMB 4KKAD 2XXFA 1H9DA 4FQLL 3PR8A 1T7YA 4JR9H 1H3UA 2IH3B 3NJLA 1T7XA 4GKLA 5CM1A 4M8VA 5D72L 1EMTH 4WW2B 2GC7C 2G5BA 2OMYB 3AITA 1PSKH 2GTWB 4FQXA 2QQLH 3EH3B 4RGOH 2F2HA 3ARED 5COHA 1DJHA 1U87A 2UZIH 1UM5H 1SY6A 4WO4C 2G9KA 3GHPA 5IOWA 2WB9A 3FQRB 3NAAL 4MJIA 2X53A 3SDXE 4R6UA 4F7MA 3PWJB 4HUUA 4FQHA 1QLFA 5AAMC 3UTSB 1IYHA 2XHFA 5DCGA 2PN5A 4WUKL 2P48B 3L78A 2XOTA 2C3TA 1JE6A 5K9OA 4ZFOA 1LU4A 4KPHL 1HCZA 2H2PD 3MRIB 4G8GA 5G5DB 5HYEA 3V10A 4DEPC 2WAQA 5AVTB 1FYTA 5JMRA 1H8LA 4LO9A 3A2XA 1F9MA 3UDWC 2RIIA 1A4JB 4P4KD 2HT2C 5JTWA 4DSQA 2EDOA 4PSRA 4DP0X 2XFXB 1BLNA 5MENA 3EYSL 1HWHB 5CZVH 3AABA 2EUWA 1RCYA 3GN3A 2PCFA 1MW0A 4TULL 1AGDB 2BZCA 2F53D 1G7HB 1TO5A 2J8OA 1JZRA 5CILL 3BEWA 3BGFC 3F4SA 4M7ZB 5FWGA 1KJ2B 5FCUH 5PAZA 1LO3H 2BSSB 2Q76A 4L9LC 4XVSL 2BY2A 4R7NA 2IIYA 4DVBB 2I9HA 2KQNA 2EO1A 2HJKB 1OY3B 2MTAA 1ZV9A 3QHFL 5I5JA 1JAEA 3X2QB 2R2EA 3WD5L 2UY7A 4O2EA 3LRGA 5D4QA 5D1ZA 2WTRA 3ZKQD 1R4WA 2WINB 1OZUA 3B3BA 1NOFA 3SCMD 3CG8A 2X8GA 2HSYA 4KI5C 4U1JB 2PYED 1VKXA 4N8VA 2XQYA 2UYLA 5HR3A 3MLWH 4XC1H 4U31A 1WFNA 3C5SB 4RETB 4KTEH 1FNSH 1QP1A 4JPSA 2HRLA 2NQCA 5KVGE 4AEIH 4AUJA 4Z76A 3NSFA 2JB5H 3FPYA 4ZB9A 4QT5A 1A3RH 2GFBB 3BWAB 3IU3A 4WZ9A 5L7XH 1SJXA 4E9QA 5IMVA 2XCMC 4OCEA 5A7BA 1F0LA 5CZXC 3L4WA 4NWUL 3QWOA 2V3DA 2ARJA 4KK9D 3O9WD 1HT6A 5EEYA 4BL7A 1G7LA 3W82A 1PA3A 5K39A 3WEXB 3NG5A 4A2MA 5E24E 4JEDA 2PXYC 3F6LA 1XB8A 2SEBA 3EADA 3NQIA 5IEHB 3D34A 1NCBH 4JDVA 1UXMA 1YEKH 1JUFB 4M8UA 3SGJC 3MCLH 5F89B 3ILDA 3DX7B 2G4GA 4KMLB 3VI4F 2QZ5A 4OO4A 4XMKL 1IQDA 5DK0B 3JT2A 2V3EA 3BDBA 3EUDA 2QADB 4POKA 1ZHKA 5FGCE 4LEXH 3ARBD 4WU5B 3KPRB 3SBWC 5D6CA 3K6OA 1BAWA 3P4MA 2KLXA 3W0WD 4WFFD 3CFBB 4S1QH 5GS2H 1JWUB 3L5XL 2B0SH 2YD2A 3UEMA 3DXAD 2ED6A 2XC8A 1Z9SA 1GJUA 3EHBD 5F1KC 2BP3A 2H41A 5TH2A 3DEXA 5HFKA 3M7OA 2AV7B 1QYGH 4PJXB 3TONA 5EZPA 3V5HA 3IWVA 2NY0C 5AVRB 1ILUA 4N8CH 3VFWA 4AVIA 5FO9B 1Q9OB 4QOKD 5M7QA 2AJSL 1ZEAL 2XVGA 3MMEB 5IF0B 2HJFB 3N2JA 4JFQA 2NNCA 2CH8A 2N56A 2CPUA 5F7MC 5FYJE 3VQLA 1R5AA 5J7CC 4I2XE 4F15B 2L7QA 2X4OA 4IOIB 2CHNA 4FTDA 5AAWC 3ECVA 3BP5B 1X44A 4GLRI 1UZGA 2R2BB 1L9QA 1GAFH 5FB8A 4FQIH 3VFMB 1DLFH 4LDCA 4ZFZA 1F2XK 1T1YA 3NIDB 3ZXAC 1IZJA 4XPFH 3V0WH 3FU0A 3IAM2 3F7VB 3PLYA 2F74A 5E9DA 5EBLA 4GW4A 4F2EA 1FAAA 4CDOA 4PS4L 5BCAA 1ZE3H 1YG9A 1ASPA 1OSPH 5C09D 3OG6B 4XCYB 3ZGIA 1P4IH 3C60A 3OAYH 1BQLL 1JZ2A 5L6YL 2DS4A 4F2MB 3KGKA 2WXHA 1RP9A 2IH1A 4JFXA 1YYML 3BCFA 2VW6A 2AGJH 3QXTA 3HVNA 3X1EA 3D39D 4H86A 1EXUA 2YGVA 5B6NA 4RAVA 2X38A 2W95A 3EOAB 1IFRA 3JTBA 3MV7E 3ROLA 1SUJA 4OZHE 3E2HB 3VH8A 3RVXC 2W0PA 4DN3L 2NR6C 2NY3D 2LNTA 2CJUH 3DARA 4TLKA 1HYSC 2X64A 2NW2A 5C0BD 4C4KT 4G8IB 5GGVH 2FSEA 2X10A 3ULAB 5IHUL 4O2CA 4N20A 3D18B 1YPZA 2M8XA 2VLVA 2ISDA 3ARTA 2HXAA 2OULB 3AMLA 1RD6A 1GYWA 4ZW3A 2WIIB 4MCMA 4APQD 3TJEH 4ZDHB 1PLGH 4GSXA 1DYZA 5IPHA 1WAPA 1HEHC 5D5MA 4A04A 3O2VH 3QI9D 1UXSA 4YSCA 2YRLA 1G6RH 4WIQA 1BQHG 3P4NA 3BIKA 1OW0C 4N0FA 3PL6A 2DBLL 4YZWA 1F18A 2VR5A 1Z0NA 2AABL 2I60H 3FQTA 5AALA 1SJ6A 4UZUA 1PX4A 3PP3K 4U1HB 2B3SA 1TENA 3T6WA 4LT7A 1YF0A 4MNNA 4AJ6A 1P6AB 4FL4C 1A64A 1FNAA 1RJYA 4MNGE 4Q2ZB 4B9FA 4AVKA 2ON5A 5JIIA 3PG2A 2APVA 1GKEA 4MYWB 4ALAC 4BFOA 1JMXA 1V7ML 2DIZA 4FD0A 1H6EA 3V5DB 4AY0A 2EEAA 6PCYA 1ZXKA 2O61B 2IWTA 1ZSHA 5JCGA 5IR1A 3ZDXF 2BVYA 4BZYA 3TRXA 1S7TA 1I9EA 4K3DH 4FQUA 2CQ9A 2KQMA 2GZZA 4MABA 4XPGL 3WO3B 3MNZB 4BWWA 3FFCB 3KJ4C 2EUXA 4DWHA 1B4RA 1K6QL 1QSEA 2CUMA 2BSBA 5K33A 4MQSB 1AR1D 4HQQH 1V3JA 4L29A 4M48H 4QRBA 5CJBA 1SXCA 2I9TA 1FW1A 3HKRA 4ZB6A 1KULA 4BYHA 3AQDA 1OTSC 1XAUA 3ARPA 2NLJA 4YAQA 4GT7A 4USSA 1PX8A 2GIYA 4IJIA 2JCWA 3HC3H 3KYAA 3BDYL 4AYMC 3HI5L 4OUUB 2WLIA 4G83A 4OLYL 4PRIE 2BJXA 3KXFA 1TFHA 3UBXA 1L0QA 2R1YB 2AJUH 2DMMA 1NMAH 1FZJB 2SODB 4JRYD 1ML6A 1XIWB 4P2YA 5I1LA 1TU2B 5JQIB 1BFVH 2FQEA 1BD2D 1KB3A 2F58L 1V7NL 1UATA 1NGQH 3E7JA 2Y9RT 2WO4A 4EI5C 1CF1A 2PW2A 5I1DA 4FFVC 5B7FA 2AHEA 2XACC 5DJ6A 1VDGA