3G2MA

Crystal structure of the glycopeptide n-methyltransferase mtfa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
265
structure length
232
Chain Sequence
b'PVRTPHADVLLASVVLCDFYADGTSEAREFATRTGPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERLHVRHLPAEEIQEITIHPADEDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCZA361.24
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
total genus 67
structure length 232
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.40 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2mA02
4BLWA 1R00A 3HVJA 1INLA 4FSXA 4P7GA 4E2ZA 3GXOA 3ELDA 4QVKA 4B17A 2GH1A 5B1SA 1JSXA 4PYJA 3A7DA 4KVZA 5ERGB 1P39A 1NE2A 2NXJA 2ONYA 3M4XA 3GRZA 2F8LA 3JWJA 3VC2A 2PWPA 2YTZA 5DX0A 3GDHA 5FULA 1WZNA 3EVDA 3G8AA 4WVLA 4E2YA 2QE6A 4MHTA 2XYRA 4WXHA 1ZKDA 5CCXA 5LQUA 1MJFA 2HTEA 1P1BA 3PLAE 1XTPA 4AZWA 3C3YA 3D2LA 3KQSA 2QRVB 5BW5A 1YB2A 5EHGA 4OBWA 1KP9A 3EEOA 5E1BA 3OZTA 1WG8A 3BGIA 3SVZA 3OCJA 3B3GA 5GINE 3MTIA 2JG3A 1RJGA 3DULA 1ZQ9A 3PS9A 2C7RA 4V0RA 4CKCA 5EG5A 4OQDA 2GA9A 5C1IA 3TKYA 5F2NA 2NP6A 3CC8A 5GOZA 2ZZKA 5E8JA 2XVAA 1D2HA 2AVNA 4PYLA 5EKUA 1R8YA 2OXTA 4R6XA 2HNKA 3UJ6A 1R18A 1RJEA 4HSGA 4GOOD 5DTQA 3UA4A 5HIIA 5LQJA 1ORIA 2ZWVA 3ANXA 4FR0A 5CVUA 1Q0SA 3DTNA 3B7PA 1TW2A 2ZWAA 4PGHA 2ORED 5EEHA 4DM3A 4E70A 4ER7A 1RJDA 4RSRA 5D1NA 5KYGA 2YXEA 5T64A 4YUXA 2BH2A 5K0CA 3QOWA 1B42A 3FUVA 3C6MA 3EVAA 3AXTA 3OFJA 4X63A 2AZTA 5GM1A 3TRKA 5M5BA 1RI1A 5GIOE 4AUKA 2V7EA 3BZBA 3LL7A 2IDJA 2PXCA 5DRTA 5E9QA 5K03A 3BWYA 3PFGA 2P35A 3TOSA 2WA2A 5JUWA 1VLMA 3GGDA 4OX9Y 3I9FA 5IKMA 1ORHA 4QTUB 3G2QA 4C06A 3ER9A 5MHTA 1HNNA 2K4MA 4JXJA 1RI4A 1NW8A 2VS1A 4POOA 3NTVA 3M6XA 3PT9A 3KR9A 5LQKA 4KRGA 3AWIA 3CKKA 5EKXA 3DLCA 3KQOA 5FA8A 3LPMA 2E5WA 4CWAA 4R6WA 3GRYA 2VDWA 5E2AA 2Z6QA 2PWYA 3EMDA 3FTFA 4KIGA 5LQNA 3EVZA 2IFTA 3DP7A 1VL5A 3P9CA 1I1NA 2FRXA 1G8SA 4AZTA 2CWWA 3G7UA 1BHJA 1X1BA 3UJDA 2AOWA 4MQ4A 4XUDA 4Y2HA 5F2KA 2AS0A 5E1MA 5LQAA 1VP3A 2BR3A 2P7IA 1F38A 4FT2A 2IBSA 3FPFA 2Z6UA 1KR5A 2GB4A 5E1OA 1SQFA 4RTQA 5K0JA 3GWZA 2JH8A 3JWHA 3EVGA 4DCGA 3G88A 1XDSA 4QDJA 1NBHA 2EJUA 3O31A 4RTMA 4IKPA 3FPEA 1FP2A 1IM8A 3NWBA 4V0QA 1L3CA 3E8SA 3P9KA 1EQAA 2P3OA 3TKAA 3VSEA 5E8RA 2G8NA 4CKEA 2I6GA 4QQKA 4X1OA 4HC4A 1TPYA 3HCAA 5FHRA 2PX4A 2PY6A 2NXCA 1ZG3A 2CL5A 5DXJA 3UBTA 2Q41A 1YFLA 4DMGA 4RVFA 3UJCA 5DM4A 5ICEA 3QV2A 2UYCA 1X1AA 2NYUA 3UJ8A 2AR0A 5EEGA 3NJRA 4GC9A 2ZULA 3R0QA 2G1PA 1WS6A 2OB1A 4HTFB 4PYNA 3EVBA 2O07A 3UJ9A 2AOUA 2OZVA 3MERA 3GRUA 3SSMA 2BR5A 4EK9A 3FZGA 3E05A 3LDGA 2P8JA 3P2IA 4ER5A 5CCBA 2DULA 4C04A 3EMBA 2O05A 3VYWA 3A4TA 3DLIA 1UWVA 2GS9A 3G2PA 3FUWA 3U81A 4YUZA 4IWNA 5EMJA 3UJAA 2YX1A 1SKMA 1O9GA 4DF3A 3TFWA 4PONA 1N7JA 3BUSA 5HZMA 1NW3A 2AOTA 4KDRA 3CVOA 3A26A 3HCDA 1FP1D 2EX4A 2V74B 1JR4A 2YVLA 3BWMA 3ME5A 4LWPA 3EGEA 2NXNA 5DLYA 5DXAA 3TMAA 5F2OA 3IYLW 2PBFA 4ATNA 2B78A 3HNRA 5IH3A 5HIMA 1YF3A 1NT2A 2PJDA 3EVEA 3H2BA 1JG2A 3BKWA 3KQWA 3LCCA 5EMMA 5FQNA 4YUYA 2ZFUA 5KQSA 3KR2A 2KW5A 4C08A 2ZBQA 4PYQA 2ZCJA 4FT4A 2EG5A 1JQ3A 1VIDA 1YUBA 3P9IA 4PYMA 2PXXA 3R3HA 3LECA 4PCAA 4PYOA 3SSOA 4PCLA 4ZTBA 4DZRA 3AY0A 1I9GA 1DCTA 3DH0A 5E2BA 3SX0A 1ZGAA 4BLUA 3X0DA 2ONZA 3EPPA 3FPHA 5DRYA 4GOLD 1AQIA 4FS8A 4MTLA 2ADMA 1XCJA 2BM9A 4E33A 4OA8A 2BZGA 5EQJB 4GUAA 4X41A 3TPZA 2OY0A 5CD1A 2JHCA 2IBTA 1VBFA 5EMLA 3B3FA 4R05A 5DTRA 1BC5A 7MHTA 4EKIA 3REOA 2ZIEA 3KQTA 3CGGA 1JG3A 2ZLBA 3KPVA 4GC5A 3FRHA 4RTRA 8MHTA 2QYOA 4H0NA 2IGTA 3PB3A 1DL5A 2FCAA 4A6EA 2YR0A 3BWCA 2PT9A 3THSA 4BLVA 2ZW9A 2VZ9A 2YXDA 1JTEA 1RI2A 1IXKA 1VE3A 3OU6A 3IV6A 1WY7A 4FZVA 1M6EX 4L7VA 1D2CA 3SR4A 3TQSA 3UFBA 4E2WA 3LDUA 1NW6A 5HIKA 1L3IA 3KQVA 4DCMA 4YV1A 1AV6A 4YV0A 4KIFA 1QZZA 5HIJA 4O29A 2AN3A 1Z3CA 2UYHA 3HCCA 2UZ4A 2ESRA 4K6MA 5CVDA 3FRIA 2IH4A 5DM0A 2IH5A 3EVCA 4CTKA 5K0BA 4IV0A 4XUEA 5U4XA 5BP7A 5K09A 4YMGA 2AOUB 3MHTA 2O0LA 4OA5A 1R74A 4RVGA 5DM2A 5C9ZA 3L8DA 1KHHA 3LKZA 3SXJA 2P40A 3B3JA 3OU7A 5LQCA 2YXLA 4IV8A 4GQBA 3Q87B 4XUCA 3UWPA 3ELUA 1D2GA 5EZQA 4BP1A 2PGXA 5LSAA 4Z2YA 3M6VA 4KDCA 3PTAA 2ERCA 1U2ZA 2YUIA 4DKJA 1N7IA 2ZSUA 3K6RA 3KPUA 3LKDA 5EC8A 3SMQA 2YQZA 3HA7A 3WSTA 1BKYA 3M33A 1PJZA 3HA5A 3GCZA 3MGGA 1RJFA 4GF5A 1BOOA 4RTSA 4QPNA 1FPQA 1F3LA 3FTCA 3KKZA 3FTDA 4PWYA 2Y1WA 1G6Q1 3E23A 3EEYA 3EGVA 5FUBA 4AZVA 3Q7EA 4U7PB 2ZZNA 3KQQA 2GAFA 1Y8CA 2OBFA 4PIPA 5KQRA 4OQEA 1G55A 2B25A 2H1RA 2QRVA 5DM1A 2O06A 1FJXA 4RVHA 4QPPA 1JSZA 3ELWA 4AZSA 1MHTA 3HVKA 3LSTA 3GO4A 5T67A 2FYTA 2ZIFA 1VQ1A 4YMHA 3BWBA 2ZIGA 1RI5A 2DPMA 3JWIA 2O57A 3LDFA 3P8ZA 3RIEA 3MTEA 2OYRA 5DSXA 3FUTA 4RTPA 3A25A 2B9EA 2ZZMA 2IP2A 3M6UA 4RV9A 2PX8A 3KPYA 4RYLA 2JJQA 4C03A 10MHA 1KYWA 3GRVA 1SUIA 3ER8A 1FBNA 2C7QA 1JG4A 4M37A 2PLWA 1QAMA 3O4FA 3HTXA 3RW9A 3LBYA 3SM3A 4GBED 3GU3A 5HILA 2ZBPA 1OR8A 1QAQA 1UIRA 4CKBA 1R8XA 3PFHA 4G56A 4LWOA 3G5TA 3F4KA 1YFJA 4DQ0A 2CKDA 4FGZA 4LG1A 4EQZA 2XYVA 1JTFA 2ZBRA 4E30A 3IEIA 1NKVA 2AN5A 5ICGA 4R8RA 1HMYA 3BT7A 3P2KA 2XVMA 4CTJA 3DXZA 4F85A 4QVGA 1Q0TA 5EGSA 1DUSA 1PRYA 4X60A 1KPIA 2ZTHA 1TW3A 4RVDA 5FQOA 5T6BA 3DMHA 4EKGA 1ZGJA 4CXMA 3G2OA 1XJ5A 3HA3A 5CVEA 5DX1A 2FPOA 3CJTA 1QAOA 5KS2A 2P1DA 5LQRA 3O7WA 3T7TA 2IDKA 5DTMA 2FK7A 2HR1A 5K0FA 3GNLA 3G2MA 2UYQA 4RTOA 3BXOA 3LHDA 1JG1A 2Z6AA 1L1EA 1WXXA 1M0EA 3R6TA 1O9HA 4C05A 3TR6A 1SQGA 3AXSA 3DXXA 2P7HA 2B3TA 2R6ZA 3MCZA 4KWCA 2C7PA 2H00A 4FP9A 3CJRA 1IY9A 3P97A 5HOQA 5ICCA 2JHAA 3TLJA 1QANA 1AQJA 1YZ3A 3KPJA 3NVKI 2EFJA 2IIPA 3NW9A 5EIFA 3MAGA 1JQDA 4OBXA 3NWEA 1X19A 3CBGA 3CJQA 5H02A 4F84A 5FWAA 3HM2A 2WA1A 2H11A 5BW4A 1G38A 3TM4A 4UOEA 1I4WA 2AOXA 1XCLA 3KPWA 4RX1A 5E9JA 1EAMA 4DA4A 1EIZA 3HP7A 3OU2A 3FTEA 5E9WA 2FK8A 3GIWA 3R9XB 5E1DA 4QDKA 5CVVA 5DSTA 2PX2A 1G8AA 3LCUA 5DT2A 5FADA 4PGGA 1R6AA 3HCBA 5GP1A 4EVIA 5K8VA 2OPBA 4GEKA 2I9KA 4QQNA 4U7TB 2JH9A 1EJ0A 3T0IA 5EOVA 3CCFA 4M38A 3HCFA 2WK1A 3DOUA 3C6KA 1XXLA 5CUQA 2IPXA 3HVIA 3UZUA 2I62A 3A7EA 5K0GA 1UFKA 3LCVB 2UYOA 4AX8A 2XBMA 4HTFA 2N47A 4ER3A 1RI3A 5EMKA 4E2XA 3A27A 1X1DA 4PNEA 4YV2A 1KPGA 4KW7A 1NW5A 2FHPA 4HGYA 5HFJA 2G71A 2OB2A 3I64A 3T7RA 2HV9A 1KIAA 4EMSA 1YZHA 3I58A 2Y1XA 4FSDA 3ERCA 2NNWB 2GPYA 3S68A 3C3PA 2XYQA 3OPNA 4ISCA 3PX2A 4A6DA 3KHKA 4P7FA 2B2CA 2PSSA 2LD4A 1L9KA 3DXYA 3HEMA 3R24A 4GOND 3UJBA 5ICFA 2P3LA 3FPJA 2VDVE 4E32A 1KYZA 1L3BA 2BM8A 5K0LA 1SVUA 2QM3A 3DR5A 1V39A 3FYCA 4XCXA 3UA3A 1KPHA 3C0KA 3NDJA 2ZVJA 4QTTB 3OE4A 1NBIA 4RWZA 3KQYA 4PINA 5EPEA 2CMHA 2OO3A 3T7SA 3ID6C 2AOTB 1XDZA 2CMGA 3GRRA 4YUVA 3PX3A 4P58A 1XVAA 2NXEA 4C07A 3ELYA 3LX6A 1M6YA 3IHTA 1AF7A 3I53A 4RTLA 3B89A 2PV0A 3KR0A 4Y30A 5EVJA 5LR6A 3FUXA 1N2XA 3GJYA 5GWXA 3NVMB 3P2EA 1NW7A 4P7KA 5DX8A 5D1HA 1G60A 2PX5A 2PXAA 3G5LA 5K0EA 1SG9A 3EGIA 5GM2A 5EZSA 3DUWA 5EHIA 4RTJA 3P71T 1O54A 3KQMA 3JWGA 3RODA 4BY9E 5KVAA 3FPGA 4LECA 2G72A 4PYIA 3V8VA 3ORHA 1P1CA 2BR4A 5BXYA 4C4AA 2R3SA 3G8BA 2AVDA 4GOMD 4M7RA 5FHQA 3OE5A 3SGLA 2G70A 3LBFA 3BGDA 4HH4A 5DPMA 4E31A 1X1CA 3BGVA 5FTWA 5FCDA 3NMUF 4RTNA 3HCEA 2EJTA 5P8WA 3NDIA 3LGAA 4NECA 3EVFA 3FYDA 3OZRA 5DWQA 3M6WA 1XDUA 3V97A 2P41A 3M70A 3PVCA 5FWDA 3THRA 2HMYB 5GIPE 3B5IA 5CVJA 5G02A 5K0NA 3SSNA 1H1DA 4R8SA 3MCTA 2I7CA 1EG2A 4M36A 3DMFA 2P3QA 4HG2A 4PIMA 4HGZA 1QYRA 2AN4A 2PKWA 2HWKA 3E7PA 3MB5A 3MQ2A 5CIYA 1JQEA 4ER0A 2A14A 4HRAA 2GLUA 3KU1A 2QY6A 1KXZA 5JR3A 1EJ6A 2VP3A 3QOXA 1VPTA 3OZSA 3HVHA 3TM5A 3AJDA 2PVCA 1ZHFA 2JHPA 1NV8A 3BKXA 3P9NA 3OFKA 1T43A 2VDUE 3K0BA 5K05A 2PT6A 4MWZA 5C0OE 4PYKA 5EIWA 2OKCA 2C7OA 4MIKA 2AOVA 1SUSA 4ER6A 9MHTA 1NV9A 4F86A 2IH2A 1P91A 4P7JA 4X61A 4BP3A 5HEKA 2NP7A 3G89A 3I5UA 3VC1A 5K01A 4RTKA 3KR1A 3FUUA 3UJ7A 1VP9A 3KQPA 1WXWA 5FA5A 4YUWA 3DMGA 5CM2Z
chains in the Genus database with same CATH superfamily
5HJ5A 4M0FA 3GN1A 1INLA 1BMFA 3PGKA 5COQA 1B0UA 4E2ZA 1CU1A 4UBKA 3HYTA 1T8TA 4E3WA 2Q9UA 1SC1A 1T8SA 2WIAA 3JRWA 1Z0KA 3WO1A 2VIIA 4OMFG 4FSHA 2P1ZA 2G9NA 3U80A 5ERGB 4NFLA 5CFMA 2J5BA 3EXEA 4UAVA 4HQKA 2DH5A 4H7DA 1QGAA 5U4QA 3V46A 3VC2A 5KINB 3QE9Y 3OCXA 3GDHA 2WIFA 3GMDA 1CUWA 3G8AA 1E5LA 1R4NB 4E4RA 5JT1A 1KVSA 1YJCA 3QTTA 2NO1A 3AHJA 2HU2A 1P7PA 2C3UA 3D3JA 3IVMA 1BRMA 4HNRA 4QQFA 4HF7A 4Z1MA 2FWRA 4TOIA 1NRJB 1OE0A 1EP9A 3WLKX 4FGJA 1B74A 2IITA 4QYXA 5D3KA 4HQFA 1EUZA 1KI6B 1YDGA 3C8ZA 1M74A 2PNFA 1WB4A 3L49A 2ZBGA 3OCJA 4JBLA 5F51A 3TXYA 4D8UA 5HTKA 4O4HA 4R4JA 5BOVA 2X5XA 3AX6A 4RJKA 1QCZA 2I2CA 1JHYA 4EPYA 3BS4A 1YA8A 1AC5A 2KLBA 1BNCA 2D06A 4PLHA 4EZBA 2XMPA 1D2HA 5EKUA 3RKUA 4AKTA 3KOYA 3LGXA 1SOMA 1T8PA 2WLTA 4FYXA 4CU5A 4UQLA 3EODA 4RK6A 5KC8A 2TECE 1D6SA 2P4HX 4M6WA 2OK7A 3BTVA 2GD2A 3KB8A 3PIDA 1T1JA 5K0CA 1B42A 2GM5A 2JLVA 3OHMA 1DXHA 2WNHA 4JLUA 1Z6ZA 4C3OB 2AQ8A 3BMXA 5D5PA 4BCDA 1B15A 2AZDA 2RG1A 5K7SA 1CUSA 3FYSA 1ZI8A 4MO9A 4PX9A 4LBZA 1JDBB 2QTAA 3FLBA 5E9QA 3PFGA 3TR0A 4N5NA 3VI3B 3FGOA 5CFPA 1H6BA 5K03A 1WBDA 4PIVA 4QDXA 2P35A 2JLSA 2HU5A 1AQLA 3AWDA 4XCVA 4URVR 1FNSA 1TF2A 5FBQB 3PC8C 3BXXA 4FONA 1M73E 2XD4A 4OGKA 1K3TA 1NW8A 3DZJA 1XMSA 2E89A 4EY8A 4POOA 1XD2A 3CSSA 4PHCA 1P29A 3AUYA 1QHYA 3T7JA 1YRAA 2JJMA 5ARDA 3F7OA 1Z6GA 3EZ7A 3ZKAA 4DTIA 4G0XA 3IS3A 4M0DA 2IQ5A 5K3CA 3WBKA 1JEYA 3W79A 4CG2A 3DP7A 4YAGA 4BUZA 4ESOA 3B5JA 4YP1A 3L8YA 4HV4A 1NX9A 1C9KA 4GBMA 2ZRKA 2FH5B 1ULHA 4UULA 1R0ZA 4FFBB 1S7CA 1RHKA 5KYXB 1SKBA 1RMQA 2X0FA 1HT0A 1BGXT 1L7AA 3L6EA 2VZEA 3QPDA 3FPFA 4N0QA 1EDDA 1KR5A 1QTQA 3IOYA 5ER9A 4MGHA 3U16A 3GA0A 1NBHA 2M2IA 4YBRA 3FPEA 5AJZA 5HXAA 4BGIA 2HF2A 4KVGA 221PA 1SQ6A 2KX7A 2QQFA 2WF7A 3BSFA 4MKIA 4QT4A 1CY4A 1WKBA 2JA2A 2JGJA 4XARA 3RUAA 4GXQA 3OZIA 3HCRA 4JQYA 2AXQA 4Z0TA 4ZCPA 3GFSA 5DXJA 1TAGA 5G0TA 5ADHA 3OBBA 2RHDA 3MLEA 5DM4A 3RU3A 1NQXA 2R4UA 2IK8A 2W6QA 3LHKA 1H2RS 2NYUA 3NHSA 1C9MA 1ECBA 1UCFA 4OQLA 3KVYA 3HDYA 4XGKA 4YCBA 1XRQA 1F06A 4LX8A 1KZYC 4P4GA 2WWYA 1KEWA 2CZQA 5JSZA 5L4LA 1SXPA 4Y0NA 2D1RA 1VLVA 3BD7A 4R2IA 2BR5A 4D4KA 1KJ8A 4OLBA 4IR7A 2J6IA 3GLFA 1XKTA 1B4DA 3Q0TA 1XBTA 4ER5A 1I6KA 5CCBA 1RQRA 3D3KA 4RHTA 1RWVA 4I6EA 1NOKA 1YXMA 1YCHA 2H57A 4M1QA 3RJ5A 4IO1A 4YXWA 3DZDA 5IKXA 1J2UA 1J07A 1I5EA 1HYHA 3CEAA 3G8DA 5IHPA 2FSHA 4KIWA 1FTWA 2V65A 3H7IA 1N75A 3DFKA 2DG2A 1G7TA 2NVUA 3ODGA 5JAQA 3LPAA 3A26A 2HXSA 1JX6A 1ZJ4A 2ZSKA 1HE8B 4RDHA 1T5HX 2HFKA 3ADOA 1NNLA 1I2CA 4KNYA 2BEJA 3KX2A 4LJYA 3IQIX 4BNIA 4HWOA 2VXBA 4E22A 2GXSA 1ZHHA 1RCUA 1ZXXA 2YY6A 4MUFA 1TDJA 1IK4A 2ZTVA 1BS9A 3NOXA 2Z5FA 4JVLA 2WQ7A 1L8AA 4CT0A 2ID8A 2PZLA 5CA1F 1M5UA 2TSYB 3TD6A 4C08A 3F73A 2HJHA 5E9AA 2VDJA 3TX2A 1L5FA 5AOCA 3P9IA 5IASA 2CDRA 3OJXA 3CVYA 4EABA 2EF0A 2QRJA 3DDZX 4GM0A 5JLJA 1OV6A 1IZ7A 2A67A 2H7YA 2B5WA 5TPWB 4LXTA 3M7IA 3TCNA 3ETEA 3FPHA 1NASA 1JLKA 2PAAA 3FUCA 1CQJA 1UPTA 1W5AA 3K4HA 2J6BA 2YWBA 3KZ1E 1O5OA 1EDOA 3CY6A 3AFMA 4I50B 3MTAA 4Q1EA 5CHEA 4BV3A 4D56A 4G5SA 5EQJB 4G5OA 1KH1A 4MVJP 3EZGA 1TJ5A 3C43A 3I32A 2P9CA 1K9SA 4PZYA 4C2AA 5EE1A 4KBGA 1IY8A 1ILEA 1BA3A 4TYWA 1JR6A 1OFVA 4DCSA 1CQWA 4FNMA 1HKHA 5TARA 4JXXA 1FLDA 4J4HA 4KOEC 4DC9A 3H5AA 1BVUA 4GC5A 4K40A 5FO1A 2OXIA 2G7MC 3A2NA 2XT9A 4DIEA 1W49A 2GD6A 3AUJB 2CF6A 3MJVA 5NLLA 4B7UA 5BNTA 5KDDA 3VR4H 5AVXA 1IZYA 2R751 2YXDA 1QZ3A 3E3OA 2CB9A 3RVJA 3B9RA 2Q3HA 3ZWWA 2ZYDA 3HLYA 1E2HA 1JB9A 1GLGA 3EMVA 5CCEA 5TGZA 2WT8A 4M1KA 2QUIA 2XV1A 3P9RA 4RD3A 3J7AC 1HM5A 3LC2O 4ARAA 4P7BA 1DZIA 5HIJA 4JMLA 5CTJA 4TSKA 3SEAA 4Y1EA 3DE7X 2CJFA 3U3KA 1J5EB 2FXIA 3OETA 1T8UA 4RMJA 4EUNA 1HR0B 1XCMA 5B6IA 2X4LA 4RHFA 5BN4A 1ST2A 4M1TA 3TJRA 1QO0A 1E1YA 3GLGB 3WHLA 1CC1S 3B70A 1WB5A 1A9XB 3PDJA 4BP9A 5BVGB 3LC1O 4L08A 3LS2A 3B3JA 3EULA 2YXLA 2ATEA 2OHVA 3OT4A 4F04A 1ZMXA 1XQVA 5EZQA 1EFLA 2I4OA 1G4AE 1GSHA 1YDHA 2J31A 4G8BA 3FWNA 2PSJA 3HEBA 4Q9DA 1SFRA 2VZLA 3E0QA 4YJHA 1VTKA 3BXGA 3ZV3A 5BMOA 3EPHA 1HDZA 1NM5C 2R1UA 3NHLA 4O4JA 3FIUA 3PX7A 3ZE8A 3ZWAA 4CMBA 3KXDA 3ZHZA 3BD8A 1ZM7A 4OQYA 1X2BA 5F5XA 4QOEA 4RIGA 1G6Q1 4RE6A 1DRKA 4L78A 3CF0A 4RESA 2AJCA 1RYMA 4JAVC 4DYHA 3H17A 1MOZA 5AKIA 1KNQA 1WPQA 1SG6A 4N41A 1NXPA 2ZIXB 5TF4A 4MW7A 2EX0A 3EISA 1UBGA 3FF4A 3IP6A 3ROXA 4E1AA 5BSWA 1RI5A 2H3EA 4JLNA 4NFYA 2VUHB 3QPUA 2HJVA 3RLFA 3KKPA 4B75A 1KQPA 1SIOA 3DZGA 1GZ3A 1UQRA 3JD0A 1PTKA 1F4LA 1Q3KA 3M6UA 4OFBA 1E6KA 4MI6A 4KQ1A 1GU1A 5BUSA 1PFKA 1XI2A 3MZ0A 5KSPA 4XIJA 4Z4FA 2CXPA 1HFEL 1Z25A 3H1PA 4HUJA 3KSMA 5AW9A 4W5OA 3F4LA 3RW9A 3NV7A 1I1HA 1R6VA 3E4CA 2OBYA 1G21E 3ABSB 1NPTO 2HPAA 1XTIA 3SS9X 4J1TA 2JAQA 4F3NA 1EXDA 1MQ8B 1XZJA 4E51A 5LIPA 3P4UA 2CKDA 3FETA 4FGZA 1SUWA 1UJ5A 2WFMA 3BJEA 4ITUA 4ARBA 1V95A 2DT5A 4DQKA 2C88A 2Z43A 3B48A 3WK8A 3PJGA 2D3WA 3JASB 3G2KA 2EAUA 3H9BA 1UBKS 4NBTA 5G0SA 3H9EO 3KQNA 5JAUA 5JSQA 4P31A 5EJAA 2YWJA 5F5NA 3UMRA 2PMCA 4OB6A 1G291 5DGDA 5ALXA 2D7JA 1UJMA 1MC5A 5I5EA 3O5AA 3MTJA 4LKOA 3FDIA 5HR5A 4WBNB 3ABIA 2WJYA 1UMCB 2GK4A 2HR1A 2QN9A 1SBIA 3HYLA 3I0ZA 4AY6A 5A4DA 2GRUA 3FLEA 4A5OA 1GGVA 2ST1A 3ZGVA 1CIVA 4D8WA 1QDEA 3B36A 4FU0A 5G0VA 4UEKA 1PHRA 3SXUA 2FXVA 3TR6A 3QSYA 4EPRA 3DXXA 1ZFIA 3GEBA 3L4BC 1T0BA 3UXHA 4DRXA 2EWVA 5H3CA 2PKQP 4P2BA 4X7BA 2XADA 1IXYA 2VK2A 4EQ6B 5C46F 2ZUVA 1AQJA 2VO1A 5EESA 1J7JA 1W4BA 3ABRB 2IIPA 2MCFA 4E5VA 5A9SB 3K9LA 4XWTA 1MB3A 5L3RA 3O6VA 3ROFA 3RR2A 3HMQA 3TLBA 2CBZA 1TIKA 1V26A 1Z06A 2D59A 1ZK1A 2ISCA 4UAJA 5D5HA 5TXGA 1MJGM 1GCUA 5BRAA 2H11A 5KVSA 3TM4A 3OG9A 4YRNA 4AF6A 3ZCQA 5IXSA 4YMUA 3OPQA 3TLGA 1B6GA 4YIKA 2F59A 1NPYA 4KQEA 2C78A 1OLXB 4HXEB 2IIVA 1EGQA 2WE7A 2ZAGA 2B1QA 4YP5A 3ZV7A 1V3QE 4LF8B 4DIDA 1R9NA 4MZXA 1R6AA 5FF9A 4EMBA 4JOSA 1J1ZA 2V0GA 1MTOA 1OFGA 1S01A 5IDQA 5LZ4A 1IMOA 5EOVA 4WZAA 4AQ7A 2ABZC 1X7YB 2DGDA 4HX5A 5IUJC 4OXIA 1DQNA 2VNSA 4BDTA 2WZBA 2DQKA 2RAFA 1DBPA 4WBSA 3IBFA 2XEDA 1E62A 2P9TA 5HF6A 3LA6A 3UCXA 2GD0A 5EMKA 3ZNPA 2C5EA 5M34A 1MQ9A 1NMEA 3Q2KA 4L7QA 4CQNA 2D8MA 4NBVA 4D9GA 4HNQA 2F1IA 1L8LA 2OCLA 3AL2A 4HGYA 4PLVA 3A06A 3DO6A 1C29B 3UHPA 3VV3A 4EG3A 2AJTA 1POXA 1ECJA 3JQ7A 1BAPA 5B7NA 2B0JA 3S68A 1JB1A 1AGYA 1U9ZA 3A0RB 4IJVA 5FBLB 5KNLA 2R6HA 2E2WA 2JZNA 2P5UA 3AJAA 1B1AA 4IH4A 4CQLB 4E08A 4P0QB 5HGJA 4KXFB 1RWQA 5JH7B 1QQBA 3E61A 2ZXFA 1NATA 2PT7A 4P0PB 1ACMA 2BM8A 2OENG 1ZD9A 4JP3A 1MXFA 2XMCA 3IR7A 1EZ1A 5GZ1A 4RA6B 1C3JA 2CJWA 1MAVA 4QTTB 5L40A 3OE4A 4Y2JA 3RREA 1G17A 1UM9B 1E3TA 2CNWD 3KEOA 4Z6KA 5EUQB 5GONF 5IAKA 2I7DA 5FNZA 4HN2A 4B7CA 2AX3A 2LDXA 1ZX1A 5H9VA 2FPRA 4DIFA 1EVJA 4U2CA 1EGMB 4CUKA 2R8OA 4U5QA 2KBFA 4JJ4A 4IIBA 2QVCA 3R7AA 3RBAA 3W1VA 1KAMA 4HDAA 3RC8A 2NAPA 1SCIA 1JEJA 2VRCA 3MWDB 3O73A 1G8FA 2XQGA 5GM2A 2ZRIA 4D97A 3NT2A 2EL7A 3INTA 3CWQA 3SLRA 1VIMA 3OEEA 4K3UA 1RBZA 3PA8A 4AMZA 4GPEA 4MQ5A 4FJ1A 3EAQA 3STVA 3UC9A 4DCTA 2A9JA 2HLDD 4IJUA 3LVBA 4X91A 1UBNA 2GNAA 3IEXA 2QZJA 3LBFA 4AJHA 4I1RA 4S24A 821PA 5KWIA 1ZMOA 4RFVA 3RPEA 1JSLA 1XLUA 4KX5A 2IVZA 3FNRA 1JXAA 1IEVA 1T5DX 3FR7A 1CUYA 3PFNA 2BEVB 5JJCA 1FRFS 3LDAA 2YZ7A 3HABA 2OCDA 5EP1A 4J16A 4M8SA 4W5NA 4QXMA 5EKSA 2TMGA 2QBYA 3HHPA 3U6KA 3PFIA 4NZNA 1R4MB 1JKFA 3ITEA 4OAPA 3FYTA 3B5IA 1QG0A 1AK2A 2XW6A 5G02A 1HNWB 4CL3A 2HSZA 1L4KA 2R25B 4MVJI 5L51A 2B1RA 2M1XA 1FP6A 4OK3A 5IN5A 4BFTA 1UZUA 5JNVA 3RSCA 1PG2A 2QLLA 1N1GA 2AN4A 3QBVA 4M60A 1U2TA 4QLBA 4LJ9A 2F17A 1X1SA 2CHUA 3K0AB 4L2IB 3WISA 3MRXA 1DDIA 2PANA 1PLJA 2RGNA 4QQ8A 4KPEC 4FFRA 3R5TA 2R5FA 4BU0A 1EJ6A 1JHZA 2Z6VA 4CIXA 4U2FA 2QW0X 2XHEA 3A6DA 1WZ2A 1ECCA 3JX9A 4WMLA 1YUMA 5GWXA 2EL9A 4O5AA 2JJ1A 1BXKA 3H6KA 2O0JA 1STOA 1CNEA 1F0PA 3EASA 3HFGA 5GONA 5U1PA 5TQ0B 3FOZA 5AUQA 1TECE 5ALYA 1TFRA 3AVQA 1ADYA 5FJJA 1OTHA 4YB8A 2OYSA 5EHNA 1OYWA 3W3ZB 1JI0A 2CHQA 4JLMA 2HHAA 3DB1A 2YZKA 3EUAA 1Z62A 3K4QA 4M0LA 4QVKA 1V48A 4NCBA 3WGQA 1W36D 4UEJA 3G0CA 1AXGA 5B3JC 1IOWA 2JLBA 2PLNA 2VBIA 4PYJA 2BFDA 5LKAA 4KVZA 2RHJA 4EA7A 1OZAA 1SOWA 3KKQA 5B5SA 4ZJZA 3WGZA 3SZRA 5ITSA 2L17A 5ALWA 1SKUA 1O0BA 2DOKA 3DAOA 4Y6OA 1FFCA 3K0CA 1CUFA 2QE6A 1NUPA 2B4YA 4HAVA 2R79A 3N6VA 5IKOA 4KACA 4DLBA 1T10A 1IZZA 2HTEA 2QN8A 3EZNA 4MWBA 3R6LA 5DKFA 2O2IA 4MPTA 3RYHA 3VZSA 2UXCB 3IXLA 3O8QA 4PV7A 4ZA2A 3HKDA 5K9ZA 3LWDA 3TJMA 5CT5A 1J5PA 3LDHA 3OEWA 2B34A 2BZ0A 4WFIA 3H4MA 4QNNA 3SFZA 5HUHA 2WP0A 1CDDA 3SPXA 4IO0A 4E88A 4QL3A 1H66A 1HUQA 2IYQA 1ENOA 3PHCA 4V24A 5B2FA 3EVNA 4UDOA 2GA9A 3TKYA 3ZDZB 2FSVC 1NKTA 1JFVA 3H2SA 1S2NA 4PSCA 4ZZ3A 3C87A 4NENA 3A3KA 4KO4S 3AR3A 5ENVA 3W5SA 1RJEA 4DIUA 3OT1B 3AUSA 3KDPA 1YA4A 3AEUA 1I7DA 5FTMA 1E0AA 1IOZA 3EJ6A 2QVYX 1U0EA 3T41A 4PGAA 3ND8A 1PN3A 2Q8QA 4ZPJA 5EQFA 3L0PA 3B7PA 1TW2A 1VKHA 2HCRA 4ZVOA 1YH3A 4UARA 3W2IA 4CMGA 4GPZA 5K4GA 5EEHA 4E70A 4R54A 3ILVA 4K2HA 1K0FA 1CR1A 5JXGA 1XPJA 2ZANA 4HEA6 1J8DA 3PRHA 3AEKA 4ZT3A 3T35A 4DFDA 4XQEA 3COPA 3KJGA 5A6SA 4LSZA 3W5HA 5KIAA 1KORA 2J1LA 4EI2A 3CF6R 1VRVA 4MQUA 3OTOB 1R15A 1I24A 4HNSA 4K9RA 1XZLA 4NZMA 4LY3A 4NZYA 4ZCQA 4R68A 5HM6A 4OPMA 1I7SB 4GVLA 1S1CA 4PFSA 4JI2B 1FFGA 1ORHA 3EDYA 1FPMA 1P17A 1T9DA 3DWEX 4JY7A 1HNNA 4HPXB 4K9NA 4PBRA 1WO8A 2YOFA 4X7RA 1BGWA 1MX5A 1D07A 2D1FA 4PTLA 3HRKA 3OZXA 2H7VA 2E0IA 7YASA 3BGSA 1KBQA 1Z5PA 4TL7A 1T3GA 4P4NA 3UAVA 5IMSA 1J39A 1OROA 3NG1A 4FFWA 2Q5LA 4ND5A 4HB3A 2E5WA 4EATA 1L5OA 2VDWA 4YFVA 1GL9B 5ERYA 5LQNA 2ZDHA 3OT5A 4MLDA 2YFHA 1HDXA 4UBMA 4LYDA 1GTG1 2VCYA 1JIXA 2WWGA 3BZWA 4PN3A 4W9NC 1A95A 4LDNA 4BNNA 4B6QA 1PU2A 1U6IA 1HQYE 3DOOA 2P9BA 3HKEB 1XEXA 3K0HA 4LWQA 4PBSA 4FE7A 2IV2X 3RVOA 3UOGA 3VTFA 5F9MA 4ASUD 8AT1A 3G1TA 3N59A 3BK1A 4AAYA 3R5JA 4JCCA 3HUFA 3BIXA 4J07A 3DOJA 4Y8VA 2JGDB 3AR6A 4GOJA 3JWHA 2ZE5A 4A0GA 4XJXA 3QWAA 4TTSA 1XMXA 2EJUA 2BISA 3RSGA 3MAAC 2JJYA 4FOOA 1L3CA 1OHHA 1OYOA 1ORDA 1T2NA 1TX4B 2QX9A 3D1JA 2I6GA 4KUHA 3IPXA 4MDYA 2C4HA 5FHRA 1PLKA 1TKAA 1PV2A 2IZOA 3NIFB 4F45A 5BURA 2WKSA 7ADHA 5J43A 2ZJFA 2ZYAA 5G3ZA 4LQ4A 3UJCA 3OFVA 1JAZA 3BMOB 1F3OA 5BWOA 3RK4A 5ALNA 3HBNA 2AR0A 3TI9A 1QYWA 4UDXX 2ZULA 3UC5A 2X0IA 4U2GA 3DQPA 3VA7A 1JPVA 4A4DA 3IBYA 4WZBB 1NRWA 1YMQA 2WM9B 3MRVA 3LT4A 4LJAA 3NIDB 3VSBA 3ZNNA 4M46A 3PC6A 2Z57A 3HLTA 2CFSA 2F4NA 4DSOA 3PQ5A 5PGMA 3AUTA 3A4TA 4KUGA 1UWVA 4EHHA 4N5DA 1U4OA 4CLRA 3EHDA 4L9WA 1ULAA 1UC5B 4ETMA 4ODIA 2Q07A 3GQBA 3WQQA 2DB3A 2O2XA 3GJRA 4KQ9A 5SY4A 4ENUA 2DWQA 5C32A 3OHSX 5JIBA 2ZJ1A 4Q1DA 3OQHA 1RRVA 2SECE 3UT6A 4XAQA 4PO1A 4GOXA 1ODCA 3MMNA 4GVPA 4A2CA 4GAEA 1R64A 4AYWA 2B78A 2FKNA 3PWTA 2I7XA 2OSBA 3PFWO 2GEKA 3A6PC 3T3IA 2CUNA 2NO4A 1VHDA 3H2BA 1J6UA 2FTKE 5EIXA 1DUVG 4NYIQ 4I1YA 2RGYA 4XGIA 4Y2QA 4LCBA 1E3JA 4FGSA 2OZLA 1U7XA 3CVXA 4WINA 1G21A 1HWYA 3IIJA 4MINA 1NUAA 3AVTA 3C3BA 2NPFA 1YL6A 2UZ1A 2IYFA 1MEJA 4BMXA 3WJ1A 1Y6JA 2CLKB 1Y3HA 3A6ZA 4A8JC 2XGGA 1KI3A 3WAKA 2XXJA 4GOLD 1IUNA 2VDKB 3FN4A 3ZW7A 1OASA 3UPUA 5DFAA 1ZNXA 4Q6WA 1G6HA 2BZGA 3EDCA 2XKKA 4GM1A 4OJKA 4X41A 1KP2A 5A7HA 5BYJA 1SM4A 2BHNA 1F6BA 3KYBA 3TOZA 4AYXA 4LF6B 1ML3A 4G23A 4ZT2A 1H1LB 4EPTA 3B3FA 4CM9D 1XZBA 2OXEA 1WD7A 3QVKA 1T8WA 4FLFA 5JDIA 4KRXA 4RA9B 1XXHE 4K87A 3A1VA 4R3NA 3V42A 3AVUA 3FRHA 5AVYA 5JS8A 3KSAC 1CB7A 1WCIA 1QG6A 3MAJA 1HFWA 4PTYA 3PK0A 2PYIA 1CUIA 1G64A 1C9YA 1XRJA 2A84A 1K2WA 4IIEA 4NU6A 5AKKA 3RSQA 4E2WA 3G2NA 1U1CA 1YZVA 3VJKA 3IOCA 1RQLA 3E7FA 2C3OA 3OCWA 2I3AA 1EVEA 1NLUA 1YZTA 1IHXA 1Z35A 3OTHA 3PE4A 2BSAA 5F64A 3AVVA 4TVOA 4ARVA 3RS0A 4Y9TA 4EG5A 3O21A 1KMHB 1U7ZA 1E66A 3AHCA 1NVFA 3F67A 3PJEA 4PSUA 5IX8A 3V6LA 4RMNA 4QARA 3JQRA 4V0ME 1L8OA 2I80A 5H0IA 4CTKA 4EX6A 2NTVA 3ESQA 3UXMA 1WZIA 1YHZA 1L4EA 3B1YA 4TZKA 1FA9A 1U2SA 3G9UA 1J25A 4EFNA 5KWJA 1XTQA 2ZATA 3WBBA 1FFAA 2RKOA 2OSVA 3MTGA 1CUEA 3OZ7A 3JZMA 1IU9A 4BGUA 3OU7A 1C0KA 4R69A 4C29A 5B7GA 2D74A 1GTMA 2B8EA 1LFDB 3ELUA 3LLCA 4BU1A 1KZ1A 2GEFA 3DP9A 3FHOA 4LQLA 1F51E 2JIMA 2SKDA 1XN4A 4XYMA 1F4PA 3MYRA 4HMPA 4MUEA 5DNCA 2A4KA 3R0VA 5JPCA 2OD2A 3ETLA 2AG1A 2BJWA 2ID7A 1OAOA 3GMSA 4FYJA 4QREA 5FWYB 2ZJYA 3W5VA 4HDNA 1HQDA 3CRVA 3VNBA 3RTAA 3WK4A 2I03A 5TS3A 4CRWB 5EHXA 4KXYA 4S2EA 5TQVA 4RTSA 2DXIA 1M6WA 5KOJB 1FPQA 4PWYA 2W2OA 2VYFA 1FQWA 1W0KD 2YW2A 3MMXA 3GEIA 5HSGA 2HHLA 2WHQA 2QRVA 2B25A 3A2MA 4KSBA 3NX4A 2Y93A 4KXMA 5DM1A 3N8NA 4DSTA 1R0BA 3NUGA 4AZSA 1JGTA 4GWLA 4MHOA 5DWVA 3S2SA 3ZVLA 1E8MA 3BJRA 4IDDA 1QBGA 3RIEA 4B4DA 1MOPA 3H2GA 4HEQA 1ZSNA 3O8CA 2X42A 1V8BA 3NDPA 5B3AA 3A25A 3PJFA 5ALVA 4HQLA 4IXNA 2IP2A 4IGEA 4P80A 4X20B 1ZIYA 1E1CA 2WG0A 4Y0VA 3AEZA 3KWLA 5FOVA 3KHSA 4TWIA 4DEVA 1RKQA 3DD1A 1LCIA 3K9CA 3O4FA 5GY7A 3WL5A 2NU8A 3WP1B 1OB5A 5DYGA 1NRXA 1QM5A 1OBOA 1OR8A 1CJKC 3NBAA 1Q3TA 3PCRB 5JATA 3VNRA 4KZPA 3VC3A 3QKWA 2NW6A 1U4NA 3B8HA 3FBWA 1EZ4A 3V1YA 1N1DA 4ZGBA 5EHZA 4L4SA 5FOUA 5IP5A 3P2KA 2H4FA 2BBWA 1GG5A 1ZSVA 1VLQA 1HTBA 1FCJA 1TEHA 1V5GA 2IOFA 1V1RB 2HLHA 2WVAA 4LE1A 1NI4B 3BMNA 4O2RA 3K1JA 3KT8A 5FL7A 3IMKA 2EATA 3T0GA 2QLNA 3PFKA 3SR3A 1W9MA 3KETA 2HK9A 1NA5A 3CZMA 5FWXA 3AHDA 4RKQA 4KPYA 3C7KA 4D4LA 4PY2A 2X41A 1ZCBA 3I42A 4J7AA 5H59A 5AW3A 5C80A 1JT9A 4LVCA 1WXXA 4JLSA 1PNTA 1KOLA 2FR8C 2DQYA 1U04A 3H8VA 1B1CA 2VHEA 3EBOA 2O5EA 4I81A 2N75A 1VL0A 2BSXA 3HU2A 3EDQA 3KUKA 1VHJA 4FP9A 3RKSA 2WKRA 3QSGA 4RPGA 3TIXB 3TLJA 1IBCA 1KJZA 4N0DA 4Q1BA 4F1WA 1DS6A 3DE6X 3VKHA 2B2XA 1FLNA 2YVQA 3DE1X 3G3EA 3BCRA 3BVPA 1P6QA 5KWSA 4EDHA 5EHQA 4AN1A 1X19A 4AJ1A 3CJQA 3ASUA 1L4UA 1LDGA 3LHFA 1XD8A 1KY4A 2A1TR 4P84A 1ZK3A 1KZHA 1D7OA 3LU1A 2QRPA 2YHUA 3ORRA 5GADl 4Q21A 3EPLA 4KYUA 3H3FA 5DK4A 1UOOA 5DT2A 4YCSA 2H8GA 1VPVA 2OQVA 4XYEA 1JZQA 3UJHA 1Z16A 4CKYA 1O97D 4GEKA 1NLMA 2P0YA 1ORRA 3I9LA 1HLPA 1EJ0A 3TDMA 1N77A 1L5QA 1Y3DE 4GZMA 2O8FA 1U5BB 2PZJA 1YIAA 1TZKA 1YU6A 1XKXA 1F8YA 2A9PA 3HYSA 4U6SA 3UZUA 2WB4A 2YWEA 1UK6A 3OIFA 5HFNA 1VYTA 3RYFA 4BMNA 1ESEA 2YHBA 4DC1A 3GAMA 4QOGA 2A0YA 1AKNA 4US1R 3TB6A 3AY3A 1FMJA 2HCJB 2HBQA 1D8AA 4M8LA 2EFEB 4RM2A 2P6OA 1E1LA 3FR8A 4Z0PA 4C3VA 4EHAA 1MU0A 4AY2A 1P2UA 2COKA 3HG7A 2Q3CA 4KK3A 3T7RA 2NVOA 3E48A 4MAMA 4WN9A 2CHGA 2XWBF 2PR2A 3ZNOA 1ECGA 4EMSA 1DFGA 2H65A 3OLXA 2J0UB 4BMZA 2DBYA 2ISSD 3CH6A 3RH0A 4ESEA 2X4DA 1VJGA 3Q9SA 3UFXA 4P5PA 1R6BX 3GG9A 5EMHA 4GPIB 3T34A 1QHEA 4EYQA 2BMJA 2EF1A 3QJYA 4YV7A 5IJ9A 1OJ7A 5I9IA 4ZZ0A 6LDHA 5CJJA 5DYTA 4DMHA 4EY4A 3BRCA 1DNPA 4NAUA 4IW3B 1L1QA 5ESXA 3NDJA 1A2KC 2GHQA 3OZAA 3PQFA 4C87A 4CEJA 1NBIA 3N74A 4YI3A 2C5LA 3L7BA 2CFTA 1TMGE 1FYEA 2BTEA 3GRRA 4L9RA 5I4KA 2IYVA 5H83A 5CBKA 1FDTA 4F96A 2IYPA 1YI0A 1AKMA 3B2EA 3WYFA 5GJCA 1KQGA 4AU1A 2O3SA 1K8YB 1WUHS 1JLRA 1HY3A 2GJ9A 3AIOA 3EJWA 1ECPA 1N2XA 3KR0A 4KYVA 4QDZA 1N5IA 3MJ4A 3HMKA 4UU7A 3IB6A 1BSVA 1K6EA 4Y1FA 1PJTA 1TKRA 3DFMA 3WLRA 2PX5A 4F71A 5IF3A 2RHLA 2XYHA 2XKBA 5FTKA 5BN3A 1A8HA 2BUBA 3DBOB 3EA4A 4RLSA 3NJ4A 4TV9B 1MFZA 5CG1A 3H3JA 2VDRB 1Y6GA 4KWIA 2G76A 4IMPA 3D8RA 1N9ZA 3LLMA 5M2QA 2OLEA 4J76A 3NTOA 2YNMA 4X9XA 4QODA 4EUHA 4EHJA 4C4AA 3G8BA 2AVDA 1Z5NA 1II0A 1EM6A 2C2MA 2VNAA 2X0NA 3OE5A 2W5UA 2POQX 4M7RA 5FHQA 2EJCA 2XUPA 5LYYA 2AMJA 4BN4A 2R7AA 3HY4A 3JQBC 4M7PA 2GEBA 5SYMA 5TJHA 3ZIDA 2ZYSA 3H7AA 4BYGA 3IEPA 4Q7JB 1FC0A 1WSBA 1CLEA 1N5LA 5KTMA 2W2KB 2J9GA 4K03A 4S1NA 4E4TA 1RZRA 1VCIA 3IKTA 5FWDA 4MWCA 3TSYA 4B45A 1VECA 1BFUA 4WNAA 1BHSA 1V8DA 4CLHA 3MVEA 1P9RA 4KO2S 3E53A 4C6HA 4F93B 4ZQFA 3MJHA 4HI0E 4ZD6A 1QH8A 2YVAA 1RLOA 5HJEA 5EA2A 1Q83A 4X97A 5JD4A 4GE3A 4JLDA 1AX9A 3OZWA 4LYHA 3X1YA 1XMPA 1Z07A 3AZPA 3NCTA 2Y77A 4E5NA 3LF1A 4EHDA 4BNLA 2V7PA 4KPGA 4PLFA 2YWCA 4JI8B 2NYRA 2VSXA 3QOXA 1U5AA 5KNBH 3SVTA 2RK3A 1RS0A 1XD9A 1E5XA 1BXRA 4IQ0A 5L8VA 3AKZA 5L4NA 1OILA 2RSLA 3HUTA 2PG3A 2PT6A 2VJMB 3N2KA 4O2LA 4I5EA 4PYKA 3RD5A 2G40A 5DI9A 4MIKA 3HV0A 3IKLA 3KYDB 2PT5A 4J7XA 4RY8A 2ZROA 1P91A 5LWHA 1TM4E 3DOIA 2BFEA 1RAGA 1QS0A 3BHMA 4MV6A 4WLNA 3B9BA 3O8RA 3DKPA 1NIJA 5C8YA 3LUHA 4I36A 4B71A 2LW7A 3EZ9A 3Q15C 1K1EA 4WSOA 3OKCA 4ZAXA 3DTVA 3TPFA 1APBA 4EARA 3NTUA 4LBVA 4OXNA 1QJ4A 2QM0A 3UAGA 3JAWB 2XBUA 2JI6A 4HAOA 1R50A 4R8LA 4RXMA 3WJ2A 3X1XA 4EA8A 2NUPB 5TY0A 3UQZA 2VHQA 1S4QA 4ED9A 1AZSC 4ZTUB 1EFAA 1RAAA 2GH1A 5C8DA 1SPBS 4QFMA 2QVLA 1W5BA 5FR1A 2CNNA 4RNCA 4L16A 4IHKA 2HA2A 4EKDA 4WOJA 1M2NA 2CDAA 4BX3A 2W6MA 1XYGA 1ZUD1 2YTZA 2IT1A 1C41A 2AW3A 1CUDA 2AL7A 3ZTYA 4WVLA 3VHLB 3L0ZA 3NDRA 3WV4A 1EVLA 1GQYA 2LUOA 3V4FA 3LKBA 4QXPA 3OOWA 1V16B 4BVKA 1MEEA 1CUUA 2HUPA 3D2LA 3RIYA 4CI9A 1X70A 4DR3B 3EPKA 4MI1A 4JOBA 4QATA 5AM3A 4OMUA 1EUCA 3QV1A 1WG8A 1KDOA 1W75A 5LN1A 3B3GA 3U3MA 2J5KA 3FRJA 4S3MA 2XYGA 3GJSA 3HE3A 4I9NA 4HL6A 2XA9A 4OYRA 4ZEMA 4RQUA 3LWBA 3ROKA 1IBSA 4R5MA 4RGYA 3TK1A 1NW9B 2H07A 3IESA 2ZE6A 1UBEA 3Q10A 3ZHUA 3ICEA 1UMDB 4G5FA 4EF4A 3HZZA 3QM1A 3UWSA 4CCYA 1VPLA 3BMCB 1U1GA 2BGTA 5IWCA 5HE8A 1XRPA 3JQFA 4NS1A 4PVCA 2JBWA 2HMWA 3BFPA 3ZCUA 2Z2XA 5CDYA 1I94B 1TL7C 1MKYA 5J2UA 5KAMA 4PYRA 2Q4EA 4LE0A 4OQXA 3BZBA 2NSHA 4OV6B 4R7ZA 3VX3A 3NETA 4DV0B 1OWMA 1KRWA 2YHSA 3W3AA 4KR7A 4GBJA 4R2KA 1REQA 1O6GA 4BV2A 1GA6A 2IPAB 1HSOA 2HO5A 1M67A 3OF5A 4HWPA 3ER9A 1MR3F 2P0AA 3BFXA 1RI4A 1WDTA 2HF8A 4OOFA 2GDZA 3NTVA 1NU8A 1E2MA 1YZLA 6REQB 1XXHA 2AZ4A 3R3UA 4M9RA 5E2IA 4ESVA 2QTWB 2WKQA 3W2FA 3O8NA 1YCGA 1OXUA 4ACBA 1PR9A 5IK2D 1NBAA 1DWUA 2QDKA 2W6JD 4HQ6A 3WA7A 1H8HD 2GBLA 4GWKA 1VGRA 2MYUA 2DCUA 1ONSA 3IUPA 1Z4KA 3AEQB 1I1NA 4FOPA 4EUEA 1JA9A 3T4XA 3PUHA 3VVBA 2GAAA 4MQ4A 2AJ8A 4ARSA 1DRVA 2AI3A 3FTNA 4B33A 1A7AA 3M1IA 1H9CA 3G0HA 4QEKA 5BW6B 3WGIA 3PNVA 3F5SA 3O7MA 1DC3A 5CBPB 4JUFA 1YDFA 2AN1A 2Y99A 1Q0QA 1CB0A 4TN1A 4V0MA 5AVOA 1SMKA 1NN5A 1NOIA 3GC6A 1G16A 1V8FA 3G0GA 2XTNA 3O91A 4IKPA 4OJYA 1EEHA 1BGVA 4BO9A 4XGNA 4RTMA 1P8JA 2UYGA 4Z86A 5DTJA 5LOVA 2BFAA 1M2GA 2WPNA 3K5WA 1FMFA 4HYTA 4HC4A 2I55A 4L02A 5G1NA 4X44A 1R66A 3QWFA 1H2ZA 1FNNA 5JARA 1YS2X 1OLUB 4FFDA 3K9BA 4XCQA 3DKVA 3WRXA 2Y71A 4N9WA 3HPQA 5CDGA 3U4HA 4XIGS 2JIBA 2QOEA 2RGEA 5EEGA 3PKIA 2ZAMA 3R0QA 4YRDA 4K6GA 1I01A 2C9BA 3PUJA 5JAHA 4I1PA 1BQ3A 2B3DA 1N6KA 4I9HA 4TX1A 1EHIA 5JBIA 2OESA 3MERA 5HCIA 2XOEA 1VFNA 1WHSB 3LBIA 3I62A 4YH1A 3P2IA 1H8EA 2XNCA 4KN6A 3EUEA 3SDZA 2V59A 3VYWA 1BDJA 1DAMA 3IUNA 3GP8A 1MX3A 2F4VB 2E4ZA 2OMKA 3I6IA 3VU8A 5E0OA 4QPDA 4Z7QB 1FXUA 4FKMA 1WXHA 1FXWA 4ZK6A 3KUXA 5JJKA 1YSCA 2VWQA 1KYQA 4B82A 2VF4X 3K9FC 2BHTA 2HHHB 3HDQA 4F91B 1PAUA 1E59A 4RZUA 3E2MA 1B0ZA 4GL4A 4NCHA 2Z4RA 3C7DB 1TO1E 4ITVA 3RTGA 3STHA 4DAEA 1Z33A 4V0OA 3D4PA 3HNRA 5JRZA 2ZUWA 2A0KA 1QRRA 4CMIA 2F67A 1T15A 3OESA 4D74A 3R5SA 3PUYA 2DP4E 1C7QA 1D2MA 2XXBA 3KZKA 1LPAB 2C57A 3KR2A 3TW0A 3RBXA 3NYWA 1I32A 1QC5B 4UEQA 5DBOA 1VIVA 4PYMA 1TAQA 5EP2A 1NSFA 2QAGB 2HQ1A 1K3FA 3RF6A 1X42A 1Z0AA 5F1OA 4I66A 4AO7A 1CDEA 2CUKA 3QLTA 4BRSA 5BV7A 1FNBA 2M98A 4JEMA 4EOGA 5IC4A 3CM0A 1YASA 4RELA 1WHTB 2WZQA 4ZJUA 1M34E 4D5GA 1OBHA 3ZHSA 1ENYA 2DUNA 1G18A 3MFQA 3RG8A 3ZY5A 1NUQA 2GNPA 3DCJA 2DAPA 1CEQA 2ZJOA 4H7HA 2ZB7A 2Z98A 6ABPA 3GR6A 5K51A 5LL6P 2O3TA 3SY8A 3CXRA 1IK6A 1J09A 3CQFA 3JR7A 2Y66A 1FUYB 1BH6A 1UT8A 3SIXA 3SOZA 4TVBA 2IUUA 2C2YA 1E1MA 3NWJA 4UM8B 4Y6SA 2WYWA 1S5PA 1BMDA 1PF7E 2R1TB 4CM3A 4ZDKA 1PL7A 3F8TA 2P9GA 3K9HA 1W73A 4DQUA 4U3JB 4N6NA 1O6FA 4XVRA 1TD1A 4B3CA 4B6RA 5A9RA 3D2AA 4PZUA 2G28A 3GT7A 2WKPA 2REQB 3E9ZA 2OXCA 4L5CA 1PJAA 2KBEA 1AMUA 5BUCA 3L0YA 4CM5A 1GYQA 2DQSA 1M6EX 2O2GA 5DWDA 4QT0A 4CQMA 4UDYX 3RC1A 2AKYA 4DV4B 3DO5A 4AQDA 3THYB 4YV1A 1V1MA 2XRFA 4M86A 3VHRA 4DJAA 2G06A 4QYSA 4QHTA 1LWNA 1FXSA 4AUEA 4MVYA 1DWQA 3T1YB 1SGWA 2XGMA 4INPA 1N6LA 2FZEA 1YOVA 3JQGA 4OHBA 5IWAB 4AWXA 1O97C 4FEGA 1YR9A 4G9GA 4IKEA 4IM7A 1EFRA 1ATZA 2G36A 1IULA 4MP3A 4OQNA 4UMEA 4V03A 1JF8A 3KOUA 4BLTA 1H42A 5CLQA 4IV8A 2B1IA 2J87A 5JXWA 2DPLA 4QDUA 4OX9B 4BV8A 2EW8A 4ZOAA 4F7DA 1C3LA 2X8JB 1MAUA 4F2GA 3EW7A 3FYUB 1CJMA 2AJDA 2ATVA 3WLQA 3S44A 2CDBA 1QLHA 4HVLA 5J3JA 2DMRA 5EZ5A 3ZI0A 1ZKMA 2ZI4A 3FTCA 2FCRA 2BI8A 2FU5C 4NMHA 3M9XA 5FRDA 1EP2B 5FUBA 3T8YA 2I6TA 4Q12A 5A3SA 2P78A 4XSVA 1DAIA 2YH2A 4UHBA 1XWWA 3NNDA 1SXJB 2EIHA 5KO2A 4RVHA 2YL2A 1OF1A 3KBOA 2ONJA 5FUVA 4U39A 3HFRA 4BBZA 1VYVA 2BI4A 4YMHA 3VTZA 3N76A 3FHJA 2VTEA 4GI3A 4KE6A 2Q6LA 4N54A 3B53X 3U4AA 1KYIA 2RGWA 3T3HA 1BHO1 3DNMA 2P9YA 3UWKA 4H7JA 5ALQA 3VGJA 5EZ6B 1GZ5A 2X86A 3LH5A 1OLSB 5AT1A 4BUCA 2ZSAA 1GRQA 3O4RA 1HG1A 3JTMA 3NFRA 1QVWA 1UIRA 4NYJQ 2I76A 3H5RA 1R8XA 1Z2EA 3PFHA 4ND3A 3EBLA 4W9MC 4HLNA 1LSJA 2WMNB 3UYKA 2C2OA 1YD7A 4HFMA 1XX6A 1B23P 1GQQA 4EQZA 2V7VA 2C98A 3HK2A 1QLWA 4MMYB 3V1KA 2QX4A 1XA3A 5F78A 3QVWA 1OI3A 1NN3A 2V6FA 3O26A 3MWFA 1GGFA 1MX9A 2WVJA 2I87A 1PYDA 1SVKA 2VQ6A 2C4KA 3C8HA 1CX9B 1JHMA 3SF8A 1G20B 2FE1A 4KIUA 4DBLC 4PZEA 2KQUA 3A1FA 4NV0A 1BDMA 4H1WA 5LQRA 1SOUA 4X92A 1WCV1 1P73A 3LM8A 1G2IA 2FPIB 2GI4A 3GNLA 1M2WA 3F8SA 3R3YA 1A0OA 3DPSA 1PWXA 4OTZA 4Y7CA 4MCIA 3GYBA 4WOCA 3ZY2A 2IIQA 5ECYA 1HE5A 1SQGA 4JKIA 4YXFA 3LUKA 1T4GA 3CH4B 4P86A 3M5CA 3U2QA 4C4RA 3QEAZ 5ALPA 2C7PA 2OGZA 1J7KA 1L5WA 2JHAA 5JC1A 4E5MA 4CTNA 2P6RA 4PWZA 3FDFA 5AICA 1MUUA 1SU8A 1JQLB 2JI9A 4PQRA 3W0LB 2ZRDA 1JQDA 3KKMA 3L7AA 4PBTA 5FPYA 2OZKA 3LSYA 5B2ZA 5IMBA 5DIZA 3CBQA 3Q3JB 4XIYA 4TGLA 1XHFA 1OXXK 2QUAA 1IHUA 5L7TA 2CSXA 2ZUDA 1XKQA 3G2JA 4URYR 5EQTA 2JBAB 1JQ5A 1V6AA 4H6XA 4QDKA 1WF6A 2ZE7A 3OOSA 4FMDF 4GDMA 5IAGA 2I22A 2F7SA 2BAGA 2OFOA 4X0EA 5GP1A 4EITA 3E5NA 5KYUA 3BEDA 4C4SA 2I4LA 1X92A 5EE5B 3CLVA 3PJRA 3CZ9A 3RVDA 1MAWA 4OK6A 1LK5A 2BELA 1EXMA 1UWKA 3OJLA 3V9PA 2QUBA 3LP5A 4G5XA 1OXBB 3LCVB 4QOSA 3U3OA 2AKEA 4ER3A 4KRFA 1AZWA 4MR8B 4D6YA 1OXTA 4R3UC 3ZYZA 1UZMA 3AB7A 2IYLD 4JP2A 3M3HA 1GNQA 4FOTA 3ZCXA 2G71A 1YZFA 4QBTA 2YCBA 2XRYA 1ZIPA 3SYMA 3T7EA 1VE6A 2XNHA 1GSAA 1BKSB 2XUDA 1D7AA 2P9FA 1C9NA 1KEZA 3C97A 1SOVA 3KHKA 1H9AA 3LXUX 4HEA1 1T91A 3UJBA 4JI0B 2E4VA 4JP5A 1GZVA 3QY0A 4UFPA 5J5CA 1F20A 3WLOA 2JFYA 2G07A 3AVYA 1GKLA 3N2LA 3D7MA 3QWIA 4RY0A 2R7NA 3LPLA 1GCAA 3F5MA 1H3NA 2RI6A 2X9QA 3HZHA 3KQYA 4FD2A 2AOTB 1XDZA 2IJGX 2YYAA 2DWUA 4WY5A 1YR3A 5DGCA 4H9GA 4TYNA 4NCNA 4ITRC 4UU1A 4QNRA 2WM2A 3B89A 2OMEA 2R00A 2QG6A 3JQDA 5FP0A 4Z1MD 5CYPA 4RWEA 3EHEA 3P19A 3VPSA 5B58C 5ABPA 4A73A 2FA9A 1QIGA 5ENZA 2WQZA 2JFBA 2WWFA 4F1KA 6GPBA 4KV7A 3G5LA 5G1PA 3DYIA 3OZVA 4I4IA 1LX6A 4IIGA 2QVBA 3QJ5A 3WLTA 4YRLA 1KETA 2ZB8A 1QHHA 3DS8A 4RFSA 4BFCA 4D45A 5AD1A 1ZW1A 3J80A 1Y34E 4H18A 1L7DA 3HB4X 4HBGA 3W04A 3JAKA 5IAAA 5TX7A 1KMIY 5KAPA 2P9QA 2R3SA 2FW8A 3S8YA 1LC0A 1GGHA 2FZCA 1Z28A 3R3WA 3THOA 4TV9F 4UVIA 3EAGA 3VR6A 3FPBA 4Y7DA 5HUQA 2B4RO 2HA0A 4OXYA 5EXSA 1X1CA 1WDLA 3BGVA 1ZC4A 2DR2A 3UEOA 1QYDA 5U9CA 1E32A 4AVYA 3M34A 2RONA 2JEYA 3RABA 4YRFA 5KKCA 3DT8A 4ZHSA 5DNUA 2ZWIA 1N0VC 1SG0A 3RADC 1XTTA 3IF8B 3HJUA 2VRNA 2J9FA 2NU6A 3IUMA 2VHJA 2MOKA 1BCSA 2YFQA 4BO7A 5CVJA 1FP4A 3TKLA 3BF7A 4DUGA 1MC1A 3DMFA 4X6UA 4ZRDA 1GNRA 2QMOA 4WI1A 3SIPA 1T2AA 3WDKA 4ZJPA 3MQFA 3A10A 4ZPXA 3W06A 3SC2A 2PUWA 1YOBA 4LFAB 3SBEA 4ER0A 3R0IA 4IUDS 5H82A 1FX0A 2ETVA 3NU1A 4AXXA 5JASA 3EG5A 4ND8B 1TYAE 1V5WA 4BE7B 1M2FA 2HQOA 4DVGA 1FVOA 2AD1A 1U2PA 3LXMA 3HO8A 1EX9A 3KD2A 1NV8A 4RGQA 3H4VA 3P9NA 4TTRA 2O7NA 2Q1YA 1L0BA 1K5DA 3FZYA 2BV3A 4FHEA 1MCZA 5ANRB 5TQ2A 2OKCA 4ZC8A 3SQOA 1WQ4A 3T3EA 3X2EA 2VHYA 2R87A 1IWPB 2YMPA 2ZUCA 5LP6C 4EELA 3I12A 9MHTA 1N1MA 1SB9A 1K7YA 3KTDA 1T0PA 3I4CA 4JX8A 3N75A 4AN4A 1TB4A 3KM0A 2O4UX 3HZRA 4TMWA 2PIAA 3MUOA 1G3RA 5G0UA 4U9HS 4EVRA 4DV2B 2QMEA 5KEIA 4TVKA 4O3FA 1PDWA 3EG9B 2DHCA 2CEAA 4MUGA 1C80A 1FEZA 1MMFB 1UF9A 1VBKA 4MV4A 5ELMA 1KMNA 3HYCA 4BNYA 5ITWA 1AUQA 2X6TA 3DT9A 3H5IA 3OSUA 3A7DA 3K4PA 3PV0A 4INZA 1LUAA 3S28A 3U7RA 5ULLA 4QGSA 4D0LB 4LV6A 2EBWA 4C0KA 4JC0A 4ETNA 1TM2A 4OLHA 4RFLA 4KPUA 5CFNA 4FOSA 5AO9A 5J63A 3IVRA 3FHCB 1U02A 3ZX5A 3V55A 2R7LA 3EY4A 4EJSC 1RACA 1J0DA 4FCCA 5A6VA 2GN6A 5D5QA 1TA9A 4F3KA 2HSGA 3C3YA 3U3XA 5KNDA 1QFYA 1QB8A 4ZOLA 4KR2A 1RFGE 4ZOEA 1IRIA 5D86A 4E46A 1T1EA 2CEKA 3L8ZA 3OIWA 2RIPA 4L5JA 4NEQA 3V80A 4B6PA 5L3QB 4J2OA 4COKA 1MQSA 1YE5A 1FFBA 1MA3A 1W2GA 2P75A 3MUFA 1SCAA 2OHOA 4JLKA 5BV2P 4H6WA 5KHOC 3FLMA 2JASA 3AJRA 1NULA 4M9UA 4EMUA 2NP6A 2IX3A 1T1RA 4JLOA 1N9KA 4PYLA 5CB8A 1VJ5A 1K5PA 4R81A 2WAXA 3G23A 4MH0R 4YXWD 2F9MA 3HC7A 1KZ9A 3UA4A 4NWIA 2A9QA 2VATA 3C98A 3ANXA 2BOVA 4KXNA 4LMAA 4MKZA 4WASA 5FV7A 4LZWA 2YJ4A 2IL1A 3WDSA 4AICA 4EGCB 2OWEA 4CM4B 4IOMA 3U56A 1LJ8A 1NUTA 1DHTA 1TYBE 2AG8A 2IDMA 2IX9A 2C7BA 1HYEA 2XCIA 3C3DA 2YXEA 3CLTD 3NBFA 4LSMA 3JAMA 3ZV5A 3IR6A 2BGWA 3VDXA 1SBQA 2KJQA 3AGPA 3AEXA 3OJ0A 4LYGA 3OTIA 1O03A 1TPZA 1WMFA 3EVAA 4CDMA 2I91A 4JBGA 2FW9A 5B1HA 1C1DB 2PLFA 3N0VA 2V7EA 5JFGA 2P79A 2NV6A 2W37A 5EYPA 2ORVA 3PEFA 1M34A 1IIBA 3F6YA 1N9GB 2RK6A 1NYLA 2Z3WA 5FBHA 2BMWA 2X5JO 1N2SA 1Y3CE 3PUZA 4EUKA 2BGGA 4UUNA 3JPWA 1WV1A 2DT8A 3HADA 2J3QA 3R0ZA 4HLQB 4KYTA 4P4TA 3VYVA 1E9SA 1TF5A 3OLWA 2W58A 1JZSA 3CMMA 2IA5A 3HY3A 3LT0A 3NBKA 4O2BA 4RK4A 1L4LA 2WT9A 1MIOA 2NIPA 3KR9A 4IG9A 4PNHA 2FETA 3H87A 3EQ6A 2FZVA 5IAJA 3QI7A 2W6NA 2CE2X 4QUEA 3TR5A 3KQOA 1KE1A 3RDPA 3X1KA 1MRSA 4Z1OA 3LPMA 4FYHA 4CWAA 1XFDA 4C22A 1ES9A 2PWYA 3N6XA 4H2DA 4EEKA 4EYSA 2FFHA 3OQNA 1VL5A 1WJGA 3HV2A 3M1AA 4M49A 1RVDA 3G7UA 1I30A 1AQ6A 4J7CA 3HUDA 1X1BA 3UJDA 3B2NA 1K06A 1O4VA 4XB2A 1B6SA 1HOXA 2AS0A 3GRPA 4N7RA 1PK7A 4N8DA 3WS7A 4AJJA 4TQUS 1DQZA 4KJXA 4P92A 1PFGA 3L02A 2REXB 5CEFA 1D0VA 2G04A 2XGOA 4G4SO 5C53B 4DCGA 2Q29A 1SH7A 2FMHA 4PXAA 3WLMA 1H2AS 1M7HA 3RRBA 1JVNA 2ZKIA 4V0QA 3SBXA 3TKAA 1VE1A 2AC4A 3WNDA 5HZGA 3KG2A 1KEEB 3LYAA 1T36B 5K8JB 1CKEA 3SSAA 2GYVA 3HCAA 3VAZA 2PY6A 2L19A 4I5DA 1PK8A 4LPKA 2VN8A 4UAUA 5MGBA 1NLYA 2NZ2A 4M8IA 2Q5HA 4NJOA 4XTRA 4LOAA 5GJWC 1T9KA 4ZWNA 1YNSA 1QPZA 2GYUA 5HYVA 3OC0A 2Y1FA 3O2JA 2DTDA 2GK7A 1QO0D 3IBTA 1T6ZA 2X2PA 3MFYA 2QTVA 4M8NE 4PYNA 4MDEA 1L5YA 1YR1A 4IQGA 5CTAA 4UUQA 4CM8A 2XT0A 5IVPA 4NAHA 5DLPA 3L0BA 2R44A 1L7EA 1A8QA 2R8RA 4I4TF 4B3BA 3GJ4A 2ZUSA 1YAJA 3FWKA 2OQRA 3PC8A 1TK2A 3DLHA 4BNXA 3R9WA 1T9AA 1PGPA 1KS9A 2Z2KA 4PONA 2XCTB 3MINB 1Q0UA 3NI2A 3QWHA 4QOHA 5ECDA 4ZMSA 3WAGA 1GZ4A 3GBVA 3KQUA 1M2EA 4N0EA 1YZKA 2NX2A 4QJBA 1K97A 1TYDE 4Z53A 1A8SA 4JQOA 5JY1A 4KO3S 1GSIA 4QSMA 5LA6A 4A9AA 5AW6A 5LMUB 5KOHA 5LVAA 1KRHA 2AJBA 3S2ZA 3RG2A 2X76A 1JG2A 3BKWA 3LCCA 4FR2A 5EMMA 2G4VA 3VU0A 4Y9DA 2NT4A 1M66A 2PTHA 1C81A 2QGNA 4MYSA 1A69A 2B7LA 2XA1A 4FT4A 2AX4A 3T9AA 1A72A 1E61A 1M2OB 3IIEA 5BORA 4NJMB 1P7CA 3SSOA 1W7AA 5ALKA 5DYYA 5EIEA 2A59A 3FZQA 5K99A 4A2WA 4G0UA 3UMCA 1EG7A 1PIWA 4WLOA 1PWZA 1Z7BA 3CLHA 4FS8A 4BPBA 1EESA 1R5BA 3BF8A 4DCNA 2X7HA 5LD2B 4Q19A 4UBJA 2X6QA 5I8PA 4GUAA 2JHGA 3KAQA 1FSSA 2IYAA 3TRIA 4AC9A 2OY0A 2G0AA 5CD1A 1WUKS 1LX7A 5C4MA 5IT0A 3KD3A 1TNDA 4LOJA 3ZR4B 3C2QA 5EMLA 3WLIA 4MVJF 1D1QA 4PO9A 3AM3A 1EUDA 4C0WA 4YJ2A 3OCVA 1N2CB 3UMFA 4H0NA 3F6CA 1JJBA 2YRXA 4ZCSA 1BVHA 2WM3A 3P2OA 5CX1B 3AUAA 2IUSA 4BAUA 3PI7A 2QSUA 1I4LD 3EDMA 3DE3X 3U4DA 3PUVA 4FKBA 3AHFA 3G1UA 2VXCA 3J81A 1KO1A 2W6CX 2O7VA 4W1SA 1XZKA 2Y68A 2ZG6A 4OB8A 3QBEA 1GYRA 4FWIB 4GRIA 4G8DA 3WRYA 5MN4A 4XX1A 1Z88A 3CUUA 3G0DA 1K6IA 3PC3A 1M0TA 2WIKA 3QQ5A 3U7JA 5C7IO 4K7JA 2OVFA 3FPSA 1ZQ1A 3I9V6 3DBLA 4KIFA 1WXGA 1GU7A 1X94A 1RZVA 2D0OB 2V9ZA 3EWSA 1ODKA 4HGNA 1SUCA 1Y5IA 4U5XA 3MJSA 3JYQA 5DM0A 1RR6A 1V3VA 1YL5A 1WCWA 2AFIE 1OGYA 3D4OA 2FX2A 5K09A 2JAXA 4TTQA 3D59A 2J8ZA 4RHXA 5FNVF 1Z73A 2GPJA 2AOUB 2WT4A 4YAOA 3V4OA 4BNKA 4OA5A 4PC1A 3GFBA 4MQFB 4REOA 2A7QA 1R0KA 3QLVC 1CF9A 2HHJA 3C5EA 2BZSA 2ZIUB 1OIWA 3HJTA 4IDBA 1P0MA 4OHPA 4WA7A 3ZW9A 4CKWB 4E30A 3IEMA 2B21A 2QTGA 2WU3A 2WJHA 4GUDA 3ZXXA 4KDCA 4BVBA 4I55A 4IZ6A 1T8YA 1YE8A 3FKSA 5EC8A 2Q5QA 1D0SA 2XMZA 2EZUA 4WW0A 3HA7A 3C39A 1HDCA 1IAVA 1T9CA 3HCNA 5TIIA 1T2DA 4I9FA 2WSIA 1JFFB 4CYMA 3AOEC 1W36C 1DDGA 3EEYA 4A26A 5FPPA 5I47A 1ULUA 2OBMA 1SVLA 4S35A 4YAIA 1A9TA 3QVVA 2X4GA 3ZY3A 4M1ZA 1XMOB 3REQB 4A91A 3BSSA 4GYKA 3CR3C 3HDGA 2HIAA 3EXIB 4IRXA 4ENQA 2DPMA 2D5AA 1W9HA 4TKUB 4AM8A 4RTPA 1N0HA 1SQSA 2ZZMA 1XZQA 1OFUA 1TEXA 1RP1A 2HDOA 2PX8A 1Z38A 3Q7SA 4HX9A 2PJRA 5E0KB 1GPKA 5EXEA 2V1UA 2W6ZA 2C7QA 4LF7B 2PLWA 3GJTA 1RRGA 2ID4A 1Q50A 2C04A 4ZQBA 4A8TA 2RCYA 5HILA 2GZ1A 2GFHA 4IDCA 4R2LA 4D6PA 3CB4A 4Y2SA 5AVVA 3O2SB 1BQ4A 3JQ9C 4H31A 2Q7DA 2ZCVA 4X3CA 5KJFA 2WWWA 2XYPA 2RGRA 2NU9B 5FNVA 2F8TA 2YDXA 1IY2A 2A30A 1TCUA 1TU4A 3WSVA 4BDSA 1K3UB 3P9YA 1B73A 4GX1A 2EYQA 3QUBA 4X60A 3VU1A 1IWBB 2K7ZA 2ASEA 1RZUA 1HT2E 3L9XA 3ACBA 1IN8A 1W0CA 2VJOA 1EP3B 4WK0B 2Z8ZA 2O9JA 2CXQA 3AFOA 2J3IA 3EEBA 1G66A 4RKRA 5DLQC 2HK7A 4NE7A 2Q50A 4DCJA 1DT5A 2W70A 2W8ZA 1XPOA 4EB6B 4YBZA 1NKSA 1WLSA 1PGNA 4K6KA 1XHLA 4LISA 3RSOA 1C5KA 3QELA 4AMVA 3JQQA 3CNHA 1DKUA 3I9OA 3LHDA 2RGUA 3A3YA 4FYWA 5ECWA 3G0IA 3OEED 1MG0A 1W93A 1WOMA 1N6IA 1OFUX 3LZCA 1Q22A 4U2EA 1TYZA 1PJCA 3IX7A 3WGGA 2R6ZA 1J0AA 2OQ2A 2TMKA 2WYUA 5BN5B 1IY9A 4GLLA 3SC6A 4I6JA 3KE8A 5A7GA 3TOVA 4QXQA 4IJMA 3TSZA 5EIFA 3DEHA 3FVQA 2W4QA 4J0IA 2AE1A 4HP8A 3SE0A 3SYKA 4AJNA 5AQ1A 1BDIA 1YZUA 1C0EA 3CBGA 2H18A 3P0EA 3USZA 5F7OA 1H2YA 2GBGA 3A9VA 5IM4F 2XH8A 3T1VA 2POCA 1C14A 4G2NA 5DB4A 1P3Y1 4I8XA 4Q16A 1J8QA 1EIZA 2JZCA 2MSNA 4WZ6A 3T7AA 3GIWA 3K6KA 1E7QA 1N2HA 3KLPX 3NWPA 1X8KA 1IRXA 1G8AA 2EBFX 2VT7A 1UEIA 5AW5A 2JRCA 3G85A 5KCMA 4JWKA 5I8WA 2O6HA 3V1TC 2YWFA 2DUMA 5GOTA 3A4NA 1GNTA 3HKBB 1M8JA 4NTZA 1HMPA 2V4UA 3P4XA 1Z47A 3JQAB 1DC6A 2CWDA 3GEMA 4H08A 4IVPA 3C6KA 4MOWA 2WOOA 2HADA 2FDCA 2W7TA 1QV6A 2C77A 1NRIA 4OMCA 5LBIA 2UYOA 5ALJA 1CE8B 2F3RA 4RACA 2Q4RA 2JJ1D 2JIQA 4IDNA 3MUEA 3MWLA 3ND6A 4UTXA 1DQPA 1W4LA 3BOSA 4ZEWA 3PD0A 2QM8A 1PL0A 1ZONA 4L85A 3K05A 3WO0A 1DLJA 3AYXB 5DBGA 5T8KA 1V3UA 1EK6A 3TZBA 1VGVA 2E3JA 3LOPA 4MB0A 1RZ3A 3KKKA 1YRBA 4R31A 4RENA 3WB0A 4C3ZA 1T35A 3DXYA 5DM70 4RD1A 3DVAA 1QE0A 2P3LA 3BE6A 5J40A 3ZZTA 3A9RA 3K09C 3KLBA 4ZK2A 4MVJM 3JXEA 1DEXA 3LY8A 3C70A 4F5EA 3LVRE 3CG0A 3GGOA 2BFBB 2CKMA 4TRMA 4P53A 1KYYA 1OT5A 3I73A 4B5LA 1J23A 1ZL2A 2CVHA 2F2TA 2RH5A 1ISRA 3TMYA 3T9BA 2CMHA 1N36B 4G2TA 1XLTC 3ODPA 5CNIA 1JEEA 2RHBA 3PXAA 2H4YA 2NU7B 1Y3IA 3R3ZA 3I53A 4DNPA 3QXHA 3RF7A 2HBYA 3OTWA 4OP2A 4DXHA 1X3SA 2QQ0A 3P2EA 2TS1A 1YZQA 4MPJA 3DO8A 1ELOA 1JFSA 4M2LA 2C2BA 4R1UA 3CLTC 4ND1A 3DUWA 4OSPA 2Q2QA 3N70A 1ADFA 4XM2A 3DPUA 4LECA 3IB3A 3EIOA 4DY4A 3A9UA 4G0ZA 2C9CA 3GLHB 2AXNA 1HXHA 4FB5A 1C1YA 4Q4CA 2XKAA 3VTAA 3IBCA 4Y2RA 4XDZA 4ESHA 2WG1A 4GZLA 3K3PA 3S40A 4NP6A 4PF1A 4CW7A 4N3NA 3QPBA 5HZKA 2MSWA 4WL0A 4LTNA 5P8WA 3IULA 4G0YA 4RIHA 3P9ZA 1JECA 1Z4LA 3O4JA 4QUKA 3EVFA 4GGPA 2LNDA 4BIIA 2WB2A 1Z8FA 3SQWA 1X6VA 2HYDA 5JYDA 2FW6A 5HFAA 3THRA 1ONBA 2PSDA 2XNSA 3NAQA 3FFAA 1JZTA 4Q0MA 3RC7A 5KX5F 5FOQA 1U6KA 1I9CA 1Y5MA 3FMIA 3KAPA 3M2TA 1BVYF 1Q0RA 3KRTA 1BDBA 1JDSA 5DHQA 4PC2A 5B57C 4DQVA 4INOA 4HGZA 3COZA 3EDOA 2HWKA 1J06A 1DUIA 3R0JA 2O5VA 2PGJA 5HQ3B 2HMVA 2A4MA 4B79A 1M0WA 3GHYA 5HNKA 1FTGA 2IUTA 5CMLA 3HB1A 4NH0A 3WMXA 1IYZA 1XTVA 5IVIA 1C7IA 3E81A 4UEWA 5J4LA 5CDUA 4U7GA 1G2OA 4QUIA 2ONKA 3TIFA 3PDUA 4BRWA 3FGNA 3MD0A 2EKDA 2GN9A 4DLPA 3BGOS 1BX0A 3PNOA 2QX6A 2RMKA 1DX6A 5KMGB 4EW6A 1R4AA 2C07A 3SK0A 3I2FA 1WP4A 1C4WA 3MJEA 2PGAA 5A3QA 4NK5A 1R00A 3HVJA 1FVFA 2HU8A 1QF9A 2NPOA 2C4TA 4FFBA 5C1OA 5KYXA 2R1ZA 1IOVA 2QMQA 2NO9A 1DRJA 4NHEA 4PQFA 1JIVA 3LBHA 3VH2A 2JCVA 3PJVD 1FNDA 3IAS6 2XRMA 1N3IA 5SY6A 3WK9A 1YKGA 2PWZA 4JLWA 5IDXA 5D3MA 1Z4PX 1OHHD 3JATA 4P4UA 2OCAA 3W5UA 1CUBA 4KC0A 4D4HA 1BX3A 2Z1DA 3GVIA 3KEFA 3P32A 1XTPA 5KSWB 2FOIA 4NBNA 2BFMA 3ZHVA 1G6OA 2CLOB 2FOXA 4LY9A 4EGFA 5DYIA 5FUQA 3PGMA 3PYXA 3RS2A 2D1TA 3TLZA 3RAFC 2XXAB 3A6FA 3QLEA 4M1SA 1NAIA 3RGGA 3V3TA 5KX5A 1QZUA 1RJGA 2OBLA 1RC1A 2ZUTA 2OTCA 2WVHA 4WEOA 1L8XA 5EG5A 2ID9A 2IZ1A 2Z2ZA 1G8MA 2AK2A 1XT6A 3K6SB 1AB5A 4IHJB 2OO5A 3EZ2A 4GEGA 4MULA 3K7EA 1YVRA 4CF3A 1KWKA 1TAHA 3U62A 1LTKA 4LQCA 1PJ3A 1RLTA 2H9IA 4CKBB 1G6KA 3K5PA 2ZWAA 3A4IA 3PD1A 2O8DB 3JRNA 4RSRA 5DGIA 5D1NA 4IIXA 4B81A 3AHGA 4D3DA 1U2DC 5DNWA 2IZZA 5KYGA 4ARZA 3A1DA 1NYQA 4YPFA 2HREA 1B3RA 1WF3A 1JAXA 4HAZA 1M83A 1ISJA 4PZPA 4XGQA 5DJ5A 4HCJA 4ZEVA 5HKAA 1IHYA 4F38A 2CFIA 5KWVA 2IDJA 4J29A 5C1PA 1Y9JA 3GFRA 4OSOA 1NJFA 1W46A 2HSWA 3H8JA 3TD9A 1H2FA 4LE2A 4OMDA 3S6JA 2WAMA 2ECPA 3WKCA 4OX9Y 3DVLA 3CWCA 3GGCA 3NNNA 5AXCA 5H81A 4HMQA 5B3JA 3VV2A 4Q3BA 1QFJA 3VR2A 1V5EA 4YC7A 5C5CA 2QMHA 4JA2A 2G09A 4TMFA 4WADA 4XDGA 3DBRA 1DBWA 1DX4A 1N1EA 4I50A 2HRRA 1MABA 2FMUA 4KKVA 4L0DA 4MR9A 3I83A 4JCOA 2HTFA 5JNUA 3BXFA 4I1SA 4GX5A 4GSLA 5LP1A 3OQMA 2WEKA 3OOYA 4FGKA 3ZG6A 1BE1A 1P7YA 2G1KA 4XX0B 3KKLA 4Y2HA 1CEYA 1PL8A 4FFOA 3RAJA 1U90A 4OVKA 3K0SA 2I6SA 1ZFLA 3WFJA 4FJ0A 1Y8RB 3PI6A 2O2ZA 3QMVA 2GB4A 4J9UE 5K0JA 2P69A 2PUEA 1DADA 2AFIA 2FSVA 3DOEA 1O0CA 1H4QA 3ILYA 4A36A 2BKXA 1WUTA 4CKEA 1X15A 4MJLA 2OGWA 3HSYA 2Y4OA 1JBQA 2FB9A 3WFZA 2FZGA 1P19A 3GA7A 4EKNB 5IJAA 1ZLXA 5BV1A 3VNSA 2PFKA 2I8AA 2Q41A 3DCNA 4DMGA 4R7TA 1ZA2A 3S2FA 1A9YA 1Z7EA 1YB6A 1Z2DA 2VJYA 4LK2A 4J3NA 3RHZA 5JQWA 3NHZA 4CLOB 2G1PA 3WK7A 4GX2A 3OD1A 2AQKA 2WUDA 4MK4A 3C3CA 3BJZA 2ZJ0A 2XAUA 4TLBA 2ZU6A 1PUJA 3WMRA 3GLGA 4DSZA 3G1WA 4A0FA 4UTNA 2P8JA 5BVGA 4KMRA 4QPCA 4B4VA 2BGIA 2YZNA 3A2LA 2O05A 1X7WB 1Z12A 4MUJA 4TWZA 3USES 4UPDA 2CD7A 2OAGA 4WXEA 4CMEC 2Q8PA 3IT2A 4P2GA 3LYHA 1QFMA 3ADKA 3PNQA 4L5IA 4JI7B 4LOHA 1PK9A 4QU8A 3T38A 3LO5A