3G2MA

Crystal structure of the glycopeptide n-methyltransferase mtfa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
265
structure length
232
Chain Sequence
b'PVRTPHADVLLASVVLCDFYADGTSEAREFATRTGPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERLHVRHLPAEEIQEITIHPADEDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCZA361.24
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
total genus 67
structure length 232
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.40 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2mA02
4RYLA 2IIPA 3MTIA 3P9IA 5EC8A 5T67A 2YUIA 1XDSA 3EEOA 4FS8A 4C04A 2IBTA 1RI3A 4GOLD 1JG2A 3B5IA 3LDFA 3CGGA 4OQDA 3HTXA 2B2CA 2G1PA 2DULA 4PCAA 3P2KA 5HILA 3TM4A 3DLCA 1BKYA 1L3BA 3UWPA 2PT9A 3R9XB 3HCCA 3FRIA 2IPXA 2ZULA 3JWIA 1ORIA 1DL5A 3LX6A 3NVMB 2ESRA 3B7PA 3R0QA 1N7JA 5CVUA 2PGXA 5FWAA 3THRA 1RI1A 1ZGJA 5BW5A 2ZCJA 2PY6A 5E2AA 3DXXA 3M6WA 3KU1A 2CMHA 2DPMA 4HRAA 2ZIEA 3BUSA 4YMHA 5KS2A 3A27A 3AJDA 3T7RA 3GXOA 5ICEA 4RTMA 3KKZA 4YV0A 4YUVA 2PSSA 1X1AA 1XDUA 3B3GA 4R6XA 2PXAA 4EKIA 2JH8A 4WVLA 4LECA 4R05A 3BWCA 2LD4A 2AOWA 3ID6C 3IV6A 2AR0A 3PS9A 4OBXA 3KQMA 3SVZA 4DCGA 4Y2HA 5JR3A 4KDCA 4M37A 3GRYA 4PWYA 5ICGA 2JH9A 2ZFUA 3G5TA 2IH2A 5FWDA 3LBYA 3M4XA 4PIPA 5ICCA 3LPMA 4PINA 3LCVB 5CM2Z 3V97A 8MHTA 2Z6AA 3OPNA 2WK1A 1I1NA 2AVDA 2ZW9A 1Z3CA 3P9KA 5FTWA 3FZGA 2NP6A 4ISCA 2PBFA 2OPBA 3EGVA 3GRRA 1JTEA 3PFHA 1IM8A 3PX3A 2OBFA 2UYQA 2I9KA 2QM3A 2A14A 3DOUA 2H11A 1HNNA 3EMBA 4KVZA 1BC5A 4IWNA 2AOUA 5ERGB 1O54A 3ER9A 1WZNA 3BWMA 3NW9A 2B78A 3BKWA 3HA5A 5CD1A 4X60A 3FPHA 5U4XA 5CIYA 1O9HA 5CVDA 2EX4A 3OE4A 3UBTA 1PRYA 4RVFA 3I5UA 5CVJA 5LQUA 4BY9E 1R6AA 2IBSA 4QPPA 5LQNA 4C07A 4KDRA 4AX8A 4F84A 5FHQA 1KP9A 5D1NA 4DA4A 2ZTHA 2BR5A 1TPYA 3G88A 1ZKDA 4GF5A 4NECA 3SM3A 1JQ3A 2JHAA 2C7RA 5GINE 1JQEA 2V7EA 2PT6A 2HV9A 2EFJA 3HVJA 5DT2A 2BM8A 3FPFA 1P91A 2ZBRA 3GRVA 3ORHA 2OB1A 2YXDA 4AZTA 1H1DA 3C0KA 4LG1A 2P7HA 3I58A 5EHGA 2PWPA 3O7WA 4QQNA 5DRTA 4CTJA 1JR4A 3MCZA 2XVMA 4AZVA 1EJ0A 2QRVB 4E2XA 2FK7A 3HVHA 3MAGA 2Y1XA 4ER3A 3NDIA 3PB3A 1EG2A 1D2HA 3FUVA 4EVIA 5K03A 3I9FA 3G8AA 5DM1A 3T0IA 4XUDA 4MHTA 3TOSA 4P7JA 2NXCA 1G8AA 1MHTA 3KQSA 3ER8A 2YQZA 1ZQ9A 4RTJA 2P8JA 4U7PB 4CWAA 3CJQA 3KPVA 2JHCA 1G8SA 4XUEA 1JG3A 4ZTBA 5EZSA 4B17A 3G2QA 1KR5A 4E32A 5EMMA 2IDKA 3BWYA 1FBNA 3DMGA 2Z6QA 5EKXA 5IH3A 1KPHA 4GBED 2F8LA 2FPOA 2P7IA 3FPJA 4YMGA 4DMGA 5LSAA 1R8XA 4X1OA 3TFWA 5DXAA 4FT2A 9MHTA 2QE6A 4RTPA 2UYOA 3M6VA 5E1BA 3SR4A 1JG1A 2O05A 2P3OA 3M6XA 3NWBA 1O9GA 5GIPE 1NW8A 3PT9A 3G7UA 2P3LA 2Q41A 5T64A 1KYWA 4QVGA 3GU3A 4RTQA 1KPGA 1X19A 3AXSA 5DWQA 3HA7A 3HVKA 3R6TA 3G2PA 5FULA 4C05A 4E2WA 3EVCA 3C6KA 2QRVA 3EVZA 2K4MA 3EMDA 5BXYA 2GH1A 3FUUA 4HGZA 3P97A 5FQNA 1ZGAA 3UA3A 1XCLA 5C1IA 1YB2A 2PKWA 4YV1A 2CKDA 2AN5A 1KYZA 5DSXA 5E9JA 4F85A 1NBHA 1VBFA 4HSGA 3PTAA 3IEIA 2XYQA 3KPYA 5B1SA 3B3FA 3ELYA 4H0NA 3TLJA 3HCAA 3O31A 3SXJA 1Q0TA 2AOUB 1YZ3A 7MHTA 2H1RA 2XYRA 5D1HA 2C7QA 3GRZA 1RJFA 2HTEA 4OBWA 1I9GA 4HH4A 4RX1A 4YV2A 5K0CA 1ZHFA 2B9EA 1RI5A 3FPEA 2I62A 3AXTA 3BWBA 3A7EA 2YVLA 3NDJA 4IV8A 1SUSA 2ZLBA 3DLIA 3FTCA 1L1EA 1NKVA 1TW3A 5LR6A 3OU6A 1MJFA 3V8VA 1SG9A 3P2EA 3TKAA 4LWOA 3HNRA 2AZTA 2ONZA 4RVDA 1VLMA 3SSNA 5E1OA 4GOND 5C9ZA 5EG5A 1N2XA 1G60A 3TPZA 1WXXA 2XBMA 2AOVA 4C03A 3EVFA 1RI4A 3G2MA 1UIRA 4QDJA 4K6MA 2FYTA 3MGGA 3AWIA 1YZHA 5K0LA 4PYJA 5E9QA 5EQJB 3MTEA 1BHJA 3UJCA 1N7IA 2BM9A 4RSRA 3RODA 4C08A 3NJRA 3GNLA 3X0DA 3JWHA 1R74A 2HWKA 4L7VA 2FRXA 1D2CA 5K09A 5LQAA 3F4KA 3C6MA 3KHKA 3QOWA 5LQCA 3S68A 3R24A 3LDUA 4AUKA 1VL5A 4U7TB 3HM2A 5E8JA 4GOOD 4RWZA 3NVKI 3G5LA 3IYLW 3KPJA 3R3HA 2ZIGA 1OR8A 5EGSA 1RJDA 1XXLA 3CVOA 2O07A 3CJTA 2WA1A 5EEGA 4P7GA 2VDVE 3EPPA 1PJZA 4QTUB 5E2BA 4P7FA 2YXEA 3JWJA 5F2KA 4QDKA 1SUIA 1X1BA 5EZQA 2I6GA 2KW5A 3KPWA 4RTRA 3GGDA 5EOVA 3EVEA 4QTTB 2OYRA 2PX4A 4MWZA 2HR1A 1DCTA 5MHTA 5M5BA 1V39A 2UZ4A 3D2LA 3O4FA 10MHA 1AQIA 3OFKA 3FPGA 3RIEA 3BT7A 3G8BA 1TW2A 2VP3A 1AF7A 1NBIA 3I53A 4M38A 4YUXA 3NMUF 4R6WA 3KQTA 3E8SA 1RJGA 4YUZA 3UJAA 3A25A 3K0BA 3ELUA 4FSXA 5HOQA 4HGYA 2ZZNA 1QAOA 1SVUA 2CMGA 2GPYA 5K0JA 1R18A 2XVAA 4RTNA 3BGDA 4KIFA 4PYLA 4BLUA 4PYOA 2E5WA 2C7OA 3CC8A 2BH2A 1HMYA 5IKMA 3KQPA 1X1DA 2B25A 3MQ2A 2GA9A 2PVCA 3SSMA 4RV9A 2ZBQA 4EK9A 2V74B 3LCUA 3HCDA 1UFKA 3KR9A 3UJBA 4KRGA 2AN4A 1WG8A 3PVCA 3UJ7A 1NE2A 4E30A 3ELDA 3FUWA 5DM2A 1L3CA 5E1MA 4ER6A 2IFTA 1XVAA 3DXZA 1I4WA 3OU7A 3QV2A 3VYWA 4XUCA 3DR5A 3OZRA 4X63A 3ERCA 2GB4A 4CKEA 2G72A 4FT4A 5FA5A 4OA8A 3MERA 3LDGA 5LQKA 1KXZA 3B3JA 4MQ4A 4X61A 2P3QA 2QY6A 1SQFA 5DLYA 5GM1A 2ORED 2I7CA 2R3SA 2AN3A 3IHTA 2ZZMA 5DPMA 1JSZA 4OA5A 4DM3A 2CL5A 3OCJA 4IV0A 3ELWA 5JUWA 4RTSA 3CJRA 1XJ5A 5DX0A 3UFBA 3DMFA 1NV8A 5CCBA 3B89A 3GDHA 5EKUA 4PCLA 3OZTA 2O57A 3A4TA 3GJYA 3LL7A 4R8RA 1IXKA 4AZSA 1B42A 2AVNA 4ER0A 1FP2A 1VPTA 2ONYA 4PONA 2EJUA 1Y8CA 5DX1A 3KR1A 3TR6A 3THSA 4C06A 3TRKA 5DM4A 1F38A 5CCXA 2AS0A 5BW4A 1T43A 3GIWA 4QPNA 3LGAA 2ADMA 5EMJA 2P35A 3Q7EA 4R8SA 3TQSA 4PNEA 2ZZKA 1G6Q1 3OFJA 1FPQA 4PIMA 3DMHA 3E05A 5DM0A 3L8DA 2HNKA 5K8VA 5GM2A 5K0FA 3GO4A 1F3LA 3UZUA 3HVIA 1U2ZA 2ZVJA 5KYGA 1YUBA 2NYUA 5FA8A 4E2YA 2IH4A 2EG5A 5E9WA 3DP7A 1VIDA 2FK8A 3RW9A 4YUYA 2ERCA 3A7DA 2OXTA 4HG2A 4M36A 2IDJA 3FRHA 2O0LA 3LCCA 3LKDA 3P8ZA 2YTZA 1QANA 3LECA 3T7TA 5LQJA 1R8YA 4A6EA 3UJ8A 3HA3A 3KQVA 4KIGA 4CXMA 2OZVA 4DZRA 5K0BA 4XCXA 5P8WA 2IH5A 1NW6A 1VQ1A 5EIFA 2JG3A 3FUTA 5HIMA 2ZWAA 5HIIA 2ZWVA 3UJ6A 1YF3A 2VZ9A 4OX9Y 4GC9A 1INLA 2GLUA 3CKKA 1ORHA 3SX0A 5GWXA 2PXXA 1P39A 2G71A 3GRUA 1EAMA 3KR2A 3VC2A 4UOEA 1M6EX 2Y1WA 5BP7A 4PYKA 3DXYA 5EHIA 4FP9A 3HP7A 3FTDA 4IKPA 5DTQA 2PWYA 3SSOA 2PX5A 4FR0A 4CKBA 3MCTA 2PLWA 5FCDA 5HEKA 1WXWA 4GEKA 4BP1A 2OO3A 3LHDA 3EGEA 4G56A 2GS9A 3KQYA 2FHPA 3EVDA 2B3TA 3M33A 3HEMA 3UJ9A 5FUBA 2Z6UA 2G70A 5KQRA 3KQQA 4EQZA 3UJDA 1AV6A 2OKCA 4P7KA 2NXNA 2O06A 2YXLA 3BXOA 4FGZA 3UA4A 1AQJA 4ATNA 3FTFA 4HTFB 3KQOA 1G38A 4RTLA 2BR4A 3M70A 4FZVA 3NTVA 4E31A 4RVHA 3FYDA 4EKGA 3REOA 5FHRA 4Y30A 3BZBA 1XDZA 3DUWA 3JWGA 1XTPA 5HIJA 4HC4A 3EVGA 3HCFA 5GP1A 2P41A 2UYHA 3M6UA 1YFLA 3SMQA 3PLAE 2NXEA 5CUQA 4BP3A 2OB2A 3E23A 3P9NA 1X1CA 3U81A 5GIOE 5DXJA 2YR0A 3LSTA 4BLWA 3BGVA 5F2NA 3G2OA 5HFJA 4GOMD 4ER5A 1YFJA 1VP9A 5DTRA 5EIWA 1L9KA 4PGGA 4DKJA 5DTMA 1NT2A 2YX1A 5K0NA 1M0EA 5K0EA 3TM5A 2IP2A 1NW7A 1FP1D 5EPEA 5K05A 4P58A 5EMLA 5H02A 3VSEA 3H2BA 2WA2A 1VP3A 1FJXA 3DH0A 3HCEA 5E8RA 2VS1A 4RTOA 2BZGA 1SQGA 2GAFA 5HZMA 2G8NA 2NXJA 4PYNA 1JG4A 1RI2A 3PFGA 5LQRA 2UYCA 3AY0A 4OQEA 3P71T 3BKXA 2XYVA 3QOXA 4EMSA 5C0OE 4AZWA 1UWVA 5EVJA 2BR3A 2AOTB 4LWPA 1QAQA 2P40A 3EEYA 5E1DA 4DF3A 1XCJA 5K01A 4ER7A 3CBGA 3LKZA 2CWWA 1JSXA 4HTFA 1RJEA 4GC5A 2ZSUA 4V0RA 2JHPA 5CVEA 4YUWA 4QQKA 2C7PA 4Z2YA 3HCBA 1VE3A 4BLVA 3VC1A 5K0GA 3SGLA 2EJTA 4RVGA 3EVBA 3WSTA 3DTNA 5FADA 3FTEA 3C3PA 4POOA 2HMYB 5EMKA 1KIAA 1JQDA 3OE5A 1EJ6A 3GWZA 1M6YA 3BGIA 5G02A 4RTKA 2H00A 5ICFA 1SKMA 2N47A 3TKYA 3FUXA 1L3IA 5CVVA 3NWEA 4E2ZA 4A6DA 1NV9A 2PX8A 4F86A 2PXCA 2PV0A 3ANXA 3CCFA 3ME5A 1JTFA 3TMAA 1KPIA 4PYQA 1QZZA 1Q0SA 2AOXA 3KR0A 5DSTA 4FSDA 4GQBA 4X41A 4DQ0A 2VDUE 1D2GA 1P1BA 4E70A 3EVAA 1QYRA 1G55A 1BOOA 2IGTA 3Q87B 4KW7A 2QYOA 1IY9A 4WXHA 3MHTA 3G89A 3A26A 2P1DA 5F2OA 5FQOA 2R6ZA 4C4AA 4E33A 3MB5A 1EQAA 4MIKA 3PX2A 1P1CA 3K6RA 5DX8A 5EEHA 5KQSA 1NW3A 3C3YA 3E7PA 3T7SA 2ZBPA 4DCMA 1KHHA 3P9CA 1QAMA 2AOTA 4PYMA 3EGIA 5GOZA 3I64A 4M7RA 5T6BA 3LBFA 1EIZA 2VDWA 4KWCA 5DRYA 1R00A 3OU2A 4QVKA 2NNWB 5HIKA 2FCAA 3GCZA 4O29A 5KVAA 3FYCA 1NW5A 2PX2A 3DULA 1DUSA 1ZG3A 3KPUA 4PYIA 4CTKA 1WS6A 3P2IA 2NP7A 2PJDA 2OY0A 2ZIFA 4GUAA 4CKCA 4JXJA 4PGHA 1WY7A 2JJQA 4V0QA 3KQWA 3OZSA 4MTLA
chains in the Genus database with same CATH superfamily
2VJNA 1E2JA 1GSIA 2PG3A 4B3GA 3NMUF 2QR3A 1UJNA 3C45A 3CUVA 1XZKA 2GBFA 2HKIA 3DVSX 4XYMA 1EGHA 2AF3C 1QOQB 3GLSA 3IIEA 4A2PA 4L22A 3CGWA 4ND5A 2G0NA 2RCNA 3HCNA 1E7MA 3ZW7A 1YXMA 1MRZA 4BGDA 1VLJA 3COPA 1GRRA 4GXTA 5NLLA 2F1RA 4R71A 5BORA 2X58A 2I6XA 4P38A 2PMBA 4QFDA 1LC0A 4EGAA 3THRA 2ESRA 4KREA 1V3VA 1PWEA 2PS1A 1IOVA 1R0CA 1U4OA 1X7ZA 3U4CA 3FNQA 2CE7A 4EHAA 4ZYTA 3JAWA 4NMMA 2EATA 2NG1A 1TEZA 2JBHA 5JALA 2D7JA 3KL4A 1QMGA 1MV8A 1E2NA 2PSSA 3ZHZA 4MVCA 3K20A 1OAKA 4GD3Q 3CKMA 3NFYA 1SZJG 4A0GA 2B94A 3HBAA 4Z2AA 2A94A 1O57A 2V96A 3WKBA 2P69A 4S1NA 3I9NA 2JGLA 1UDAA 3EN0A 4G0MA 1U99A 3LHIA 1OB2A 5HUQA 1USWA 2VF2A 4ZRNA 3WIUA 4LVCA 3E15A 1CF4A 4IQGA 4CMKA 3SR0A 3ODGA 3E3AA 4MYRA 4ZVVA 1T4CA 1UDBA 2PKRA 3D7KA 1TX4B 4ISCA 2Q0QA 5DTJA 4F8JA 5AVQA 1W25A 4HNQA 3AUKA 3HDQA 3VPHA 1X1TA 3WO0A 2H11A 1HNNA 3QOYA 3K71B 2X0FA 1HNXB 1DKPA 4DR7B 1TUGA 1B7GO 3IALA 3TWOA 1SHKA 4X8LA 1K0UA 4QU8A 1CZUA 3ZWPA 3NHUA 5LXTA 3FPHA 3K4QA 4N12A 4P4TA 1ESDA 3K8YA 3OE4A 4PCUA 5F33A 5CIYA 3KD2A 4IM7A 3R9WA 3CE6A 1V4NA 2XUGA 3VA7A 1K92A 4QRHA 4WCDA 4CMEC 2HGZA 5LQNA 3W5SA 5IVIA 1KP9A 3GYBA 5CNMA 5LN1A 1PNVA 2BJWA 2AD5A 5IX8A 1CYDA 3LK7A 4F3TA 4RV4A 2D7CA 4WV3A 3SR3A 3CZMA 2V7EA 3TI7A 1P1IA 2XMSA 2SKDA 1Z68A 2X14A 3FPFA 1F1BA 3IHLA 1Z0UA 3O3OB 4DV1B 1BDIA 3F7TA 4QHYA 2XBMA 3HGMA 4G1VA 2ZTSA 3BXGA 4YP0A 3O1HB 5HHTA 4L08A 3LY5A 5E7QA 1C7FA 1JHRA 2I6UA 2X40A 3LK6A 5BR7A 2C2HA 5IVHA 1M2FA 1U5CA 2R6JA 3AGQA 5FO0A 1BXRA 3NLLA 1PDWA 4KO3S 4S2UA 1X3SA 3P9PA 4JASB 3LT1A 1XV5A 2WKWA 4ZK2A 3IODA 1IHPA 1D2HA 1XR3A 3AQIA 4TYPA 4JEUA 3PQ5A 3JQPA 4OHCA 4I50B 3QX9A 5EESA 1XB2A 4WAUA 1RAIA 2ID7A 5TVGA 5TY0A 4EB3A 3IPRA 3SOPA 4GZ6A 3CZRA 2R68A 2HSGA 1L5RA 2H51A 2LBPA 4YT5A 1EESA 4R1MA 1JG3A 1W48A 1QJCA 1SXHA 3CH6A 4MAFA 4WI1A 4E32A 3VYUB 1UP7A 4CMGA 1SVNA 3BMQA 3TDMA 1NVWQ 5KYWB 2H18A 4YI3A 3AP1A 1QF6A 2FF7A 1KI6A 5CTAA 2OHOA 4QDUA 1MU0A 4WLEA 4HQ6A 4FZ5A 4X1OA 5BYBA 1Y5LA 1YQTA 1LS6A 4IIUA 4D7AA 4D79A 2R5NA 4MUNA 5CPBA 5D6NA 1ND6A 2GA8A 1EM8A 1CQIA 3ZU3A 2GSWA 4BQSA 3JAMA 4WKOA 3U9LA 4C3UA 3GROA 5T64A 3CYFA 3KAJA 2WVAA 4OMDA 5ENZA 4CNBA 5DCLA 2M1ZA 3H9UA 4WKBA 1BWPA 1OGJA 3HA7A 1N8TA 2R00C 1VSUA 2JJMA 2TMGA 1FSZA 1GTMA 2D8AA 4PAQA 3UW3A 2FWMX 1BW9B 3THYA 2G80A 4GE0A 1Y1RA 4MW6A 1DTWB 2WHPA 1YU9A 2ZAYA 2CKDA 2W48A 1Y6FA 4E15A 1JR3E 2DF8A 1MQAA 2VT3A 3SF8B 1KJ8A 4EFLA 1T10A 2VP4A 3MWFA 3SBDA 3ZOZA 3FYTA 3CUTA 1TMYA 3GZNA 3DEAA 4HZUA 1W5TA 3O8RA 1L4MA 3ASUA 2Q1XA 7MHTA 4C01A 3OQIB 1GAWA 4W7IA 1JG6A 2EF0A 3H5AA 4BN5A 1LV7A 2WTBA 2B69A 5IBCA 1ZHFA 2FH5B 3FPEA 2X77A 2NYVA 5JAUA 1QFZA 1MO3A 5JPIA 2YV3A 4JSYA 2RBGA 3ILXA 1GPLA 4M1SA 3ZDFA 2EXXA 2A1TR 2F3UA 4JVLA 4RPHA 4X8OA 5A4FS 1VYTA 4MR8A 3MAJA 3P2EA 5DK4A 1X9GA 2R65A 3SK0A 2HWWA 3A3KA 2QP3A 2ONZA 2JEYA 3IQDB 1Q21A 4G0OA 2LRHA 3UGKA 1J1IA 3KQKA 4R0NA 1J20A 1TQ6A 1UQRA 2VHUA 5JNWA 3FHLA 3HU3A 4RMNA 2CCKA 2X7HA 5THXA 3U3DA 3EVFA 4I1VA 4JGIA 4LAFA 2Z4TA 2CXPA 1EGMB 2X7JA 3FFTA 5A6SA 3RVPA 5C32A 3LE8A 1W59A 2RCYA 4E07A 3QGMA 3M9WA 1MC4A 4LIPD 1Q74A 4M88A 5AUOB 1AKNA 5ALJA 1TM4E 3WJ2A 2AGVA 3VFDA 3WQRA 2IYZA 3NTXA 2PUVA 3D59A 3TLXA 1Z73A 3IAS6 3AFOA 4LJKA 2ZUCA 5GY7A 2VAWA 4PSVA 5IDXA 1GADO 3N8NA 5ILGA 3HM2A 3I2HA 4RWZA 4KFRA 4YCAA 1I6WA 3BC1A 5LYYA 3PXCX 1ZMBA 4MPRA 4PC2A 1GNRA 4BC0A 4MQFB 2EEZA 2ZQZA 1J2YA 1EE2A 1RQNA 5EJ7A 1GN9A 1HRKA 3CJTA 3UN1A 4ZYXA 2AJDA 4IJ5A 5LZ7A 3UXHA 3DAYA 4P7GA 4JENA 3WZLA 3ZHOA 1WXFA 5FPYA 5C18A 3NRCA 4JI1B 3RT1A 3BHNA 1G2QA 3PHGA 4MS3A 1FRNA 1RTTA 4D96A 4LJRA 3I73A 5TQ0A 3EDOA 3IT1A 4OD0A 4MWZA 2OO5C 4EFKA 4LGYA 1XDDA 4OHVA 4R1TA 2ADFA 4FYVA 1JHPA 2VTBB 1WXDA 4RL6A 3MSCA 5EE0A 4MKZA 1N0UA 1Z2DA 5COAA 3RIEA 4LF4B 1KNXA 4GR9A 1NVUQ 3IXLA 3AVPA 1OWPA 4J8PA 3AG5A 1IZ0A 3ZCQA 3K0BA 4MWDA 5DOZA 1QAOA 2BFOA 3LF2A 3KALA 1TM7E 4DREA 1XVTA 4H31A 1L4YA 1R18A 2NQ8A 2PGNA 1B23P 3DUFB 4D5EA 1OASA 1XQ1A 2P9FA 1EBFA 3CC8A 4PLPA 3RC8A 2WWTA 1SOWA 4HSCX 1TLTA 2QRZA 1W1IA 3E1KA 4IRUB 2X0JA 4N8SA 1A82A 1R50A 2IJGX 2W83A 3Q9UA 3W8NA 2MYTA 4IS3A 3S1LA 4Q93A 1JIUA 2A9VA 1KYTA 3F74A 3UJ7A 4H6XA 4P3KA 2QD2A 3ZCXA 4ZOLA 3ZWCA 1RKVA 5K8UA 4QAJA 4YRDA 1OHHD 4AYTA 3OHPA 1CETA 3DR5A 1T8WA 1XEWY 4XUCA 4DYDA 2GB4A 3ZZ0A 1FLNA 1DAIA 2O23A 1U1FA 3C8UA 4FT4A 4OA8A 4UUQA 4JCOA 4DIUA 3T38A 4XX0A 1M1UA 1NLFA 5CLGA 1LZLA 2IELA 3KYDB 3C1OA 2I7CA 1A9YA 2GBCA 2ABWA 5I9SA 4LXTA 2IEZA 5C3UA 4BP9A 5KNCH 4DM3A 2VUIB 3FWNA 2PE5A 3CMMA 3CNQS 3ZHCA 2JGKA 1NRXA 4AMVA 5J1SB 1FJ2A 4FLMA 1NV8A 2CBXA 4OUDB 5CCBA 2FQQA 3HI4A 3O95A 3JWPA 3OJ0A 4Z53A 1AZTA 4PLVA 4D1YA 3MWDB 1FP2A 4NVRA 1XQXA 1YR9A 2ZP1A 1YS9A 4ESOA 3WIOA 1SBNE 1T2DA 4K9DA 5C51B 4C7KA 1ZN9A 5JHGB 1ZPDA 1JIIA 4M86A 4PHHA 3QE2A 3TTYA 4JJ7A 4NMHA 3QQ5A 1PJTA 4QTXA 4BLSA 2FSVC 3EAGA 2W22A 5AOCA 2A7QA 3RHSA 5JXIA 3KXDA 2JGMA 2QZZA 3X1YA 3D54D 1QXSA 5ANRB 3OOJA 2F4NA 2WHXA 5EXXA 2R6DA 4OM8A 1KFJB 3DZIA 4WLOA 1MJGA 4K1XA 3HVIA 3IUQA 1VE5A 4NZNA 1QRAA 1D2MA 1CY1A 1E7WA 2Q45A 1U8CB 2FR8C 3WGNA 1M1ZA 2J5XA 1G17A 1HKUA 2AV6A 2AX4A 3OCVA 1WZEA 2ST1A 3R23A 4PE5B 4TRMA 4HG2A 2Z0MA 3I6YA 5JQWA 3AFMA 1E59A 1T3ZA 6GPBA 2XUPA 4F5DA 1E3TA 2BTQB 1G9XA 5IJAA 4Y1RB 2PYIA 2DFTA 3OPQA 5TJ9A 4C87A 4KR7A 2JS7A 1IWBB 3OG9A 4MUBA 4ZAXA 2RIRA 5JI2E 3ZWAA 3RSZA 4BE7B 4C3OB 4DZRA 5K0BA 2WU0A 2VJLA 4MUIA 4WA7A 1V1RA 2IH5A 3BBPA 1FVOA 3C5VA 3LY8A 3LY7A 1F48A 1U28A 2O7SA 4Q7KA 4RZSA 5BUQA 1GUDA 3GV0A 3QVMA 1M6VA 5DTEA 4DQUA 5H3HA 2X15A 5E4FA 5JAHA 4RNDB 2ZDGA 1Y0BA 3E18A 4FCCA 3GARA 3WKDA 5JSQA 4BBJA 5BWLA 4PYKA 5AJXA 4DSNA 6NULA 3HP7A 1HT3A 3K8OE 2W2LA 3H8SA 4MUGA 1FVHA 1S3IA 4IMRA 1TRKA 4V1CB 3DFZA 2OQ2A 1S1CA 1YQDA 3HSKA 3NTQA 5IT4A 3KTAB 3TIFA 4EVRA 3TLCA 2OO7A 5DYWA 5LKRA 2GZMA 3UGTA 1E61A 1T4DA 2O2EA 4INPA 3HO6A 4JR1A 3UWSA 3L1JA 5E3HA 1OTHA 4P7KA 2I65A 2QW1A 2CNNA 3BXOA 1BU5A 2GWRA 3C7KA 3KJQA 2C2XA 3BDVA 4JJIA 4QXRA 3SZ3A 4HDNB 4TSKA 4YCCA 1LW7A 4CM8A 4P98A 2H1HA 4E31A 1U2GA 1NURA 2PDAA 1EKXA 1YE5A 3BXPA 3GWGA 2VHEA 1JJ7A 3QXCA 4W8GA 1OC4A 1MABA 3W5JA 4ZVMA 4PAWA 2IP1A 1CY2A 1UDCA 1XDZA 2L0XA 2O4CA 1AGNA 2VTKA 1KEUA 1X7WA 2PKYX 4L75A 5ALRA 5A0TA 1G5QA 1WDLA 4ZQHA 4MX8A 1SELA 4HT3B 1U7XA 5L53A 3LCRA 3ANYB 5IF3A 2GO1A 2QKYA 3FNGA 4OB8A 4F7DA 4DHEA 4C7XA 3C3MA 4YQYA 2X5OA 3DE2X 1Z45A 3E6AA 3GJ3A 4D45A 5FX2A 4B6JA 2BN4A 3CPHA 5KVVA 3ZDZB 1CUXA 1VP9A 3U0VA 3OCUA 1XHEA 2G08A 2VDKB 3RSHA 3JALB 4HB3A 1QCCA 2YX1A 4DKJA 2CV2A 4TZKA 1DV1A 3T3EA 5EPEA 4LV6A 4P54A 3FYHA 3K9NA 4MHTA 2FB9A 2Q1TA 2Q8PA 4JKOA 2P9CA 3FNIA 3NHFA 5E8RA 2BFBB 3CISA 3HVNA 4NEHB 3T7EA 2GAFA 4JP8A 3O8OA 4HNHA 2X4DA 1JG4A 3HQ4O 3PFGA 3QQPA 3HLKA 3QY9A 5AUQA 3U3KA 1LLCA 3R76A 1IPEA 2EFYA 3I61A 3BK7A 1XKXA 2R7LA 2HQ1A 2NZJA 5JMTA 2JW5A 3I8SA 3M34A 2ONJA 3HM9A 2G4CA 5TT1A 1KEEB 3Q3JB 4NCXA 2D4HA 1Z5UA 2XWJI 3F0TA 2IC5A 3WRWA 5LOVA 1HT0A 3PR1A 3TVYA 3PEVA 4F4UA 2UYGA 2J3QA 1T2FA 3CA8A 3GLKA 1UOPA 2Q0HA 4K81B 2E4ZA 1I7LA 4WBSA 1LX6A 4CNQA 4INZA 5ALHA 1AXGA 4URZR 3OX4A 4TRJA 1U1DA 1GPJA 4DVGA 4B7AA 2PS0A 2ZJBA 2ZIWB 4GW3A 5CNIA 3TEJA 1JA1A 1RJWA 1PT9A 1YCHA 2FUEA 2N47A 3A6EA 1GV1A 3AB8A 2R751 3RS0A 3NYIA 4HX5A 3IKJA 1N3BA 3UMSA 1PNRA 1HGXA 4N39A 4DNXA 2RGRA 1UBCA 1HDZA 3LP8A 4HDMA 5AQEA 5FI1B 2ATCA 4PYQA 3MT7A 3NNSA 3PHCA 1UXIA 2JJ1A 3WLLA 3TF5A 2VDUE 2WINI 1X15A 3P9YA 4QYWA 3TB6A 1JAZA 4AMUA 1G55A 3FCUB 4ZQBA 5F21A 1SHZA 3OH8A 1A50B 3DT8A 4KW7A 3IERA 3T8YA 2ZB4A 3PCRB 3EDQA 3ZWKA 4Q48A 4DQXA 1PFYA 3LRTA 2VNAA 4NMLA 4E5SA 1EQAA 3AI7A 2ODAA 1QHYA 3L04A 1LBHA 4HD8A 2PSHA 2WTMA 3IP5A 4ETNA 4P81A 2H1VA 3UV6A 1Q7RA 3BZWA 4Q4AA 3EGIA 3FOEC 1CRZA 4JH0A 4K1LA 1DBVO 4P36A 5HIKA 1E79D 2FZ4A 3HMQA 4I0WB 1HFEL 5GGYA 2BGJA 4B5LA 5TF4A 4EHFA 3AOEA 1E79A 1H4SA 3IVXA 3TG2A 1ZG3A 2GXUA 1NQXA 2BEWA 3D8SA 2ZYUX 2FFHA 3LZDA 4OFXA 4KR2A 1JHOA 2DP4E 1K4YA 3IXQA 3N3BC 4BGEA 4TGLA 3IX7A 2E49A 3QTBA 2JA1A 4XJVA 3SYRA 3VYSB 5CG2A 5JVDA 4UQOA 3GOQA 1RRMA 2YDXA 2ZB3A 5EC8A 5T67A 4FQ8A 3NHWA 2H2HA 3H16A 4DLYA 4C04A 3JD3A 1ZD2P 5INTA 1F8FA 2QLNA 2BP7B 1JG2A 2GVNA 1T6ZA 2QIPA 2QOEA 3INYA 4II7A 3ZJTA 1RD4A 1Z26A 2WUGA 1Z5GA 3H0CA 3K32A 4C0WA 4G1FA 5IP5A 1BKYA 1FMTA 1R9MA 1VB3A 1OJLA 2Q8QA 2XD4A 4LQDA 3VYTB 4C21A 2IE0A 4EKNB 1I6LA 4NSNA 3OJLA 2QD5A 1TU0A 3GUUA 3R0QA 3QPAA 1ZU5A 2PGXA 4L9AA 3A6DA 3M6IA 3L7YA 4KR0A 1G8FA 3NEYA 3RK1A 1V6SA 1SQSA 1W4RA 5C4IA 1DRVA 3I45A 4FFOA 3DWFA 3E5HA 5D3ZA 5AJUA 5BMVA 1Z8HA 2Z09A 1Z47A 2OCIA 4XR9A 1QB7A 2Q5QA 3T0FA 5CFLA 1ZOPA 4U02A 5HSGA 1JAIA 1XDUA 4RHEA 1V8FA 4EKIA 4Q7QA 3ND8A 1JHQA 3GFSA 3QYAA 3EZGA 2OP0A 3IV6A 1G1AA 2PYZA 1NNI1 1KDTA 2QVYX 4EZIA 2XE4A 3N5KA 4FXPA 2WIDA 1ILWA 3MC1A 4MCHA 3WYDA 4MV4A 4Y1GA 5AVXA 5LJLA 2CDAA 3FPBA 5C4GB 2ZUEA 4NYJR 3F5MA 4RKFA 3FIUA 1Z3CA 3AUFA 1E18A 2OFFA 1PT6A 2CUNA 1DTDB 5CA1B 1FMFA 5SZJA 5FH9A 4L5BA 3IIMA 3IH5A 4E2FA 2P2SA 5AJWA 1R1DA 1JDVA 1RQ2A 3GLUA 2E4UA 3WWYA 1S3RA 1BC5A 1MPTA 1TO6A 5ALEA 1B1CA 5ERGB 5BXQC 3BTSA 4DJFC 5DJ5A 1BH6A 1UM9B 3BKWA 1TYZA 1LC3A 2ZU0C 1WP4A 2JGDA 1YL5A 1E62A 1MC5A 1Q1QA 1ZVKA 2C03A 4CZ2A 1OT3A 1CVLA 1GTZA 4BPBA 4FFWA 1E1YA 4NECA 5C5IA 1D1QA 1I36A 1JQ3A 3I2KA 4ZICA 2JHAA 4DXAA 1XWFA 5I5EA 5CVTA 1R6TA 1DAGA 5HIAA 4YTEA 3UWMA 3N2LA 16PKA 1JKIA 4EO7A 1LXCA 2F8MA 5IM4A 2A67A 3B78A 1NSFA 3HADA 2ZBRA 3VI4B 2IYXA 4LG1A 4Y9UA 3MQ4A 3LQFA 4Q3NA 3VVBA 1Y3DE 1A88A 2AZDA 4GRAA 1Y9AA 2XVMA 4AZVA 1QG4A 2P0AA 2I3ZA 2QS9A 3K5WA 3PXAA 4WE3A 1O9BA 4IICA 2XWBF 4O25A 2GTPA 1UOOA 4TRNA 4IKEA 2IUUA 1T9AA 2X2PA 4QUKA 5CT6A 3WB9A 3NWOA 1DKQA 4WNCA 3X1KA 3ESRA 1DIAA 2J4CA 1Z2PX 1NNEA 3NHRA 3BFJA 4CUZA 1ZOSA 4JYMA 5AKZA 2QG9A 2PSFA 1I2AA 3MIZA 5EVCA 4WIAA 3DDUA 4FYJA 4J0DA 4Y6OA 4MRNA 1VLQA 3WNZA 4DADA 1KR5A 1MX5A 3B12A 3NI2A 4PC3A 3NONA 2IDKA 1B8UA 5FUVA 3MJCA 3OOEA 4BE4A 1PVOA 4GDFA 5K3BA 3IOEA 4MUXA 1NHGA 4GFDA 1SEVA 2BHNA 1TAUA 4LDQA 1T36A 4ZVOA 4GZ3A 3NC1C 3QU4A 2FPPA 3GI1A 3ECSA 3G0BA 4NCNA 3EFOA 3FNBA 2JI7A 3RLFA 5B4VA 2ATEA 1PW7A 3UBMA 5AXCA 5JCOC 2GAOA 3R5SA 3ESAA 1QRRA 1KPGA 5C8YB 4TKUA 2OBYA 2AWNA 1LCIA 2R6FA 1RHMA 4QPJC 3CNOA 1GL9B 3CUYA 4LK2A 4TXHA 5B36A 3ZV3A 1RLTA 3FUUA 5CGZA 4W8HA 3J81k 1JDJA 1ND5A 1WHSB 4ZVNA 3NB0A 1FQKA 4UJ3A 2H0RA 1PGPA 1VBFA 2BD0A 2G8LA 5JZOA 3U7GA 4P80A 1K98A 1YB5A 4KXYA 5FTNA 2PL3A 1J21A 1OFIA 4PLGA 2WIBA 1G8PA 1TM1E 1NFRA 1AB5A 1TT7A 3WYGA 2XLCA 3WBKA 2ZEJA 2ECFA 5FI3A 5EHXA 3DDSA 4IOJA 2QAJA 1CR0A 4P31A 1YBHA 2WWWA 3TNJA 4IDPA 5J2TB 2XUAA 5JQGA 4M0CA 2D2VA 4Z49A 3HBFA 1P2UA 1EX6A 3TZHA 2QRJA 3BGOS 5FO1A 3KXKA 3DVLA 1Z0AA 5CXUA 2IXDA 3RS3A 1SG9A 3R8CA 4KRYA 1QONA 3A1DA 3HNRA 5JO0A 3IQEA 5EWJA 1VLMA 1X1RA 3TD9A 3TCNA 3WLPA 4Y6GB 3TL3A 2G7MC 4NYMR 1L7EA 2ORVA 3EZFA 1SH7A 4BO9A 5LDDC 1FCJA 2YW9A 1RRFA 4B83A 2FEWB 4JQYA 2FYTA 4DTCA 5E2IA 5IDWA 4TV9B 3O26A 1XLWA 4PW0A 4OGFA 5E9QA 4E6EA 4AMYA 1BHJA 1A9RA 1DAPA 2JANA 2H3HA 4GM4A 3M5DA 2H57A 4RSRA 3PF8A 4AF8A 3AEKB 1JP7A 5HKAA 2EGHA 4B9AA 3LT5A 3I42A 4Y2JA 2ES4A 5DK6A 4ITRC 4X64B 4E7PA 4WGGA 5LQAA 1LF0A 2EBUA 4G5XA 4MUKA 4XGNA 1RHKA 2UVQA 3R6WA 2V1XA 4IYJA 3UWKA 5AKLA 5ALLA 5KWIA 3T54A 4YS6A 3VR6A 3G5LA 3KB1A 4YLGA 2IOFK 2WT4A 1RCUA 3M49A 3TCXB 2YVUA 3QW4B 4GVXA 4FB5A 1OJ7A 4Q4HB 1Y9JA 3UTDA 3R6GA 1O1YA 2IY8A 2RK3A 1XTBA 2XYHA 3B1XA 4UAGA 3TZLA 4CKEB 2HBZA 1X7HA 1E2BA 5E2BA 4NESA 5F2KA 5GJWC 3KV1A 1X1BA 1BDJA 2UKDA 1HTWA 2KW5A 2MSNA 2Z1MA 5DYYA 5BN4B 3F8WA 3SXUA 1R5OA 2PZBA 4CIDA 3PRYA 1QHGA 2B6NA 2HRRA 3G8CA 1I2BA 4J1TC 4WKCA 1GUFA 1GGFA 3NORA 3Q8MA 2BHRA 5C53B 2H17A 3ILHA 4FJ2A 2HU5A 2JAUA 2WYWA 3LVFO 4X66B 3H4MA 2VP3A 3I53A 4UUOA 1VDMA 3VR4H 5BSGA 3HO1A 1GPWB 4ALIA 2XT9A 4BBAA 4LXIA 1KI2A 3RT9A 3GG2A 3L7MA 3SEFA 2YV4A 3DBRB 5IAKA 1Z0SA 2CK3D 1M0TA 3PPWA 2PRKA 2OGTA 4F11A 1UINA 3TS1A 2CK3A 4XARA 3HP1A 2X8BA 2EW2A 4DT1A 3D4PA 4ZIRA 5AI9A 3NP7A 2JGEA 4IHAA 4PYOA 5JPCA 3QE9Y 5HBGA 2I8CA 5KJEA 1A96A 3WV4A 1X0VA 2AUMA 2XAUA 2UAGA 3I83A 3TZCA 1WQ1R 4B44A 1FDWA 4CM4B 5CTJA 1ANKA 2NM0A 3VZDA 3V4PB 5EZYA 4NG4A 1DOAA 3D02A 4GSYA 3EWIA 1Y4DE 1FTNA 4C0QC 5E1MA 1GA4A 2R8RA 2O0MA 2P75A 3CEPB 5JJCA 1I4WA 4JR0A 3BTUA 4JS0A 4L5IA 2BBTA 5IARA 5CJ2A 2O5EA 2NUPA 2W90A 3ETNA 5FUXA 4DIBA 1UAGA 3HB0A 1N2CB 2NO1A 1KDYA 4Q4JA 3MMSA 1CR4A 2QI9C 2C98A 1LZKA 3AYXB 4JP2A 3LDGA 3ZKWB 4XE5A 4DEYA 4OOFA 5CRIA 4UPEA 4MQ4A 2X0NA 2W58A 1SQFA 3VJMA 1QK3A 1OE0A 1YR3A 3AVQA 3FAZA 3ZPXA 2GZHA 4CDRA 1O4VA 4OQPA 4V3CA 5I8ZA 3P0RA 1RKQA 4JU9A 5K8IA 3IQHX 2IXBA 1GPNA 1YRBA 2QU8A 3ZLTA 4KTVE 5EINA 4ZCIA 1MX3A 3BXEA 2B1RA 5F78A 3U3ZA 3AIKA 1UBOS 3DMFA 4EFDA 4X1KA 1CJKC 1KS9A 3FZYA 1I80A 2D2EA 1Y37A 4QOGA 3W6OA 3GJYA 3O1IC 1WEHA 5EXPA 3B48A 4D4JA 5T7BA 2ACWA 5K3OA 5TIIA 1QYIA 2LZ0A 1R4NB 2Z9DA 1PEAA 1N5RA 3EXFA 4Q3DA 1QGED 3NWPA 3K31A 4KWTA 1OAOA 4WKGA 3Q9SA 3QG5A 2B4RO 4ZOBA 4D2IA 4DB2A 3EJ6A 2I91A 3F90A 3GJ5A 1E3IA 4KLNA 4MIYA 2J9ZB 2EG9A 4OQ4A 3KAPA 1J07A 1PL7A 5DFAA 5DM0A 3RVDA 1AOXA 5AHKA 3NDRA 4M8SA 4FGKA 4I4TF 5I7WA 3D7RA 1RRGA 1COWD 2ZIXA 3R3SA 2O54A 3TYXA 4I14A 1P80A 3RVSA 2CLIB 1COWA 5FA8A 2VYVD 3VRHA 1APBA 4B3TB 2J1LA 4DXDA 1R8QA 5CDUA 4QM6A 2PAFA 2VYVA 3GHHA 3KHUA 4WMLA 3LPLA 3OWXA 4EJ0A 2QROA 2AEJA 1QFJA 2XUFA 4F2WA 2FAXA 1TA9A 2D2FA 4BLQA 1GR0A 4G85A 1CUEA 3UAZA 3UOWA 3WR5A 3HXLA 3ORQA 3I1YA 4FWTA 1E2MA 5FT9A 3V1MA 3IUSA 2CNDA 4DARA 2OZVA 4KQIA 1J49A 1KVQA 4RELA 3SEAA 3BN3A 4ZZ2A 3JRXA 5BOVA 3AEUA 1YDHA 1SG6A 1UZUA 2JLAA 2NIPA 2C4TA 3BMNA 3B2EA 4GM1A 2B3DA 1HQCA 1O08A 3PP8A 4KGVA 3WWZA 2PM8A 5K8VA 3FPSA 1E3WB 3IQIX 1P75A 4HDAA 3TIIA 1I0ZA 3ED1A 4MDFA 3EUEA 5JTTA 1MB4A 1S9HA 2NZ8A 2Z2KA 3JRNA 4IKOA 5FJIA 5K3FB 2QTHA 4AY4A 3D5EA 4BNKA 4Z0TA 5B6IA 1YBFA 2VCHA 3IBSA 5HBRA 5A9RA 5BSMA 1V71A 2B3TA 3M9XA 3HU5A 4HDCA 1H9BA 3BJRA 3HA2A 3NDPA 2A5GA 3NQ41 4OEHA 4CG1A 5KQRA 3VJRA 1X7YB 1XVUA 2J0UA 2QJFA 5C5EA 2XB6A 3L79A 2H5JA 1M2OB 1UDWA 5HCNA 1JRLA 5TS2A 2XCRB 4HTFB 3KQOA 4MQUA 4NZPA 4JYCA 4X6UA 1RP7A 3WK4A 1LJLA 1N6KA 3I2JA 1KK1A 3OQPA 1XTKA 5GJBA 4JXKA 1XZHA 4FPXA 5CXQA 3O2QB 4J0QA 2C07A 5LJIA 3H9CA 1EVYA 3TNFA 2FQWA 2XITA 5JDIA 1KZHA 2WWHA 3LC2O 3RAPR 3L49A 4K9KA 2QG4A 1S2LA 5G3ZA 2CT8A 5LUAA 3HL4A 1GCIA 3KLBA 3RTCA 3ROXA 2D54A 2VPTA 1BE6A 1QH1B 3EHEA 4JLVA 4RF2A 1YJBA 1IQPA 2QW0X 4R8LA 3SCZA 5DTMA 3P2OA 2OLEA 3GGOA 1EWKA 2EL7A 3HFGA 3F7NA 3LVQE 2HJ9A 1L4NA 3OD1A 2DG2A 3P27A 1YKGA 3H83A 2Q7XA 2IK8A 3PENA 4MB0A 2FWNA 3DH0A 3EQZA 3EQ9A 1P0FA 1KAHA 3ZV5A 5LQRA 3N0WA 3QK7A 4MUHA 3S8YA 1A5AB 2AI1A 4GI1A 3ZEAA 4EMSA 3E4DA 3OMWA 3UXYA 4G0QA 5C0OE 5BY2A 3FW1A 1JB9A 2D59A 1Q17A 1GXSB 2DBQA 4B3IA 1RWNA 1KA9H 4IWYA 4H9GA 3UM9A 3N1UA 4KFSA 3ZGNA 1SXJD 7REQB 3K35A 4ZCPA 2OXTA 1WXGA 5JWOA 5EHNA 4IR7A 1SXJA 1VHDA 2BLLA 2JHPA 4IQFA 1OVGA 4U9IS 4C5AA 2GK3A 2P9JA 3QWBA 1J0XO 3OZCA 2A78A 1ITZA 3TRDA 3UMGA 3W05A 4YDHB 2HXSA 3U7JA 3HJUA 1YC2A 4D82A 5CFNA 3OZWA 4OGLA 1K3TA 4HL6A 3ZE0B 3B6JA 5B30A 1ZCJA 4R2WA 1LS1A 1NUTA 3R20A 5TRTA 2CMFA 2ORIA 1A76A 1L4LA 3WYAA 1CF2O 4CG2A 1CUIA 1FB5A 3T6KA 1ATZA 3L4BC 1HORA 4WJLA 5L4SA 2CLOB 1JS1X 1K8YB 3R44A 4US1R 3CWZA 4ND3A 3TMAA 1PO7A 3BG5A 1BX0A 1ODLA 4V0LA 4IHKA 4YDRA 2Y71A 4G4GA 4N5HX 3MD0A 3O38A 5BN1A 3KELA 3UVEA 1P1BA 1QG6A 1CB0A 3R0ZA 4MV6A 1UBKS 2QYOA 4PG5A 3NKLA 5ALZA 1A2QA 1X7ZB 2Q4BA 2JEOA 2Q5FA 2ZYRA 1CNEA 3MGKA 1NQUA 4P5PA 5AW3A 1K2WA 1L7BA 4FUQA 2HIHA 4FONA 4TMVA 2HSDA 4WADA 4V0ME 1P1FA 4WDRA 3T7SA 1LGYA 3WMEA 1WMSA 3JQRA 1CY4A 5T6BA 4DCMA 1RXVA 2Z5FA 1CXZA 1RPTA 2I66A 5L3ZA 3WSTA 4UDXX 3EZ6A 2Q2NA 1HR0B 1YIAA 4PSDA 3NTLA 3MTQA 2KYRA 3G59A 5LNK6 1CUHA 1N2OA 3IEVA 1YZTA 1FYDA 4OXIA 2YHAA 3TOXA 3ZCPA 4ESHA 5JXHA 1OILA 2P2LA 4G1UC 1FBTA 4BYMA 2EVWX 4JOCA 4UDYX 3LBHA 3SLRA 2RJNA 3ENNA 5JANA 4ZT4A 1T8RA 2OV1A 2SBTA 3KZCA 1AKWA 2R86A 3AVYA 1YKSA 3AUJB 1T4CB 3HFRA 1FS4A 1TQ8A 3FWZA 4OY3A 5DBGA 4EGJA 5HRAA 3M6AA 4GRIA 3EEOA 3CVYA 4D4HA 5H8WA 3C6ZA 4XPIA 1TU3A 4EARA 4CIYA 1H2AS 1H6CA 4LVUA 3HTXA 2O2YA 3DGFC 1M72A 3E81A 5CDFA 1HE5A 1YE3A 3OA2A 5AKJA 2OAP1 4OYLA 2E1PA 1N2CE 7ADHA 3QVWA 2A0WA 3SM9A 4XRRA 1ISRA 3OZVA 1TK9A 4GVPA 4EY5A 2QSUA 3AO0B 4BZQA 2BHLA 2F7SA 4NJMA 2MR5A 4JU8A 4LBWA 3ROGA 1B6RA 3H5RA 1AKTA 4ZGBA 3HCWA 4P3PA 4FK8A 4QDOA 4N01A 2ET6A 3O4VA 2NO5A 3FVTA 4R1OA 5AVVA 1EFVA 3OC0A 1EX9A 1GL7A 3NBQA 2W42A 1U80A 4X93A 5G4KA 3LRPA 1FFXA 2PKCA 1WM1A 4KUGA 4EATA 4EH1A 3GN2A 5B7QA 2I4OA 5L9AA 3S5JA 4WY2A 3RC2A 4WEQA 2OK8A 2BRUA 4YGXB 1BXRB 1ISPA 3KKKA 2XNKA 3FZQA 2X5XA 4G63A 2X76A 3GH3A 4MUJA 3RUIA 5I9BA 3RKUA 4A6XA 2ISCA 5L6LB 1ODCA 1HYEA 1Y82A 4K6CA 4X20A 4AUMA 3K9CA 2ZIVB 1X0XA 3WKCA 5BWBA 2Q5EA 2W8ZA 3FDXA 3H99A 1ECFA 1II0A 1UXOA 4JIGA 1EWRA 5AI5A 1Z6GA 3CVVA 4EG1A 3JQBA 1SBQA 1TQ4A 2A59A 4ZCRA 4BU0A 4B43A 4DJEC 3HH8A 1HDOA 1XEFA 2UUOA 1MGOA 3N2EA 4BO4A 1M2VA 1JBEA 5CVDA 3SX4A 3NASA 4GP7A 5J23A 3UBTA 3I5UA 3MJHA 3IAM6 2QP9X 4QODA 1KI6B 2Y2UA 1D2RA 2V7TA 4LV8B 4PRZA 4YRQA 4ZN6A 1I2MA 4JUFA 2WSSD 3L6BA 3T41A 4EUKA 5AVRA 1O2DA 2AHOA 3T7CA 1EM8B 1CQIB 4EPTA 3KB8A 1ULTA 5DF1A 4YX9A 2RGDA 4DNQA 1IJKA 1LTKA 1QS0A 3ETJA 1QIMA 2FWPA 1I4OA 3Q8XB 3BICA 5B1EA 2NO7A 4JNKA 2FJUA 3SIXA 3T52A 4D42A 2VQEB 2CFTA 3THYB 2BUCA 5FOUA 3FNFA 5FPQA 2FK7A 1JDZA 1WF6A 2WHPB 3IIKA 1KETA 2JH3A 1E64A 3UAOA 1Z39A 5JAIA 1C4XA 1EK5A 1NBOA 3JQ8A 3OT5A 3LOPA 1ZIPA 3EIOA 4M4SA 1DFHA 1T25A 2VH1A 4QYXA 1VL6A 4TVBA 2TRSB 3GA0A 4KX3A 2IPMA 2WLTA 1F2TA 1MAUA 1O96A 3GZNB 1UJCA 10MHA 3MINA 3QA9A 1BCRB 4HZUB 1A5BB 1MB2A 3I6BA 4NEQA 3ZUPA 3SU8A 4L5AA 2UUCB 1YRLA 3GMDA 4NCHA 5FNVF 3ZYCA 1BRTA 3LFUA 1ONNA 2P2CA 1YZFA 4G8BA 2P4UA 4J07A 5LP6A 5E3JA 1CZOA 1FBNA 1AY0A 4BVGA 4URFA 3TTTA 1EVEA 2R85A 2YJZA 5EKXA 1W47A 4WFJA 1Q1NA 2FPOA 1DWUA 1JJFA 1C4OA 1QP8A 4IIDA 2UZAA 4QFBA 1EVLA 4COKA 4YMGA 1A5ZA 4R54A 3MBKA 2C5FA 4HP8A 5A3VA 3M6VA 1V4VA 3UAXA 3AF5A 1MEJA 3PV0A 1NHWA 4IPTA 2NU8B 3HUEA 2Q1YA 2RKBA 2HIAA 1TVKA 3LGSA 1LQUA 3PEFA 3IQXA 4JUAA 1U3UA 4Q03A 5DBFA 1DBIA 4E4YA 2E18A 1QKIA 1TNDA 2JF0A 3COSA 3Q6MA 3RFUA 1Z4NA 1X19A 2D2XA 1KYVA 3E48A 4KAFA 3SLKA 2AFVA 2WF9A 1PR3A 3WNVA 4CEIA 3C6KA 1YFZA 3EVZA 1XMXA 1NOIA 2PQMA 2GH1A 1ZA1A 1ZGAA 2ZJ2A 4WY5A 1XTVA 4WXPA 2GRUA 3U0BA 5A03A 4F85A 2BKUA 2H48A 3PFKA 1Y7HA 5CLIA 5B1HA 4DABA 1U3FA 3N76A 3ELYA 2GEBA 3EZYA 2IV3A 3EWSA 5DTIA 1PR0A 2F00A 3M1AA 1KOFA 4UAJA 3V6MA 2BY4A 2H1RA 5KNBH 4H27A 4N3AA 1WUHS 3SZMA 3T9AA 3TUJC 3MN1A 4A2CA 3QVXA 4D80A 1W73A 5K0CA 2DERA 2NZUG 2IZ6A 4DZTA 3AXTA 1DKLA 2FQXA 3HKEA 1MOSA 1TJ3A 2V45A 1YQUA 3MTGA 5ETJA 3UT5A 2RIPA 2A5LA 4MS3B 1E5TA 4J3NA 3V8VA 3BB3A 4L9WA 2PLRA 4Y1FA 3TKAA 3QEOA 4O8ZA 3ZBQA 4KPFC 3IV9A 3DZBA 2VEOA 3TI9A 4CM3A 3L40A 2O6LA 3BEOA 4H7PA 1XMVA 1SD1A 1V35A 3K2BA 3IVMA 5AT1A 3RUHA 3TPZA 3ZVNA 1SUWA 1IYZA 3LWBA 2XB9A 3ROPA 4BNDA 3R09A 4ARZA 5AW6A 1RI4A 3DJFA 2O8EB 2RGUA 4MI9A 2XKKA 1DWOA 1VLHA 2RGXA 3FNHA 2HZBA 3LX5A 3MTEA 4OQXA 4OXKA 4R8MA 3WWOA 5DN9A 3TECE 2V8OA 3UH1A 1NW4A 3ECAA 4CHGA 3V4FA 4YXWD 2V6JA 5FFNA 5TPZD 4EVSA 1L8XA 1P31A 5IC4A 2P9BA 1E4YA 1E58A 3AP2A 3CSDA 1A7JA 3ABZA 3D6MA 2EW1A 1P2GA 5TSDA 3V8RA 4YJ2A 1ECPA 4BVLA 1LJ8A 1NY5A 4UM5A 2HRBA 1JWAB 2XOKD 5CT5A 3NGMA 4ZOLB 2ADOA 1YR7A 2YCBA 2ZIGA 3I6ZA 4M1QA 5TMBA 2XOKA 1NI4B 4X3CA 1U6IA 3DF9A 1UBNA 1BS9A 4DIEA 5JISA 5B64A 4BFCA 3HO8A 4PO3X 2VDVE 4NFYA 5AJTA 1T29A 4RK7A 3KJFA 4K88A 4XX0B 4L5JA 3Q8LA 4UEJA 1IH8A 2WTEA 3EVEA 2BTOA 1ZCAA 1JIKA 1G5PA 2EX1A 1DJOA 2PX4A 4J4TA 3V7YA 4ED9A 4ZEMA 5MHTA 3UG6A 1OI3A 3B52X 1TUBA 4NH4A 4PZDA 2HDHA 3G8BA 1YL7A 4O2AA 3H0KA 1V7QA 3AP3A 1I7QB 1HE4A 1EHCA 1XFAA 3A9WA 3IP7A 5ER6A 4BXOA 3ZTWA 3F9CA 3B82A 3E9MA 1VIVA 1XAJA 2XA2A 4NEGA 5TGDA 2CMGA 3L8CA 4CV2A 3NHLA 1ZP6A 3LHFA 4LHVA 1U7TA 1M67A 4RD4A 2C2WA 2P11A 2B9VA 2VWPA 1SD2A 3E9RA 2XQIA 2ZYIA 5BQ3A 5IKMA 3C3KA 1S8FA 3D9QX 4UU0A 3ZR4B 4C5CA 2J6BA 3U9SA 2C54A 2W00A 2ZBQA 6PFKA 4OI4A 4W5RA 1B4DA 3JQEA 3KR9A 3UJBA 4NXNB 4KRGA 4G2TA 2ZRFA 5KOHA 4DJ5X 2HYDA 1NJ6A 2ZAOA 1KE1A 1MMFB 2BKLA 3WLIA 1XVAA 4KN8A 1P17A 2DPLA 4B46A 5BUSA 5KKNB 4ZV4A 3PEUA 4FHCA 1TEVA 4KO1S 4NFSA 1JWLA 3ERCA 2QP4A 2VHWA 2ATXA 4C4XA 3ET5A 2C8VA 2VK8A 3T5DA 2ZITA 3GX1A 4NU8X 2RAVA 1CQJA 3MA0A 5C37A 4FEAA 2P5YA 3BRSA 2EKLA 1H2HA 3CE9A 2YV5A 2JRCA 3NBAA 4OA5A 3GG9A 4MS4A 5JUWA 2I33A 2OTCA 4RTSA 2PZAA 5HZHA 4GI5A 1H0HA 2J59A 1V1RB 1D03A 2FRDA 1MIOA 5DHUA 3LIIA 4ZAZA 2DQYA 4PC6A 4BVAA 1XRPA 3T3MB 4BZWA 3F6BX 3A4TA 2AMVA 1M6VB 1IXKA 1CFJA 1OQAA 2HBYA 2IEAA 1KGDA 1OXXK 3F46A 3GC6A 4HQ0A 3EPHA 3FR8A 2ONYA 3MELA 3O4HA 4O5OA 1T35A 4D9NA 3PC2A 4PONA 4PX2A 3AETA 3TR6A 3NOXA 2H1IA 3GLGA 1WTCA 1C1XA 1FK8A 4QPNA 1CY0A 2Q5LA 4U7WA 2ADMA 4CL0A 1F0NA 2WF8A 1OXBB 5KQGA 1DC6A 3P9SA 1G6Q1 1IDN1 3STWA 1FPQA 3NBXX 3DMHA 3E05A 5D5QA 3W1VA 3UOAB 2DR3A 2ZRKA 2HEGA 4YAGA 5K3CA 1CDOA 1F3LA 4IVRA 4MDEA 3G2IA 4UQPA 2V9CA 1A77A 3NRBA 5FV4A 2OILA 4TSFD 4CM8B 1DBSA 2F62A 4UVEA 3W0LB 4TSFA 2I1WA 3BF7A 5FLKA 4IS2A 4JD5A 3U56A 3BGWA 1MABB 2CNLA 2I3BA 4C1NA 1N1GA 2YYZA 5K51A 1PHRA 2FSSA 5IKXA 2EQAA 1Z18A 2A8YA 3LKDA 4TMFA 1EEXB 5AM5A 3V7FA 3S1SA 3IO5A 5HQTA 1Z0JA 3BS4A 3G0IA 4DLAA 3L1HA 4KLZA 5IYZF 1PTJC 4M8KA 2V7GA 5HRUA 4JX9A 3AG6A 4LHZA 2WOOA 4D43A 3PNKA 3RYCA 3DHEA 1NW6A 1PLLA 1X38A 4Y2GA 2WYHA 5EIBC 3EXHA 5G1NA 5HIMA 5HIIA 3ZW8A 3IR5A 4A0QA 1P1JA 3IOYA 1V47A 2WLSA 5GWXA 5IZCA 5LYJB 4JUBA 1IMOA 4DR5B 1LPSA 2EDAA 4FP9A 5EIBD 1COZA 2D3WA 2OXEA 1NMSA 2F90A 2JLRA 1OY1A 2NPOA 1SB9A 1VIMA 2P90A 3HPRA 3O8OB 4ZMRA 4FHFA 4ALKA 4BNVA 1JHYA 2HCRA 4GEKA 4RGYA 4BP1A 1PP4A 3A1EA 3DAPA 3K16A 2IPAB 1E69A 3QLVA 4PC1A 4EQ6A 2O3TA 4U6QA 1ZI6A 1VSTA 1J2EA 2YJ4A 3CG4A 3FHCB 2QUKA 3Q88A 3A2MA 4Q9AA 4RDHA 1R9GA 3UJDA 4ASUD 1AK9A 1XZLA 4ASUA 1NBMA 5B37A 3U62A 2B1JA 2VBIA 3FTFA 4WTOA 2R4UA 4JNCA 5ITZA 4ACAA 3BFVA 2J3DA 2LIPA 4LC9A 4OK5A 5LC1A 1X87A 3U4IA 2P68A 4L4SA 4RXUA 4LBYA 4N5DA 2ZDHA 1FFBA 3VC3A 2ZE6A 4BO5A 2QTGA 1E8MA 3THXA 4JEMA 3KKPA 3HL0A 3CXUA 4D74A 1R0RE 4X54A 3PQDA 4R2IA 5IHXA 2G9NA 1C3LA 1U2DC 3L46A 4G9BA 4C4PA 1JLHA 1XTJA 3LSTA 4EB6B 2YCLA 3KQHA 2IIQA 3JV7A 2I1LA 4M55A 3ROEA 1GCGA 2C82A 3I52A 3JQQA 4HDMB 4OK6A 2YOFA 4JWKA 5JSHA 1RM3A 3BOSA 4HYEA 3VX3A 4GH5A 1OB5A 5ALKA 1S2NA 1ZLXA 1KH3A 3C8MA 5CB4A 2YN2A 3GT3A 4L6IA 4LHWA 4HYYA 4BKUA 3E9DA 3CH5A 3DV2A 1SQGA 1E20A 3GPBA 1DZ3A 4NPHA 5EIHA 3GZJA 3LX8A 5GAJA 5J5VA 1TMKA 1QQAA 1O6GA 1LI7A 3BJEA 3A3NA 1QLJA 3GLQA 4P4UA 1RAAA 1VLVA 3GGCA 1VHWA 4LWPA 2IYSA 4Q4AB 4G67A 1E66A 4F38A 2Z2JA 2YJTD 3QKSA 4PHGA 4Q16A 3LKZA 4ZO7A 4YAEA 5GJCA 4F12A 3V5NA 4NH0A 3W8FA 4A8JC 1MVLA 2BEWB 2HWYA 3BREA 5FUWA 2LR0A 3O47A 2XJ4A 1OIVA 1W75A 4RVGA 3EVBA 2BGGA 2RGEA 5JVDB 3RAFC 3ABIA 3V8PA 3G2HA 3Q6NA 3FTEA 3H84A 5EFOA 1GQQA 1KIAA 3K6SB 4TYNA 3LOUA 5J4KA 5TE9A 1UBFA 4XRGA 1THZA 3GWZA 3OM1A 3C3CA 4MO9A 2JBAA 1U3WA 1XLVA 3F3KA 4F93B 3GLVA 5CVVA 1P8AA 4B4DA 1F17A 4B6GA 4EPYA 1GLGA 2ZS8A 2Y93A 3OLVA 3SIPA 1CPYA 1OREA 3FVQA 4GKVA 4CQJA 2XNSA 1UXGA 1HL7A 4X41A 1B0AA 2PO5A 2V5UA 4JB8A 4C14A 2YKGA 2J0VA 4YJKA 1ML3A 4HH0A 4FKZA 2ZUWA 2MYPA 1IY9A 1PR4A 3KEMA 4AB1A 5HYVA 4C4AA 3EA5A 2L2QA 4BQPA 4DCUA 5BMVB 1PYGA 1P1CA 5MGBA 2B61A 1NNLA 3BFXA 2EQBA 1IAQA 3P9CA 3UJCA 4DMLA 2NO4A 3AT1A 2HOQA 1R4ZA 4LI3X 4MVJA 2RKWA 5K45A 3L4JA 2COKA 1JVBA 1UZNA 1CQPA 4B6SA 1AQNA 4OI0A 3VYRB 4EW2A 1S2IA 3OQ1A 3KOWA 1DT3A 2SHKA 3OSZA 4O08A 1G63A 1QWOA 1TTHA 1EP9A 1ZGZA 3AHEA 1E9BA 1MVOA 3D7SA 1WY7A 1YA8A 3PJFA 5LMZA 1CV2A 2C84A 1VGVA 3N8IA 4PLYA 4F8EA 2VDNB 2PR2A 4WWHA 1KRWA 5AVKA 3MPUA 1ZMOA 4FLEA 3T1VA 1XBTA 2NO9A 3EEQA 3O6VA 4AP9A 1UKBA 4HAOA 1YJ8A 4X62B 2V54A 1LVGA 2Y8EA 2QN3A 1U0NA 1PVDA 3TINA 1MX1A 2PEZA 2ISSD 4KAAA 4LW8A 4AKEA 4AP5A 4A92A 2JGDB 4OL0A 5C81A 3MCUA 1YRWA 2Q9BA 1V5GA 3HFJA 5E7JA 1N7JA 3TRIA 3WLKX 1AIPA 2FP4A 1V6AA 2FN4A 3MGBA 4KMSA 4TT3D 4ZCTA 1TO2E 3CT6A 3DHWC 1ISIA 1JX6A 2HUPA 4OHRA 2C95A 4IGIA 1JA9A 1CJSA 4OQMA 4TT3A 4FYHA 1SGWA 5DZSA 4O33A 1FFSA 2CV0A 2FOIA 3SQLA 2JLBA 1NM5C 2BE7A 3DL4A 3QU2A 4ND7A 4DY6A 4OLAA 2A4KA 3KQMA 3F4LA 4KQHA 3GJ8A 3CKLA 2VHTA 2HD4A 3T9CA 3NXSA 5IK2D 2QQ0A 1JEYA 5FWYA 3SICE 1YWGO 5IK2A 3W79A 5ITVA 4LCJA 4JDUA 4X45A 8MHTA 2AG6A 3DFKA 1G8JA 2FR0A 3ZNOA 1NBEA 1NONA 1PV4A 1W52X 2JD1A 2OORA 3K9LA 4MO2A 5DYGA 1M75A 2PBFA 1IM8A 3R0VA 4NWIA 5BYJA 4EHLA 1FF9A 1OMOA 4WJKB 4OOEA 4MRPA 4DMMA 4J0GA 2WW8A 5BSVA 2IEYA 1WZNA 1XAHA 3WSVA 4I99A 4FYIA 4N0DA 1ZFNA 1VMEA 2XE8A 1DWPA 3H42B 4EF4A 4CGZA 1XU9A 4DLUA 4EUNA 1CG6A 5LU9A 4R16A 1T36B 1QIEA 1E7SA 1QKJA 1J99A 1TC1A 2QGNA 3CKYA 5D1NA 1LW6E 2FPPB 4QREA 4DUGD 4YRMA 3SM3A 2B7LA 3EFOB 2IZ7A 1GR1A 3E3NA 4EFNA 1XZ8A 2JGAA 3LUDA 4NNOA 3AF3A 4Q3EA 4N82A 3WY9A 3D0KA 3ZDXB 3MJSA 2XMRA 3HVJA 3RS5A 1L4FA 3UHFA 4B7XA 5DGHA 3K9BA 3Q5DA 5KQPA 3IOBA 3M81A 3FX2A 1PR6A 3VGJA 4ZMSA 1X8JA 1AJEA 1M76A 4DIOA 1Q92A 3D7MA 3ANMA 1W4ZA 1KAOA 1Q3HA 2WU8A 2ZUUA 3AL2A 3C41J 4E22A 2ZB2A 3N7UA 4ZPXA 2KM1A 2P1RA 2I6SA 1OH6A 4S1WA 1BCSA 2AFIA 3CR7A 4YHHB 3EFEA 3A6JA 3H04A 3CZAA 4MHOA 3L7CA 5DW0A 5AIBA 5AW8A 8LDHA 1G8AA 5IJ9A 4IG4A 4LQCA 1RMTA 1DC7A 2VK1A 1UWKA 2P8JA 2P67A 1BGWA 3BIXA 4A1FA 4D8YA 3U3MA 3WMRA 2EDCA 3M1LA 3AKCA 4LZLA 2FMXA 2R1TA 1TZCA 4DOMA 5JQGB 4FX2A 4DANA 1KI7A 3E7WA 2F1KA 4L5YA 2VT6A 1IAVA 1DBPA 4LYYA 5SY6A 1VBNA 2F8LA 2CW5A 2IYEA 2DC1A 5DV9A 1BRMA 2B83A 2E4WA 2LWIA 2PH7A 2IV2X 3TL2A 4HATA 3G0DA 2BONA 4O4JF 5DGDA 2V4UA 3PD0A 4E13A 4JJFA 3PFWO 4MYSA 4LI0A 2AEFA 3N8DA 1PR5A 4LMRA 4QUIA 3VSAA 4RDXA 3ZQ4A 2YIDA 3AZOA 3VO8A 1PHPA 3WRVA 3KZNA 2B30A 3V00A 3KS9A 5TEVA 1OYOA 4IDDA 3JRWA 4S2EA 1BG6A 4J03A 4RVUA 2POQX 4I9FA 1OKKD 2ZRIA 4J2HA 1EVIA 3B9BA 2IYVA 1M3IA 1OKKA 2WHEA 3ZWBA 4CN8A 3NEAA 4HGZA 3H5OA 5ESDA 5BQPA 3GT0A 2X3YA 1HEIA 4F04A 2FEOA 3V1TC 1PGOA 5AK0A 4F91B 5JLJA 4HSGA 2EKDA 5CNKA 1BD3A 4YMLA 2RGYA 3VKVA 1P0CA 4NV1A 4XAQA 3OZ7A 2W6NA 3NRJA 1SVSA 4JMLA 2JPDA 1S0UA 1FP7A 2Z1NA 5GONA 3WGQA 4EWLA 5K3EA 1H42A 3DB1A 3QHQA 4YCNA 1J0CA 1MOQA 2XF8A 1DCKA 3FWHA 1YA4A 3EC7A 3OLQA 4HH4A 4RLQA 4EGQA 4KTTE 4B6QA 2WJWA 3DR3A 4EFMA 3A7EA 4BWVA 1GKIA 5JZ9A 3DYBA 4LZNA 4DSUA 2OM6A 3I32A 3ED5A 4RU1A 3EAFA 3GFVA 1KL7A 4ACBA 1CUCA 4TKMA 1TJYA 2AR9A 3BMXA 4OFBA 1L8AA 1A8UA 3IAXA 1N2XA 1G5IA 4FC7A 1FMLA 1T2UA 3B1FA 3GLTA 3H6HA 3PFIA 1J22A 2ZQ5A 4FCWA 2QRMA 1HA3A 2PGLA 5KOYA 1NVEA 2C3MA 2BFCB 3AR9A 4ZIRB 2XCOA 3PUIA 3NNNA 3ZGOA 3SEZA 1YOBA 3NO4A 2FE1A 3RIXA 1DNPA 3RK4A 1EJ2A 5A5FA 3ADDA 3I5XA 3FNRA 2HJGA 1IHUA 3GT4A 1C2TA 3KOYA 4AM8A 4BGIA 2I4NA 2BEKA 1I30A 3I76A 3C6MA 4KXWA 5IFLA 1QH8B 2C3UA 1BJRE 5H80A 4WL0A 5EZYB 2G06A 4C88A 1XROA 4HDSA 2MOKA 4DMCA 3CHYA 1IK4A 1ICEA 3CF6R 2NUPB 1NPDA 1UAAA 3P19A 3I0MA 1O94C 4TXLA 4Q4JB 3QPDA 1KEZA 4UOQA 5M7EA 4QTUB 4M7PA 1N0VC 4BNWA 4Q1DA 2NN3C 3AEXA 1XQWA 3HY3A 3OFNA 1SCKA 3R0JA 3IMCA 1EUDA 4CDGA 4FFSA 1GYRA 3AF2A 3HRKA 4RMIA 5HCIA 4ENPA 1HOXA 1TIPA 2TYSB 3LLCA 1ZOIA 4BJ6A 1U7OA 2P2DA 5JECA 4X1KB 2DKOA 3M3DA 4M38A 1N75A 2JAPA 4HN9A 5IUNC 4WPGA 1TF2A 3EASA 4JLMA 3EQ7A 3DCJA 1V0JA 1OROA 3URMA 3LX4A 3WLAA 2Q6TA 4D98A 4J0KA 2ZZNA 2BM0A 2OD2A 5FOVA 5AIAA 3LM8A 3CWQA 1EWYA 2QRKA 4RA6A 1DKNA 2GZAA 2QVBA 2VNIA 3KFLA 3PQ3A 3AR2A 3SKXA 1DX6A 2VDJA 1V41E 1QO9A 5BT8A 3KXLA 1RHQA 1CR2A 1Z4OA 3JVEA 3R0IA 1JBKA 3W2GA 4B73A 4B71A 2PD3A 2BI4A 4J0JA 2VKQA 1LV8A 1E9VA 2AN4A 3FFXA 4K9RA 3H2IA 4JL8A 4ZRDA 1QH9A 1L3CA 5KSOA 3QKWA 3PIDA 1ZO8A 3K1AB 1OXMA 4INJA 1OA0A 2WJIA 3MPOA 1PNQA 1YBVA 3N8GA 4KP7A 2IUTA 1Z7YA 1AA9A 5JYBA 4MZXA 1UJ5A 1ZN7A 3DFMA 1N5DA 4I55B 4P3NA 2W4MA 1N5LA 4EKYA 3E35A 3WMWA 1II8A 1CF9A 1YRQA 2BZSA 4LQ4A 3DLBA 5IKPA 4Y2YA 1XIVA 2Z8YM 3QEMA 4YCLA 1E98A 4WOKA 4DHWA 1BD4A 2ZZMA 3M5PA 4GMKA 4TZ0A 2NU6A 3AEZA 1FW8A 4LMAA 1RZRA 2YZGA 3IS3A 1M2GA 2EJBA 2AUTA 1SKYB 2XUZA 3L43A 4TWAA 1VHLA 3I8XA 4QTZA 3AEUB 3E0XA 4P32A 4JL6A 3B89A 4F0JA 5BQXA 3BMNB 3KVRA 3WLTA 5FPHA 1RMYA 1H5NA 4AW9A 1FSSA 5ARDA 2YWHA 3FMGA 2ZJ1A 2AMFA 4V0SA 5BWNA 3ZJYA 1DJPA 4RVNA 2V7QA 3VH3A 2GEFA 2MT9A 1VBMA 4ZAFA 1F38A 4N41A 3VTFA 5BW4A 2PPLA 2QTVA 2YN4A 3WWDA 3Q12A 2XH8A 2IDZA 3CX8A 4M9UA 3K6JA 5FIUA 1WVMA 4HQKA 5AYVA 1C50A 1X9IA 2DM6A 3TTVA 3UOGA 4PIMA 3AGPA 3TIXB 1MV5A 1O87A 3ONVA 5H7XA 1AKMA 1MQ8B 1W581 2DGDA 4MGZR 1UJMA 2CFRA 2DBRA 2J0UB 2VYFA 3KWLA 1JV2B 2XVZA 2ZSAA 2C2ZA 1ZFLA 4L1KA 1FP4A 1I7NA 1VHTA 3GPIA 4BCDA 4GX0A 2XCUA 2XKJE 4MRVA 1VIDA 1B8VA 1C8KA 1Y1QA 3CPSA 2BW0A 1PNOA 4O63O 4FFLA 4QJIA 2IZ0A 3EODA 3GLIA 4QXPA 2YTZA 2WJ4A 1E1RD 1RM5A 3WTBA 2FEMA 2IQIA 1AUOA 5LQJA 3TGLA 1ODJA 1E1RA 4PZ0A 1ISSA 1Z2CA 3LQ2A 1QWSA 4PG8A 1KWGA 2LVBA 1XMQB 2VYNA 5L3VA 2JG3A 1OSNA 4HFRA 3VYVA 3ENKA 1PKXA 3Q5GA 1B00A 1N2HA 1Q7BA 1XNJA 5F52A 1WMEA 2Q5JA 3M7IA 2C3OA 2A3NA 4QE3A 3SDBA 5G53C 4F4CA 3DXYA 4R69A 4JVNA 1N5JA 2VWHA 3W6UA 1SC9A 1VMAA 4UUAA 1T8TA 1NJFA 1IPHA 2OZLA 3STVA 5F2EA 1AO0A 3D64A 3FKSD 1WUTA 3U19A 3LHDA 3HBJA 5K05A 4DV3B 3FKSA 3FOBA 3A4NA 1VJDA 2ZR0A 3USCS 1N77A 3KD3A 5TVKA 1M33A 3CEHA 1EP2B 1BJKA 1DMSA 1LRJA 3RC7A 5KI6A 4EYEA 2BKAA 1VKHA 3VKWA 4K6GA 1HG1A 3RR2A 2HHJA 1XNGA 2QB5A 4LF5B 1G38A 4H1VA 1SXJB 3D6VA 5D5HA 3GCGA 3NVDA 5LIPA 1SU7A 2QLFA 1XZCA 3INRA 4MJLA 4ZVRA 5CGQB 4KWEA 4CEJB 1POWA 4P3XA 4C22A 5HIJA 3PR3A 4EPWA 4PGAA 4Q05A 5LM3A 4HUQA 2NXEA 1TRHA 4CV1A 2VZ8A 2PL5A 5F9FA 2FMIA 4YASA 3OE7D 2XTNA 4CE6A 2Q4RA 3QXSA 5DXJA 2FZ5A 3CV3A 3OE7A 4P9NA 2R0QC 4AJ1A 2OQVA 3RSSA 4PGGA 1NT2A 3U2QA 2A84A 3JYOA 3B8HA 4A0FA 2H2IA 1FP1D 1ZMXA 3GP3A 4REQA 3TUZC 1T2CA 1TAGA 1OFUX 1U6JA 3Q2KA 2FA9A 2HBRA 3AR4A 1MRSA 2PGAA 3QU5A 4UZFA 5JMPA 1NSTA 3DFFA 4EL0A 3ZDAA 3MWJA 2VEDA 3VPFA 1UH5A 4JJ4A 1KP3A 1DQPA 4KGXA 4ER7A 4XGQA 1KP2A 5B2FA 2MSLA 2G07A 4NULA 2ZSUA 5CLLA 4AKGA 4M54A 1A8HA 4ZQEA 4ND6A 4R9VA 5LUBA 4DRZA 3PYXA 5K0GA 3VJKA 1PL8A 4GWKA 1ESCA 4N49A 3S55A 3RQIA 1UJ2A 3DTNA 4NENB 4KZKA 2YIVX 1G7RA 5KUTA 5EMKA 4JLKA 3OMXA 2XF2A 3HN2A 4LGMA 1PQPA 3KSDO 3NP9A 2GK7A 4PG7A 4XPIB 3V34A 3ZUGA 3JQAD 4IH1A 5CFPA 4J29A 1L3IA 1DFGA 4MMXB 5AXDA 3JQAA 5AUNB 2W2VA 2PX8A 4F86A 3ZE1B 3DVQX 5IBRA 5DYNA 1YRHA 1JTFA 3TMYA 1M0SA 4IX1A 2M32A 2GBLA 1WW2A 3X2FA 1VRVA 3GA7A 1JN0A 4ZHSA 3ACDA 1AUQA 2R5FA 2ZI6A 3UY4A 3V9AA 2GVDC 1MGPA 2CB0A 2Q9CA 4U2EA 1QZ3A 1TQ2A 4F6RB 2AH5A 4CTNA 4QTYA 3AEQA 4E33A 2GM5A 3TL6A 1Z2OX 3H5NA 3KWFA 2NTNA 4TTQA 1JKJA 1EFVB 4CT4B 1L5QA 1YL6A 3ZNPA 4CYMA 2ZRMA 2CCJA 1KHHA 2RAPA 2AOTA 3FCAA 3QENA 4K9LA 1FFXB 2JFUA 3I64A 4KO4S 4OLJA 1NUUA 2VDWA 5G4KB 3T9BA 2QMYA 5G0VA 1EFCA 3JVUA 1WX1A 2GZ1A 1I5OA 2JFQA 3TKLA 9ABPA 2JAWA 3LKBA 3C8DA 3I0ZA 1GUZA 4UEQA 5BQOA 5EJ8A 4RHCA 3S81A 1WHTA 1JKMA 2RGNC 3ZU5A 4QOFA 3PDCA 4FMDB 1ENZA 1K7CA 2H4JA 1I94B 1YVDA 2E3JA 2CLLB 4Q02A 5J63A 1A72A 5H68A 4QDXA 2H7XA 3GAAA 4UVGA 1QP7A 3F9IA 4JI7B 2Z8XA 3QVJA 1C41A 3N9IA 4GOLD 4IO0A 5H82A 721PA 3B5IA 4C7BA 1UBMS 1KAQA 3CF4A 3G5AA 4NOKA 1RBYA 1M2VB 1QO7A 1NVVR 1WD5A 4H17A 3VOAA 4BAZA 4EIWA 1O5IA 4IP0A 4LDRA 5MFZA 4WK4B 1YR2A 1VIAA 2ZSJA 3LC7O 1PI3A 3AF0A 3DWGA 3NVMB 3PA6A 4M1KA 1V3UA 5KSPA 2JCYA 3Q1KA 2ZSFA 2AQHA 4H7DA 4HQOA 1N2GA 2CMHA 2EEPA 4LS3A 4Q1AA 2B99A 4EOGA 1IVSA 2IYNA 3CX7A 1SKYE 5ALMA 5DASA 1A5SB 1X6VA 4X7RA 1D2EA 5FEUA 1XP5A 1QS0B 2P6UA 4W1RA 5BNFA 6ADHA 1ZL0A 3ID6C 4OBXA 4KEAA 3H1AA 3M3HA 4BAUA 4KDCA 3OLXA 2C3PA 2WV9A 1T1RA 3H2GA 4XH9B 3GAFA 5FWDA 4YRNA 3C8HA 3ZVKA 3W4KA 3BPSA 3E03A 4WXRA 2X9VA 2OFWA 1C3EA 3S1AA 3PD1A 4CKWA 2P78A 3DDNA 1J06A 3QMVA 3EOZA 2J32A 5A4JA 1KOLA 1XN1A 3NGLA 1F2TB 1O96B 1Q1AA 2ID4A 4QFCA 2UYQA 3MINB 5DIFA 4U7FA 4ZQGA 1GQOA 2NVBA 1XNHA 1QR6A 3IUPA 4BP8A 2XXAA 4JXZA 3ZEIA 1JXOA 3L77A 4G26A 2H4YA 4XYGA 3UQZA 1O54A 2EIXA 4URVR 4L76A 2Z9BA 1MOZA 1WUIS 3QEJA 2BFWA 1NF2A 2DZDA 4X7BA 5LP6B 2HRZA 3PQCA 1EVKA 5DE3A 2PL1A 3TDNA 1BVYF 5EIEA 4K9QA 4R8KA 1TF7A 3E84A 3GVHA 1CR6A 4E5PA 1PJAA 1IM5A 1E2PA 3I2GA 3ZWQA 4DQVA 3ZDBA 4H60A 2IEBA 3A11A 4MYHA 1T13A 2O2SA 4HO1X 4M2LA 4DC1A 4M9SA 5IWAB 3ZVMA 1F2UA 2NT4A 3FKQA 4RK4A 4CMHA 1LQTA 3DOIA 3BEDA 5KNCD 2GN0A 3P0IA 1ZSYA 1TVKB 2BM8A 3HXTA 4JI6B 5KNCA 2OBXA 3ENVA 1U8EA 5ERXA 4NV3A 1D4FA 4OHWA 1JDTA 4HOYA 1YACA 4DM7A 4JT2A 1T34A 2JLSA 3C3JA 2QTBA 2C7VA 1RQRA 3D8TA 4JT8A 2J3HA 3WV5A 4CTJA 1LSUA 4CEIB 3G8DA 2CLCX 2JCSA 1OIWA 2QNBA 3RU2A 4TTIA 3I3OA 2ZREA 3AHCA 4IFIA 2PCJA 4OUKX 4POAA 4DV4B 4KE6A 2O2CA 2VC2B 2H7YA 1S3SA 5KX5B 2YS7A 4H6VA 4ZHQB 1CUGA 2FZWA 2V9ZA 1CIVA 4M0EA 4YO8A 4Z7OB 5HF8A 3ZGLA 1MHTA 2ZYTX 1ZQ9A 1KI1A 2GKGA 5ALIA 2PS9A 5LP1A 1HQYE 3DF7A 1WUJS 3IULA 3NHBA 3LUCA 1A7KA 4XQ9A 4KGZA 1Q1BA 5JBNA 4H3KB 4MOWA 3MYYA 1SXJE 4W5NA 1ISJA 4UREA 2DPHA 3D3QA 5EY5B 5KTKA 2Z6QA 3HKEB 3DT6A 4IZHA 4ARVA 1NR7A 1FFCA 2YHSA 3QLUA 4JHLA 2P7IA 1P7YA 3W3AH 1N1EA 2A1TS 4JR2A 5DXAA 2IYQA 9MHTA 4UE2A 1SOUA 3ZI4A 5ADWA 5E1BA 3IIJA 1FNNA 1UT5A 4IF4A 1ESZA 4PV7A 1DV2A 4LHYA 1O9GA 2OP1A 2WAAA 3EZNA 2CXTA 2XWQA 2IW3A 4GI2A 2AF4C 3QBDA 4I50F 1XRMA 1FIUA 2RC6A 4QOEA 1P9OA 4DZZA 2B98A 3I01M 3AXSA 3ETEA 4M22A 2F3SA 1IATA 1TT5B 1ZNZA 1HUQA 1L7XA 2PQ0A 4C05A 4E2WA 4C2TA 2ICAA 3WLJA 4DGQA 4DFDA 3JYLA 1R64A 4CM9D 3ADOA 3HNOA 3UA3A 2R62A 2W2TA 4OGGA 3S3TA 1MKYA 1MT3A 2O8NA 4CLOA 1WZ2A 3NBMA 2A9OA 4QSMA 1GEEA 3LG2A 4N7MA 3L5OA 4YJ2B 4WH0A 5A1TA 2JARA 3DLTA 4B6FA 4LRSB 4XI9A 2Z98A 3RADC 2OBBA 1DQSA 4GLBA 1PF7E 3F9RA 4F56A 1GWNA 5IN4A 1U94A 3R5JA 1KDVA 5ILQA 2PTHA 4G0XA 1GZVA 5A4MS 1M2JA 2HCJB 4G25A 4B3SB 1J42A 4H7FA 4I3GA 5J47A 3K30A 3R3YA 1FYVA 4LYGA 1GTG1 2EWVA 2WFZA 5KOIA 4IIVA 3ZHXA 2WJ3A 5AJZA 4FE3A 1JKXA 3LUBA 4YJDA 3UCXA 3CY6A 3O1JC 1N6NA 1OUMA 2NQTA 2G1KA 2GN4A