3G2MA

Crystal structure of the glycopeptide n-methyltransferase mtfa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
265
structure length
232
Chain Sequence
PVRTPHADVLLASVVLCDFYADGTSEAREFATRTGPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERLHVRHLPAEEIQEITIHPADEDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PCZA361.24
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 67
structure length 232
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.40 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2mA02
2JHAA 1X1CA 1RI5A 4ATNA 3C6MA 3UJ8A 4C05A 4EKIA 5HZMA 2PBFA 3T7RA 4FT4A 3PFGA 1R00A 2AZTA 4PYJA 2ONYA 2KW5A 2AOTA 3M70A 4IV8A 2YQZA 1I9GA 5JR3A 4EKGA 5BW4A 5LQKA 4PYIA 5EPEA 3T0IA 4OX9Y 3KQVA 2ZZNA 3L8DA 5FHQA 4U7PB 4LWOA 4R6XA 5P8WA 4QVGA 5CVVA 4P7FA 3VC2A 3KU1A 1PJZA 1UWVA 3AY0A 3FPGA 4LG1A 3KQYA 2P3LA 2BR4A 5FA5A 4LECA 5G02A 4O29A 3EGEA 2OB1A 2OB2A 2ZWAA 3EVCA 2Z6UA 3JWJA 4RTKA 4KWCA 3PVCA 4M7RA 2YXEA 3CVOA 1D2CA 2FHPA 3EGIA 3KR2A 4KDRA 5DX1A 1B42A 3OU7A 3CGGA 3FTDA 4K6MA 5EZQA 3NMUF 3I64A 1RI4A 2ERCA 2B78A 4PGGA 4QPNA 5CM2Z 2ONZA 2VZ9A 2O07A 3NDIA 2ZLBA 5T64A 2IIPA 3HCBA 4R6WA 1DL5A 5DPMA 4BLWA 1F38A 4E2YA 3GJYA 5LQNA 4U7TB 4RVDA 5FULA 3S68A 1YFLA 2VDUE 5HEKA 4PYQA 4V0QA 2XVMA 4GOND 2C7OA 1VPTA 2B25A 1NV9A 1NBHA 3CCFA 3R9XB 2AOUA 4E70A 1VLMA 2ZBQA 4RTNA 1JR4A 3DMHA 5F2KA 2FK7A 3GRUA 1G6Q1 2AOTB 2V74B 3HCEA 1KR5A 4Z2YA 2NP6A 4C07A 2CKDA 3G5LA 2B2CA 3KHKA 4CTKA 1JSZA 4FT2A 1AF7A 3TM5A 2IBSA 2OYRA 2GH1A 2WA2A 5MHTA 4GC9A 3LDGA 5EHGA 3D2LA 3B5IA 3DH0A 3OZTA 5KQRA 1KPGA 1QAQA 3LDUA 4EQZA 1IM8A 2O05A 2BH2A 3FPJA 1XJ5A 5E1OA 3HCCA 3HM2A 4HTFB 3P9IA 2VP3A 3M4XA 4LWPA 2OO3A 5E1BA 4OQDA 2PX4A 5K0FA 1F3LA 2YX1A 4ZTBA 5DX0A 1FPQA 3VYWA 2XYVA 4XUDA 1TPYA 1AQIA 2NXEA 1M0EA 2VS1A 2N47A 5DRYA 3CJQA 4RTSA 1QAOA 3PT9A 5LQJA 2YXLA 4A6DA 1P91A 3REOA 4R05A 2PLWA 3SSMA 5T6BA 4BY9E 4RWZA 2ZULA 2DPMA 4PNEA 1VIDA 3EEOA 3P2IA 2AOVA 5C1IA 3BGDA 3E05A 2AVDA 1JG4A 4BP1A 3KQQA 4AZWA 4L7VA 4EVIA 1VE3A 1M6EX 3O31A 2PT9A 4X60A 1G55A 2ADMA 2ZFUA 3LL7A 4QTTB 3THSA 4E2ZA 4E31A 3UJ9A 4YUZA 3FUUA 3HCFA 1L3CA 1U2ZA 3NWBA 4MHTA 3PX3A 4H0NA 3KQMA 3M6WA 3KPUA 4PYNA 4OA8A 1T43A 3UJBA 1NKVA 3O7WA 2NNWB 3BWBA 5DXAA 5GM2A 3DXYA 3MERA 5DWQA 7MHTA 3HNRA 3TPZA 3SM3A 4FS8A 4PIPA 4YUWA 2JH9A 2AOXA 3GDHA 1JTEA 1FJXA 3EMDA 2ZTHA 3IYLW 1JQ3A 4RTOA 1WXWA 4GOOD 4PINA 3KQPA 4QTUB 3A25A 4JXJA 2GA9A 2I62A 3FRIA 3MCZA 3T7TA 3FUXA 2IDKA 2OKCA 5DM1A 4CKBA 2PX5A 4MTLA 3IEIA 1KYWA 3EVBA 2PV0A 4F85A 3DOUA 4YUYA 2G72A 2ZWVA 3M6XA 3M6VA 2PX8A 5C9ZA 2QYOA 3NWEA 5FUBA 2PKWA 3GXOA 1P1BA 4YUVA 1Z3CA 2GB4A 4XUCA 5LR6A 2IH5A 2H11A 4KDCA 9MHTA 3MTEA 4F86A 3B3FA 4WXHA 2IFTA 5EMMA 2P7HA 3GRYA 1UFKA 1L9KA 3KQWA 3KQSA 2EFJA 2PGXA 3KQTA 2UYCA 3HP7A 4C03A 4PIMA 4ER6A 5FCDA 2ZIGA 3G89A 3GO4A 5HIJA 5DX8A 3UJ7A 5HIKA 2P8JA 3GRVA 4DA4A 5DM4A 3BKXA 1XVAA 3OZSA 2JHCA 4V0RA 3LPMA 5U4XA 2ESRA 3BWYA 3NW9A 5HIMA 2ORED 5FWAA 3Q7EA 2JHPA 1SG9A 3EPPA 5C0OE 3JWIA 2I9KA 3BT7A 1G8AA 2PXAA 3DXXA 3GGDA 3DLCA 4X63A 1XCJA 3NDJA 4GC5A 1KPHA 4QVKA 4RTQA 1IXKA 4CKCA 1EJ6A 1Y8CA 2OZVA 5GIOE 1H1DA 2QM3A 1SQFA 4BLVA 5ICGA 1N7JA 4GF5A 3NJRA 3B89A 4Y2HA 5K0JA 4IKPA 2PX2A 3A4TA 4HSGA 5B1SA 4DF3A 1MJFA 2Q41A 3BGIA 4WVLA 1R8YA 4X41A 4RTJA 1AV6A 5EQJB 1P1CA 2F8LA 4IWNA 4RTRA 1SKMA 1ORIA 4OA5A 2PJDA 5LQCA 2BZGA 2ZSUA 2PXCA 2AS0A 4HGZA 4QDKA 4DCMA 4EK9A 3MAGA 4OQEA 3B3JA 2HV9A 3ELUA 4A6EA 2NXNA 3MGGA 3TLJA 4AZSA 1NW8A 1XXLA 2Z6AA 3EMBA 3P97A 2UYHA 3BKWA 1R18A 3A27A 4HRAA 3FPEA 5E9QA 3BWCA 3PTAA 3RIEA 3DTNA 3KPVA 3OU2A 4RVHA 2P35A 4E2WA 1ZKDA 2B9EA 5DSTA 3DMGA 3PB3A 4GOMD 5EG5A 3FTFA 3FPHA 4F84A 3E7PA 3T7SA 2PSSA 4ER3A 3PLAE 4XCXA 4R8RA 3TR6A 1X1BA 3FTEA 2K4MA 4FGZA 4QPPA 3AXSA 5HILA 1TW3A 4QDJA 4FZVA 3FZGA 5E1DA 3P2KA 3P8ZA 1Q0SA 5K03A 3ORHA 2GS9A 2CWWA 3G2PA 3ELWA 4AX8A 4PWYA 3RW9A 3JWHA 2AN4A 3IV6A 3HVJA 4P7KA 1O9GA 1G60A 5ICEA 3CC8A 5M5BA 1M6YA 1KPIA 3P9NA 3UWPA 5EEHA 4C04A 3R3HA 4KRGA 5ICFA 4Y30A 3QOXA 3DR5A 4POOA 2Z6QA 2G70A 3CBGA 1XDSA 3P71T 4B17A 3HA7A 2GPYA 4BP3A 3NVKI 5GWXA 2R6ZA 5D1NA 3LBYA 5EIFA 2FPOA 5BP7A 3EVAA 4E33A 2VDVE 3NTVA 5BW5A 3PX2A 1I1NA 3MCTA 3G2MA 4MQ4A 3SVZA 5BXYA 3SR4A 5LSAA 4HGYA 2OXTA 2FYTA 4RYLA 2BM8A 4PYLA 1YUBA 2O0LA 3UJDA 1BHJA 2AOUB 5CVUA 2G71A 5D1HA 5DXJA 3AJDA 2CL5A 2JG3A 1Q0TA 1X1AA 2EG5A 3ELDA 2IH2A 3P9CA 5ERGB 1NE2A 3KR9A 3CJRA 4RTLA 4PGHA 2XVAA 2NXJA 4E30A 4DKJA 3O4FA 3KR0A 5EVJA 1SUSA 3GNLA 1RJDA 2QY6A 2VDWA 4YV1A 2CMHA 2CMGA 1JSXA 1JG3A 1RI2A 2B3TA 2Y1XA 3B7PA 5DM2A 5GM1A 3V97A 1ZGAA 1FP1D 3GRZA 2UYOA 4AZTA 3A7EA 4ER7A 1YFJA 1RI1A 5EKUA 4KVZA 5E9WA 4CKEA 10MHA 2HMYB 3ID6C 5FQNA 3SSNA 2V7EA 2ZIFA 3TFWA 4YUXA 1QANA 4PCLA 3FPFA 3VC1A 3BXOA 1VP9A 3I9FA 3LCUA 3BWMA 3FYCA 2P3QA 3NVMB 1XDUA 3THRA 3DULA 2IP2A 1RI3A 5K0BA 1TW2A 3HVHA 4HC4A 1RJFA 2DULA 3LCVB 5K09A 4CXMA 3GIWA 3QOWA 1NW6A 1WG8A 4PONA 5EKXA 2O06A 2HWKA 2FK8A 3LGAA 3OU6A 5CVEA 3QV2A 2ZZKA 3SX0A 4PYOA 2XBMA 2ZBPA 3MHTA 4RVFA 3H2BA 4C08A 4E2XA 3EGVA 1L1EA 4MWZA 5E8JA 4EMSA 4QQKA 4PYMA 2QRVA 2BM9A 2JJQA 4C06A 1EIZA 1O9HA 2OBFA 1WS6A 2NYUA 1NW7A 4PYKA 3TM4A 3JWGA 4M38A 1YZ3A 1FBNA 3MTIA 1RJEA 4FSXA 5T67A 5DRTA 5HOQA 2OPBA 1OR8A 1VP3A 3HA3A 1KHHA 3K6RA 5CD1A 3AWIA 2YTZA 3P9KA 3M33A 2I7CA 5KVAA 4M37A 5GP1A 2WK1A 1SUIA 1EQAA 1DUSA 3LHDA 1QZZA 2FRXA 3I53A 3U81A 5CUQA 1ORHA 4RV9A 2ZIEA 4PCAA 1KP9A 3LECA 4KIGA 4X1OA 1KXZA 2LD4A 4OBXA 4UOEA 1BC5A 1KYZA 1L3IA 4P7JA 1O54A 4YMHA 4C4AA 5EMJA 4M36A 4CTJA 1JQDA 3R6TA 1ZHFA 1NT2A 3Q87B 2IGTA 3OE5A 3TKYA 3DUWA 3A26A 3KR1A 3FUWA 1R74A 3UJ6A 3PFHA 5EIWA 5EMLA 2G1PA 3DLIA 2IPXA 3HCAA 3LCCA 4NECA 1YZHA 1EG2A 4DCGA 5KQSA 3UJAA 5KYGA 2IDJA 2BR3A 3KPWA 3C3PA 2QRVB 5IKMA 3HCDA 4HTFA 5EC8A 2YVLA 3I5UA 5DT2A 3B3GA 5K0CA 1NW5A 2P41A 5CIYA 2XYQA 2UZ4A 3TRKA 3EVGA 2ZW9A 4GEKA 2QE6A 3G8BA 5IH3A 2P40A 2R3SA 4QQNA 5JUWA 3P2EA 1ZQ9A 2EJUA 3ER9A 2PT6A 1P39A 3K0BA 5DLYA 5GOZA 2HR1A 2PVCA 3LDFA 3FUTA 1XCLA 1SVUA 1QYRA 3PS9A 4YV0A 2C7RA 3C0KA 3EVDA 3KPJA 4MIKA 3TOSA 3UA3A 2A14A 1IY9A 5EHIA 1JG1A 1KIAA 3C6KA 2Y1WA 3DMFA 3DXZA 4P7GA 3LBFA 3UA4A 4BLUA 3UZUA 1EAMA 4GOLD 4ER0A 3GRRA 3KQOA 5LQRA 5HIIA 1VQ1A 3UJCA 5HFJA 5K0EA 1MHTA 3G88A 1EJ0A 3ER8A 2ZVJA 4OBWA 1BKYA 2YUIA 2AOWA 4FP9A 5F2NA 5K01A 1WXXA 4ISCA 4DM3A 5K05A 8MHTA 1NBIA 2XYRA 3G8AA 3M6UA 3OFJA 3TMAA 4XUEA 2E5WA 3TKAA 5LQUA 4IV0A 3SGLA 3X0DA 4DZRA 1G38A 5CVJA 5K8VA 1X19A 3G2OA 3LKDA 3MQ2A 4FR0A 3FUVA 3OZRA 1V39A 2H1RA 3ME5A 3V8VA 4GQBA 1G8SA 1QAMA 1WZNA 2G8NA 3LKZA 5DTRA 5F2OA 4E32A 2HNKA 5E1MA 3MB5A 5EMKA 3HTXA 5GINE 3E8SA 1VL5A 5EGSA 1SQGA 5FHRA 2EJTA 4KIFA 1AQJA 2PWYA 2PY6A 3EVEA 5EEGA 1JQEA 2EX4A 5DTQA 2NP7A 1PRYA 3EVFA 1JG2A 5EZSA 2AR0A 4AZVA 4KW7A 5FTWA 2JH8A 3UFBA 5FQOA 2UYQA 1XTPA 3I58A 5H02A 3SSOA 3FRHA 2PWPA 3ANXA 4CWAA 3BGVA 2YR0A 5FWDA 3RODA 1X1DA 2C7PA 1R8XA 3FTCA 2BR5A 3KKZA 5DM0A 1RJGA 3LSTA 1HMYA 5ICCA 3HVKA 4GUAA 2AN3A 2WA1A 4YV2A 2IH4A 2FCAA 1YB2A 2AN5A 3GU3A 4G56A 5K0NA 3KPYA 3OFKA 5CVDA 2IBTA 4RX1A 1JTFA 2ZZMA 3A7DA 3R0QA 3IHTA 1XDZA 1BOOA 3UBTA 5LQAA 4RSRA 4FSDA 3GCZA 4DQ0A 2P3OA 3CKKA 5CCBA 3C3YA 1ZG3A 4X61A 3G7UA 1D2HA 5GIPE 3SXJA 3F4KA 1HNNA 1WY7A 2ZBRA 1FP2A 3GWZA 2C7QA 3FYDA 3EEYA 3HA5A 3G5TA 3BZBA 4YMGA 2YXDA 2AVNA 3AXTA 3ERCA 2P7IA 5E9JA 2GAFA 3TQSA 2P1DA 1DCTA 4AUKA 3HEMA 2O57A 3OCJA 3HVIA 3G2QA 5CCXA 1INLA 1VBFA 5K0GA 3ELYA 3BUSA 3SMQA 3EVZA 2PXXA 3E23A 5E2AA 1ZGJA 2HTEA 1R6AA 2NXCA 3LX6A 1I4WA 5DTMA 3CJTA 5FADA 1L3BA 1UIRA 1NV8A 4HG2A 3DP7A 4GBED 4RVGA 3OPNA 5KS2A 4HH4A 3VSEA 1YF3A 4RTMA 1N2XA 2H00A 5E2BA 3WSTA 3OE4A 4P58A 2I6GA 4R8SA 5DSXA 5K0LA 4ER5A 5E8RA 2ZCJA 1NW3A 4DMGA 5FA8A 2OY0A 1D2GA 3R24A 5EOVA 4RTPA 1N7IA 2GLUA
chains in the Genus database with same CATH superfamily
5KU1A 5JE8A 4DCVA 1Z9BA 1X7ZB 3CRNA 4HF7A 4H1TA 3FB1A 3L05A 2FN4A 3RVKA 3FIJA 2J4FA 2PKEA 2BF7A 3CINA 1LF5A 4NDAA 4MRMB 4WE3A 1S3RA 1VCIA 4AO8A 1L7XA 2KMLA 4D2IA 5KTYA 3UW1A 5BW4A 4MVJG 3PHIA 1W4ZA 4Y3UA 2R62A 1MAUA 4YTEA 3TLCA 1GT6A 4MO9A 4JIGA 3AY0A 3RARA 4D4IA 5EIAA 5FTNA 4HMPA 3H13A 3ETGA 1CDZA 3UPTA 3LY9A 4N7JA 1GA1A 4LRWA 3KQUA 1L7VC 3Q8WA 1SUFA 3BN3A 1P0IA 4KWCA 5JI2E 3OQBA 1V1RA 3FFXA 3MCWA 1JEAA 4KQ6A 1SFRA 3B7GA 4I7EA 2FHPA 2PWZA 1PVDA 1C3LA 1ADYA 1IUNA 4BBJA 1CFZA 2WDPA 3NMUF 4K6MA 1FF9A 1Q6ZA 1ZJZA 1F9AA 4HQKA 3T5DA 4FC6A 2ARKA 2Z2ZA 4G97A 2IIPA 5DF1A 1SVLA 1KHTA 1XA3A 1D5WA 3JQBC 1XN4A 1XJQA 2AJLI 2R87A 2C5FA 1F38A 2YDXA 4H35A 4MV5A 2FAXA 4Q02A 3UKOA 1A8IA 3U1TA 1SD5A 2BM0A 2ZXFA 3IQEA 4HDSB 4JBIA 1DC6A 3R41A 2HPVA 4ZCPA 2BI4A 4BEBA 2HXYA 4OLJA 4UU0A 2B25A 4BJ5A 3ADBA 1SBYA 2YC4C 1QIJA 3OPQA 3DO8A 1Q57A 4QJ5A 4TYMA 2WWFA 1F6BA 3PFNA 3DM9B 1S0UA 4C88A 4X66B 2X8WA 1Z7YA 2WUDA 3HCEA 3F73A 5H70A 5JCOC 2C98A 4J0QA 4A2WA 1U1IA 3DVQX 3NTRA 1TA9A 5A0VA 2ZOSA 3G9TA 1AKQA 1PYOA 3GAMA 4QL3A 5IK2D 1J2YA 1J9GA 1EK2A 1G19A 1MDFA 1SCNE 3NDRA 4G1FA 3TLGA 4YYEA 5JNTA 2JIRA 4Q9KA 3SZOA 1YOBA 2HF8A 4EA6A 4ECEA 2CEKA 3K0KA 5A7GA 2F4VB 3DYVA 2I2AA 1XMJA 3H2HA 5J4KA 2WI8A 4DMHA 1GQYA 4WZAA 5HM6A 1J5XA 3M5WA 4QBKA 1EFHA 5D3MB 4RYDA 1BN6A 4N8DA 5K8CA 2J08A 3IVMA 4JL6A 1Q91A 3ZU2A 4JVLA 3UKJA 2EQBA 3WLSA 1JWAB 2Z1MA 3EB9A 1M8GA 3PCXA 1T5SA 2FUCA 5I4BA 3V4SA 4HH3C 1TI7A 1CR1A 1WUYA 1TQ8A 2I2DA 3SNHA 4OFWA 5T6BA 1NKSA 1BJKA 1W4RA 3F6SA 4FMDB 4NEGA 2VG8A 3SX4A 4IDHA 4PNEA 5JSFA 4DCNA 3GT4A 1MIHA 1K8QA 5SYMA 2DLDA 3VUEA 5BVHA 2CHQA 2R6AA 2B0CA 3L7JA 4LJ8A 4CCYA 1PJTA 3NJ8A 4B7UA 5LWHA 1KERA 2UAGA 1G2OA 5G4KB 5M29A 1WP9A 1P2UA 5FOVA 5FL3A 3SYLA 1L3CA 2H1CA 1EFDN 4ZVUA 5JSHA 1L4YA 5C46F 1KXJA 2KE5A 3DEIA 3KFXA 4ZQHA 1E18A 4ICIA 1KMNA 4LXIA 4U6NA 2QYHA 1I6WA 3QEBZ 1GCGA 2XPCA 1SKYB 1U3UA 3K73O 3P19A 2XGSA 3TPZA 4F0JA 4I9NA 1MW8X 4QU8A 3NYQA 1JQLB 1PWHA 1RQ2A 4EHFA 1VM6A 3CMMA 4CTNA 3M6IA 1B0AA 3O8LA 4RZ2A 3CLSC 4ADSG 4S1TA 5BSHA 4ME6A 4HAXA 2QAGC 3A3YA 3QVMA 3Q9SA 4JXJA 2YHAA 1L9XA 1RJWA 4EHNA 2CFIA 4NBNA 1IJBA 3U9SA 1D2AA 3H5AA 2WP0A 3NM4A 3RT9A 2QUHA 3V8EA 2UZ1A 3K6KA 1SC6A 1YA4A 1GLVA 3PQ3A 4OJKA 3W7AA 4W5JA 3U3MA 4Y8VA 4RY8A 2PX8A 3QY0A 3VPSA 3WWPA 1ORTA 5D86A 1QIHA 1Z4NA 4MINA 2OAP1 3P9QA 1K5DA 1Z3CA 2GB4A 2XLCA 4XUCA 4YA6A 4BASA 3CRQA 4WN9A 3H6KA 3KKLA 5AJYA 2VA8A 1GZSA 3KWFA 1GUDA 5EMMA 5DZSA 2YJ3A 1SVOA 2B8JA 3I23A 1L9KA 5FRDA 5TGTA 4CODB 1B73A 3GLIA 6REQB 2UYCA 1IL0A 1IG3A 3BCRA 2ZIGA 1DV2A 2HCJB 1RXWA 2OO5C 1UPCA 1XVAA 1DRVA 3FNBA 4ZQGA 4EATA 2O1XA 3VPGA 3ZI0A 4JJEA 3VOTA 4G4IA 1WSBA 1Z4PX 3SVTA 2VYQA 4W1PA 1ZVQA 2VBCA 5DHPA 4TS9A 5AVYA 1G16A 2ISQA 2RARA 3D4LA 2COKA 2QPAA 2VATA 3BBPA 3NDJA 3OT5A 4KWHA 4PU0A 1Y1SA 2MIIA 2ZT5A 4TS3A 5CLFA 2ZVPX 4BFLA 3N70A 3VHRA 2XMCA 4RLSA 3HXQA 4HWSA 3JU3A 1QO7A 3WISA 4HI0E 1WUKS 4Z6KA 3EPJA 2PX2A 1ZNXA 2FEAA 3T34A 1QLHA 1CKEA 3BGIA 3IOCA 3O7MA 3RSFA 1JHYA 1RWWA 1G7CA 1CNEA 4ZMSA 1WMBA 1LK7A 2IGBA 3SPXA 4AG6A 2QN7A 4M7WA 2GETA 1YJ8A 1FTWA 3CB4A 4RZQA 2NYVA 4IVRA 4BCCA 3HXMA 4GHWA 5FV7A 1MTOA 4UREA 2NXNA 2FMHA 4TV9F 3G17A 4H3SA 4Z7JA 5JJIA 1UKVY 3HUTA 1Z2CA 2XCUA 4X7RA 3WV5A 3A1NA 2B4RO 2DBRA 3PDUA 4MV0A 1UT5A 4BJ3A 3KPVA 1C1XA 1DAGA 4O4HB 1C9KA 3ELBA 2FPGB 2BIFA 5AMXA 3GP5A 3RABA 3CX4A 5J2TA 3PB3A 4KK4A 2QJRA 1VFNA 1YU6A 2XDQB 1ZD2P 4FIDA 4RJ2A 4WL0A 3C3CA 4TUYB 4YALA 5E7JA 2OENG 4DV0B 3PLAE 5C5EA 1TCUA 5JMTA 1GV0A 4RAQA 3BM5A 3KTOA 4MGHA 1WCWA 2X9NA 1N4DA 1EE9A 2ZYWX 1BGVA 4MP6A 1HV8A 1IHOA 2C42A 1YGPA 4M0DA 1T1SA 4A73A 4QATA 3B6IA 2W2VA 3M89A 5DP2A 4Z0NA 4ZP1A 2O14A 4JK3A 3CXUA 1KMIY 3S3TA 2PLAA 1DAIA 3NAGA 1M1UA 2CWDA 1XYYA 3C4JA 2P5UA 4JJ6A 4ZARA 3V8RA 1A9OA 2JKYA 3TCNA 4WT7A 3WWCA 5AOBA 4D3SA 4YBRA 3NYIA 1GD1O 2J6BA 2R7AA 4Q34A 3H5RA 2CVPA 2HL6A 3L41A 5D1NA 4ZV7A 3KYBA 2ZI9A 2A6PA 4H9GA 4YRQA 1XPUA 1TUBA 3G2MA 1JAXA 3U17A 5KDDA 3SR4A 3OCXA 2W2MA 1GHTA 2JLVA 4LK3A 3PXCX 1X42A 1YUBA 2G77B 5JPCA 4MUIA 4KXNA 1I5RA 4PX5A 5K6TA 3A2KA 1A9PA 3AJDA 2HLDA 1FFGA 1OXKB 2JG3A 4MB0A 1NBMA 3PXBA 2C3UA 1BRMA 3P9CA 4PZYA 3AF6A 4ZJYA 5JVDF 3ZZUA 3OIFA 4RD4A 5DGDA 3G82C 4ZCIA 3T9AA 4O4LA 3M83A 4M8IA 2LKCA 4RDCA 1RFGE 7REQB 1H2HA 2HA6A 2QT9A 5FNZA 2OGZA 2VP9A 3IBGA 1V5IA 1JHMA 1VJ0A 2MOKA 4GRAA 4K9LA 5GVSA 5K3OA 1HE8B 2CD9A 1JG3A 5IXJA 1ZIOA 3L1JA 3UGTA 4H27A 1TAHA 3SI7A 1KQFA 1V4NA 2C2MA 3KSDO 4XGRA 4ER7A 3HY6A 5HW0A 1RI1A 3JQ7B 4GX2A 4WJKB 1OD6A 1AT1A 1JTVA 4KUEA 1BE1A 5DI9A 5FQNA 1T13A 4EYSA 1T9AA 1J33A 4MPRA 1QKIA 2HHJA 3ZHBA 2ATEA 3D1LA 1V3TA 1VP9A 3I9FA 3SZUA 4LGVA 2RB4A 4TV8F 4BV3A 1D09A 2RB5A 3DULA 2YZ7A 1VJ1A 4HC4A 2I8AA 3ZDQA 4CXMA 3F6RA 2B30A 2YUTA 3ESQA 3UHAA 4HDKA 1R4NA 4HVCA 2DXIA 4IGEA 3SQNA 4UDYX 3ENNA 3KKPA 2VAXA 3INGA 1A2OA 1NJ2A 4FGSA 4MGEA 4B46A 3ZCTA 4DM7A 3PQ4A 3PEVA 1W4CA 4UHFA 1UDXA 4JI4B 4XH9B 1QZTA 3G0CA 1J0EA 3JQFC 1U8UA 1W94A 1JKFA 2O8FB 1TNDA 2FSVA 1TOAA 3R09A 3LWDA 4RA9A 3M1YA 4TL6A 5LMUB 2PQ0A 3A6LA 3V1KA 4B6GA 2Z8YM 2QNIA 1A7UA 3KG2A 4QA9A 2IL1A 1IM2A 1WV1A 3N2GB 1KRHA 3H5OA 2CUZA 3BWEA 3NYWA 3O9VA 3Q11A 5EYPB 3QX3A 2IOFK 1KOGA 3L84A 2IW1A 1NQWA 3OIUA 4Q0MA 2PCLA 1DUSA 3WBJA 3IRUA 2N46A 3CIOA 3LLCA 3T0GA 3NHAA 4E4RA 3ZDZB 1RXUA 4YLGA 5LQSA 1PT5A 2LIVA 1AQUA 4NAUA 2Q5QA 3K5PA 4KJZA 1CUZA 5HRCA 3N39C 2ID4A 1L3IA 2AEJA 2W90A 2RFLA 3H4IA 2KM1A 4KEAA 3D8TA 4D4HA 2C5GA 3VKFA 1ZK2A 4TLBA 4KPFC 3WE7A 3ZGOA 4BMZA 4C21A 4D3DA 1H5NA 3RWOA 1ZHFA 2X0IA 3ZYZA 2J0QA 3Q87B 1D8TA 3H1PA 3HFRA 1GY8A 5JH7F 2XMDA 4N6GA 3RG2A 2W6ZA 1RIFA 3HVRA 3A26A 4JJGA 4MB6A 4NV3A 1J70A 4IH9A 3Q3CA 2AKEA 1R5JA 1XNQB 3LOUA 4UD2A 2Q2WA 4CMJA 3D4OA 3KD2A 1U9YA 3F46A 1F8YA 3ONFA 5EJ6A 1PJRA 1UZMA 3PHJA 4OGKA 4F4UA 3L8EA 5T3YA 2FEXA 2FZKA 2FPXA 5EKSA 3VZQA 2RGCA 3C70A 3PZRA 1EGAA 1U8TA 1WHTB 2PSEA 2VF8A 3MK31 4GECA 1PIWA 1N33B 1MAWA 3TLEA 2X77A 4NLLA 3KU4A 4R2LA 3M7IA 5HYVA 2PJRA 1ORVA 2IW3A 1Q84A 3U7IA 3NBFA 3V4VB 4BX9A 4MRSA 2HR1A 1VYHA 2ISSD 1U2GC 3FDZB 4FLMA 3AHDA 1XLTA 4U00A 1NXTA 4BO0A 4L16A 3LLSA 3WIDA 2JRCA 2LXNA 4EG3A 1G5PA 1I4EB 4G4SO 2A0WA 3B9RA 2Y1WA 3K9BA 5CDUA 4FM9A 1OTXA 1T9GR 3LO5A 1LVUA 4UARA 4G0NA 4JBYA 5TQ2A 2GHQA 2PZ8A 2A3RA 4QEDA 3QE2A 3ER8A 3L49A 3LY5A 3S7ZA 3F7TA 5KYNA 1LJLA 3L8FA 4NNJA 4B47A 1PJQA 2PM8A 2C5EA 1AKUA 3QEMB 5HTKA 5B6PA 4XD7A 3ZE1B 4U5XA 4FGWA 1BDIA 3TIXB 1DKPA 5CVJA 1BQ3A 1X19A 2P9YA 2PJUA 1KGDA 2PAFA 3T4PA 3U0VA 2XKKA 5A0TA 5LJIA 1LH0A 2B92A 2F67A 1OCEA 5A4KA 4OYHA 1M1YA 3WADA 3IR7A 2CCJA 2MSCB 4HFJA 1SQGA 1YJXA 2EDAA 1U5BB 4M0LA 3FWZA 1QKKA 1Z83A 4OXKA 3MPOA 5JZSA 1B7GO 2A5FA 2PQ6A 2PTGA 2J0EA 2WAXA 4TM7A 4KX3A 2Z5VA 2ZRMA 2JEOA 3L0DA 5IM4F 4NMMA 3NHJA 1RC8A 2JFVA 1JKJB 1EXDA 1R12A 3AK4A 4JBGA 5PGMA 3L4BA 3Q12A 1X1DA 2NT4A 5I45A 1BKSB 3B12A 3B48A 1T4CA 4WSOA 2R7NA 4K87A 1RRKA 1NJGA 2CZGA 4X97A 4C5BA 1V7QA 3NV7A 4FR2A 2Q6LA 2WA1A 3I30X 5CPFA 2VZEA 3SXUA 3ZG6A 2VTBA 4UVDA 3CLRD 3VA7A 2QGNA 1RWKA 4JC4A 4RJIA 4UHKA 2RDMA 3E84A 9ABPA 4WLUA 4MYRA 4RSGA 3DEZA 3MLBA 4XGNA 5GZ1A 2ZRLA 4RDIA 1V8DA 2E4ZA 2ZB2A 2F1KA 1KWGA 2FWIA 4C0QC 4DILA 2WJVA 2YY7A 4Z0TA 1HRKA 1DI0A 1XELA 5CYOA 5CYPA 1Y42X 5F35A 2QJOA 3ZWBA 3H75A 3PD7A 4XCVA 4G84A 4LA4A 1FXWA 3I6ZA 1K1EA 3AXTA 2VJMA 3CW2A 1P6UA 3TD9A 4BO7A 4ENSA 5K0ZA 2GAFA 3FTPA 1RCTE 1CUJA 2CFSA 2FLWA 2RHOA 4ZPJA 4E51A 1R0CA 3OZGA 1DJNA 2X8JA 4WZAE 1OBOA 3WLQA 1NGSA 1NMYA 4G0PA 1QX4A 3BOSA 1JT9A 4IRXA 4N5HX 5M04A 4DUZB 1E3IA 1K86A 2XUDA 3OCYA 1QP8A 1I4WA 3HWX1 2YJ6A 1L3BA 3PLRA 1EFVA 4F60A 2NZ2A 3MTJA 1AE1A 3ND7A 4C3OB 5A04A 4OJNA 2REXB 4K7JA 3UK0A 4UPEA 2GUGA 2MMGA 2I6GA 5KSYA 4WKPA 4BNZA 2HBRA 2OY0A 3DS8A 3PXDA 2GRAA 4R2HA 1UBHS 2A35A 5FWXA 2CXSA 1Z25A 5LMNB 3GGCA 2ATXA 3C6MA 4PSKA 3VUFA 5HZMA 1T35A 1JDBC 4C29A 3CPJB 1T3GA 1IONA 1QTRA 2HXGA 3PFGA 3QW4B 3I8XA 3WBFA 3GXBA 1FRZA 1I9GA 2X0KA 4BQEA 5JR3A 2YJ5A 2CFRA 5LQKA 5DYNA 2R1VA 3SHTA 2OTCA 4R0VA 4XWYA 4NH0A 1YMUA 3I1YA 4BLOA 3IUNA 1MIOA 1W52X 1W88A 4JWKA 3JZAA 3SJCA 2IY9A 4IEIA 3C7CB 3G0HA 2BR4A 3MWEA 3RK1A 4RORA 5BSWA 8LDHA 2B36A 2WJYA 1V6AA 4N5DA 4Q48A 2JLAA 4F6LA 1XXHB 3KQKA 1PVOA 1U7UA 4JIMA 5FBQB 3ZWAA 3W5SA 2FHSA 3CVOA 1QOQB 3BBLA 5EUQB 4R1UA 4DDMA 1RKVA 4RFSB 2W6MA 1Z0DA 4I3HA 1W19A 3C98A 5EMNA 2AXEA 3RIHA 1RI4A 1I1OA 4MS1B 2HIHA 4OXYA 4RIHA 4WWHA 5CM2Z 3THWA 2ON6A 3A06A 1O95C 1TVKB 3T99A 2CEAA 4WAUA 3ZHQA 4HXYA 2AFIB 3FPKA 5BSKA 4MJLA 4QOGA 4GXRA 4R2IA 1YFLA 3L7CA 1TGVA 3QPWA 3BPSA 1G42A 4OJMX 3LY7A 1JJ7A 2WM8A 3KKOA 1NFRA 1VPTA 1OU0A 3KUKA 3S5JA 1NBHA 4L5YA 5ALZA 5FUMA 5LKAA 2BFBA 3GYBA 2IVFA 1VLMA 3WQQA 3U4MA 1Z6TA 3WG9A 4YV7A 1JG6A 3O8NA 4FFWA 2PBZA 3V4OA 3IPYA 1G4AE 4PN7A 3GLIE 2NP6A 4C4ZA 2A5GA 3G5LA 1T6NA 2ODQA 3AG6A 1TYEB 2Q2QA 1JFRA 1KDVA 4EHDA 2GQ0A 2WA2A 1PR9A 4B48A 1JFLA 2F7SA 1I2ZA 2OCKA 2FUEA 2P0AA 1E6MA 3EHEA 2DFNA 3FTNA 3IT2A 3B38A 2OOSA 3LQQA 4O2LA 4D4GA 2V6BA 2AWOA 1CQJB 3L0OA 4J2TA 3FCAA 3C5WP 2Z56A 2BH2A 2C7GA 1NHGA 2QOEA 1AKRA 4R9NA 4IV5A 4CF3A 4HS9A 3CNHA 1XUOA 1LPOA 4ESEA 3M34A 1LX6A 1OLOA 2DUUA 4ZYTA 5A4AA 3QXHA 3DAGA 4ZODA 3EX7C 1PJCA 4ZTBA 3AVOA 4DA0A 3QLEA 1L5KA 5DTIA 1P60A 2QGFA 5DGIA 3PHLA 4GNRA 1DQSA 2GKGA 3PL5A 4I2VA 2PL1A 1H2YA 4C4RA 2XF2A 3R75A 1NTOA 4MV7A 4L74A 5E6RB 3H5WA 1YCDA 3N76A 4AMBA 4J7XA 4OM8A 1S2NA 1OB2A 3FBTA 2CV2A 1LDMA 1I36A 1GV1A 2IYQA 5ADVA 1O0SA 4AO7A 2ASVA 4O6VA 1VMDA 1OXVA 3BGDA 3IUBA 1H1TA 3V1UA 4DB2A 5IFLA 3T52A 1MC4A 1Y9DA 3D4BA 2A5YB 2R8PA 2X58A 3FETA 3DBVO 2Y9PB 3GELA 3NRBA 4QUKA 5AW5A 3LVQE 4GQAA 3TTWA 4EA8A 3A3NA 4FOPA 2H65A 2Y3IA 4PNPA 4TL7A 5M3BA 4MHTA 4GZLA 3B1FA 4AAYA 4ZT3A 1HSOA 4GYJA 2CW5A 3TLGB 3LK7A 1ELOA 4MQ6A 1ZOIA 2P9GA 3NKVA 4QRIA 1QRTA 4PIPA 2JGLA 5KKAA 2JFGA 4LOIA 4B79A 2WOJA 3DEAA 4C0SA 4LC9A 3SZGA 4NVRA 5ADHA 3KBOA 1Q1BA 1BVRA 1ZXBA 4RTOA 4LF7B 1H8EA 3ZWVA 3FWNA 3F8WA 4GGOA 4OH7A 2CCKA 4D80A 2G76A 1P4RA 1O94C 2XD9A 4KUHA 1E4OA 5FPTA 2Q7DA 3AR7A 3HJAA 4UFNA 2FMIA 2B1IA 2BFEA 2Q3FA 4MTLA 2QI9C 5HF6A 3C1OA 4DW8A 621PA 1YR8A 1FZTA 2VXCA 4BJ6A 4ZQEA 4EKDA 3K0FA 4C4OA 1OI2A 3JD3A 4Z7QB 3A9TA 2WLTA 3FNIA 1LGYA 3DOOA 2GPSA 3KM0A 1ESEA 2Y77A 3N6RA 3WGQA 4BFUA 3ZGVA 4EAAA 5BVHB 4A0GA 1Q11A 1ZZEA 1K0UA 2CF5A 1GL6A 4BMXA 2P7HA 3B51X 2J45A 3IDAA 4FMDF 2PPVA 3BDAA 3FLBA 1Z2OX 4E4TA 3FVTA 4KE9A 3Q7QA 4C03A 1NBME 3IODA 1DS6A 1NYQA 1KBOA 1Y3IA 3ET4A 4FHFA 3UCFA 1DQRA 1J1IA 1YRAA 3I8SA 1TKAA 4DA4A 1DO0A 1WB4A 1YJBA 3EPKA 1HOXA 1Q15A 4UFOA 1SJ9A 3Q7EA 1JFVA 2FFAA 4AJ1A 4JI3B 4NCXA 5DMXA 2HT1A 1PL6A 3WK5A 4M1WA 5IWAB 2MSDB 2OBMA 2H4YA 3TSAA 4LF5B 3DB2A 4DHWA 2Q5CA 1EBBA 4PO3X 3C5VA 3CIFA 3FGNA 1L5YA 4GF5A 3WWZA 1ONPA 2C96A 3WR5A 3BCUA 4P4UA 1CDDA 1I2BA 1FFAA 1MA3A 2UZ1B 4DIEA 2H9YA 3T1YB 4URWR 1E0DA 3GLQA 2IKQA 1OKKD 5I01A 5DJ5A 4MRRA 3BE8A 1SZJG 2ONJA 4HCJA 3U7JA 1UWLA 2ZSUA 3ER6A 3RREA 2ZRQA 3H1EA 3PFKA 4K6OA 4RY0A 5AVZA 3I3SR 4WN9B 4LJYA 1DFHA 2XDWA 4CZ2A 1Q83A 4OI1A 4DQKA 2QQ5A 1U0SY 4BE7B 1R18A 3EVNA 4AS2A 4H7IA 5B1HA 3GLIB 1YT5A 3LPLA 2JDIA 4NBSA 4JI7B 4I4NA 5CB6A 2FCRA 2VYND 3ETDA 5ALGA 5AP9A 4I2NA 1VKOA 1V45E 1VPDA 1EA5A 5ECWA 5BYKA 2IZZA 2B69A 4GR9A 5I9SA 1EUYA 1XE3A 2FPIB 1XKQA 4Y9SA 3FWPA 1OAOA 2HYIC 1ZRHA 3UG7A 3FTEA 3COSA 4IEFB 4HB3A 4F2PA 4JXXA 4BKUA 3FCCA 1LLDA 4WLNA 4F5ZA 2H54A 1NT4A 5JZVA 1SURA 3ORRA 4L15A 4D3YA 4HLNA 3GI1A 1BCRB 4QXRA 5IJ9B 2GLTA 3FROA 4J4BA 3QHAA 3H1GA 5A4JA 5M5BA 3P9NA 1W5FA 1P72A 5ICFA 5L7TA 1JU4A 3EN0A 4JKOA 4Q3CA 1JKXA 4JVOA 1E1CA 2POQX 4XWTA 3ILHA 1QO0D 4JR1A 1XEWX 4WOCA 4MUKA 3JTMA 1Z4MA 3BVPA 1Z5OA 5EIFA 2EFYA 1X92A 2GTIA 1M9NA 1XZJA 3MCTA 3PX2A 4MQ4A 5EP3A 1IQUA 1SZPA 3NV9A 5DIZA 2WV9A 3B52X 4FXOA 1GEGA 4MQLA 3BWVA 4A6PA 2ZYRA 3GBSA 2XXJA 4R5HA 4RETA 5AOVA 3OPVA 1N1EA 5DXJA 3DOFA 2OFWA 2ZUTA 3IF8B 1DQYA 2TMGA 1C1XB 1DSSG 4AC9A 4LVOA 1E8DA 5IBPA 3GGJA 4QDZA 5LL6P 1TT7A 1XTUA 3FVRA 3RRFA 3C7KA 5GV8A 4D96A 3PJEA 2R85A 1N1DA 4FFSA 1LTQA 3QE9Y 3DVLA 5B4TA 2QM0A 3SIWA 3GNLA 5BSVA 3C39A 2XWSA 5CPBA 5GGYA 3UNXA 2I67A 1TAQA 2PX6A 1E1LA 1T2NA 2RKOA 2X42A 3OOHA 4RTRA 3AOGA 2VP0A 3TX2A 2BGRA 2W9XA 1WMAA 2P79A 4TUYF 5KVVA 2WICA 1VE7A 2D0PB 5AM5A 3HRHA 2ZT7A 2GVDC 5J1TB 3UUWA 4ARIA 3ICEA 3W5HA 1VTKA 3VU8A 1T6YA 4YQYA 4C1BA 1RQLA 4L28A 1YDMA 1Z4OA 1FU7A 2XB2A 4M0KA 1Z2EA 1DC7A 3T1OA 5K0BA 1GL7A 5GAJA 1OV6A 2UZIR 1FK8A 2H17A 3O91A 5ITZA 2YWDA 3BXPA 3TN7A 1FOEB 2WWXA 1II9A 3KP1A 3JXEA 3WGJA 3RRJA 1ZBDA 5JALA 3QV2A 1U5AA 4Z4GA 3FVQA 3HFSA 4C1NA 2I1LA 3IILA 1COZA 1Z0JA 3IHWA 1L1EA 4MWZA 4TWBA 2W0MA 4JVMA 3UT5B 3WIUA 3EH2A 3EDQA 1KZHA 4YAKA 3C6ZA 1ZNYA 4P2BA 1B0ZA 3GJ8A 4KB5A 1M1YE 2GCNA 4DE5A 3GJ3A 4PYKA 4AXXA 3JWGA 1QTIA 1VMIA 4H17A 3H1TA 3HJHA 2ZAMA 4YGXB 4M55A 2OHGA 2C95A 1VP3A 3HA3A 2AR7A 2A5DA 4UTRA 1T8WA 4UHDA 4II7A 2QZ4A 4UM5A 1NY5A 5GP1A 5K5EA 5DHQA 4JH0A 1OBFO 2C8LA 5C37A 3ZHZA 4DPLA 1M76A 1X1TA 4HVTA 1N2SA 2ETVA 4CTMA 5I47A 1XQ1A 1JWBB 1YRHA 3KZNA 4TWRA 3SD7A 1G7RA 1TD1A 1KP9A 4IS2A 2ZWOA 3TL3A 1R5BA 1SUBA 1KP2A 4DV6B 4DLPA 1UQTA 3GEPA 2F2TA 1F2VA 3AHJA 3B8EA 3QX7A 4ZC1A 1U6IA 5BWCA 1EVLA 2OD9A 2AE1A 2GAAA 3GFTA 4BO9A 3TIVA 3KHSA 3AUAA 3ZQUA 2XOXA 2IPAB 4A8HA 3DBOB 1GAJA 4CM3A 5CBPB 1UFVA 1R4NB 3LQ2A 4J16C 4XTCS 3UF0A 3U1VA 2OFOA 3WIVA 4YXFA 5J5VA 3F6YA 3PKZA 3ZKWB 1E94E 1U3WA 2FW1A 2FZCA 4DCGA 3PSHA 5KQSA 2NAFA 1HDXA 1V7CA 2F9FA 3HGQA 2BR3A 2ZDGA 3I37X 4FLFA 4FTWA 3NONA 4Z2AA 1W85A 2ZI4A 4W8OA 4IKOA 3BRSA 1FMJA 3GFSA 4WCVA 3QKTA 4NCIA 4RA9B 1NW5A 3DZCA 2BP7A 5HQJA 4E14A 4G9EA 1QF6A 1RLTA 1CJUC 1HYEA 4NEQA 5DNVA 2I7XA 3A70A 2NUPA 4WCDA 3BA1A 1R6DA 1E5QA 1CB0A 2RGYA 3GEBA 3DMPA 1XTSA 3S5UA 1Y33E 2INGX 4DLTA 3GZ4A 2AJCA 3VH1A 3GLUA 3KVNA 3IDSA 3PXAA 1BJRE 3BJZA 1FQKA 1ZJWA 5MDHA 3RHFA 2WVHA 2C2YA 5C18A 3UV6A 2ACVA 1TMOA 3FX2A 1M34A 3I39X 3PU6A 4AYTA 3PQCA 1MHTA 1V5FA 4ZEXA 2H1SA 2EKDA 1QYIA 2N0SA 4IZIA 4FP9A 4Z4FA 5F1KA 4BBPA 1C5KA 3HPQA 3NT2A 2C1EA 3P26A 1ZK0A 3HR4A 3RNOA 3TMAA 1U6JA 3CG0A 2AXNA 5CNKA 2C2WA 2JJ1A 3AJEA 4XD2A 4PAGA 1GARA 4PRKA 3ZWKA 5FOQA 4NJMA 5ILOA 1M7BA 3FN4A 3V6LA 5KDLA 3RS2A 1TMYA 2QP9X 2WF7A 3OX2A 4RGVA 3MB5A 2QMQA 4EP1A 4GPBA 5FHRA 3JVVA 2PPLA 3UAVA 2PWYA 3BMCA 4JL5A 2KB0A 1JQEA 1P1JA 4P4SB 1PRYA 4TOIA 3OPYA 4OQLA 1J06A 2VRNA 3SP1A 3S0JA 2A30A 1PGNA 4YMWA 4LZJA 5B2EA 5C3MA 4Q4AA 1X7XA 4A8JA 4B75A 1NW4A 2BGKA 2ZS8A 3AEQA 3C3KA 3FFWA 4JBHA 2BEWB 1YIDA 5ESXA 3WL4A 1CF9A 1C9NA 2O48X 1HM5A 1TEVA 3W5CA 4CEJA 2CXQA 2RAFA 1CK4A 1J39A 3QXSA 2CK3A 1ZH6A 3HFJA 3STVA 5JEDA 3LZ6A 2ZSEA 2XADA 1IPFA 3QXCA 1RHUA 2W4QA 2Q8PA 1PEAA 1XTQA 5TQ2B 2IH4A 3HEBA 4JGIA 3LPNA 5J63A 1CLUA 1M2NA 1SZDA 1GQ2A 2BOVA 2GD6A 2ONCA 2ZBFA 1PEDA 2AL7A 4OHBA 3UHPA 4AK9A 2VC2B 4EB6A 3D3JA 4F4HA 5F33A 3I45A 1X1RA 2VJYA 3OJEA 5KCMA 4C20A 3C3YA 5CLGA 4KWIA 1JDVA 2YV1A 1K7FB 3SXJA 2C92A 2AV6A 2ZBRA 2C7QA 4GQIA 2CXRA 2GWHA 3E22A 1PWZA 3HV0A 1RBYA 3HO8A 4BVFA 4F71A 3V8NA 1Z5NA 1H6BA 3EEYA 4IIJF 3ZGYA 5CFNA 4QRHA 1R5OA 1FX1A 2O1WA 4WNAA 5JG7A 5K3AA 4NK5A 1D03A 2YOFA 4CDMA 1C1YA 4FCTA 1JHXA 1SCBA 1WA5A 2V5UA 3TPFA 1A8PA 1KO5A 2A0XA 3L0ZA 4EF4A 5CDTA 1QHEA 4ROSA 3JYLA 5DFAA 1YA6A 1CUEA 2CLFB 3R2JA 3E23A 3IBFA 2AQ8A 2YW2A 5FUYA 5JFGA 3QEAZ 4ZVOA 1EFKA 2FZEA 1UXKA 2VSNA 1BEUB 2NXCA 1R50A 4RK0A 4R69A 1Z3IX 3HI6A 2DMRA 4GBED 3VSEA 2OZPA 3EGOA 2RK3A 5DOZA 2QZ9A 5H4GA 2DQ4A 1FIUA 1JXAA 3L7MA 1DAKA 1NYLA 4FONA 2ZCJA 4B34A 3P0EA 2A5LA 2ORWA 3GUYA 4M0UA 2NW6A 3K8YA 2HD4A 4QUAA 1XC7A 3NB0A 4JZYA 3STYA 1JR3E 5SY6A 2VTBB 1Y3AA 3SXUB 3OX4A 4MW2A 5AKHA 4AD8A 1XL1A 3UJ8A 5D87A 1T6ZA 4B73A 4EJFA 2JLCA 4JP1A 3CR7A 2IXAA 1YTLA 5GONA 3L1UA 1RMTA 2IXGA 2N1BA 2V54A 3SM9A 4BKPA 4CL0A 4U2DA 3M1LA 1U6KA 1YUNA 3F5MA 3MUNA 3OPMA 4K8OA 3T1NA 4C0HA 4F4JA 5ADWA 3FBGA 4OFXA 4UUBA 4RM3A 4ZI5A 3PEWA 1U0FA 2R47A 1DTWB 1YS9A 5CVVA 4PC2A 2BE7A 1A9XB 2Z95A 4Q3KA 3IOBA 1R5NA 2P3LA 2AI2A 2OOKA 5G02A 2NYAA 3S1LA 1WXIA 2G17A 5LP6A 2OB1A 2X8JB 4W8GA 5H83A 1QHGA 5DM70 1EJBA 1YNOA 5AVSA 5HOEA 2OD2A 4BNDA 4LFAB 4M7RA 5A3JA 1V5EA 2BJHA 4BZXA 1D2CA 4ZHQA 3T54A 1T4DA 4Q4DA 5I9NA 1ZMRA 3CGGA 2XOEA 2JKZA 3CG4A 4D9FA 1US8A 4ND6A 1EFVB 1K7CA 3QGMA 4RJTA 2WIAA 4RV5A 4YCSA 1XRNA 4NCHA 1UP6A 2VQ6A 3A1DA 3OM9A 5ERXA 1VB5A 3PNQA 3UAYA 2YDYA 3RRZA 1EP3B 1JIIA 1NIJA 2XODA 5FULA 1N3IA 1XQ9A 4PQFA 1WVMA 2WHQA 1SCUB 1G9TA 3U7QA 2NZYA 3WGMA 2ORVA 5CHEA 3OWHA 2GM9A 5FWXB 3OKPA 3RVMA 3WYFA 1OYOA 2OQRA 4RL4A 4FN5A 4F46A 3R77A 2HEIA 3VTAA 3HBFA 3ZY6A 2J3LA 2PJZA 4P35A 2MYTA 3GVXA 3FOWA 4X71A 5TEVA 2I33A 4IDQA 3OLZA 1NVFA 2ZGVA 4IXWA 1MQ8B 2R1VB 4IDDA 3SAJA 1EP2B 2D3TA 1UPXA 2Z2JA 1E7YA 2WSSA 3C43A 5EQJB 4ZI7F 3GGOA 1MIOB 3PJVD 5B3AA 3ZDEA 1EESA 1I3KA 3FLEA 3B5IA 1U80A 3MWEB 1L6RA 1XEXA 2FR0A 4CE6A 4L2IB 2AXQA 3AP2A 2C78A 3HSYA 1WE2A 3JQ8A 3L3BA 3Q5EA 4HTFB 4HWPA 1EQUA 2FP4A 4NDNE 4W5OA 1XCOA 2AE2A 1ECBA 3OHPA 1Z37A 1M33A 4EAQA 1Y5LA 3JD0A 3WGHA 1FPQA 1UJNA 4F9EA 2VAVA 3DV9A 1QV6A 4ZVNA 1TYAE 1ZQ1A 3F5SA 3RF6A 2ZRCA 4AKSA 4CYMA 3LVFO 4RTSA 4JQYA 4Z1OA 3THWB 4U2CA 1QAOA 1SUPA 4R9SA 3D7NA 4FNAA 3RLFA 3TJRA 1L7OA 1XQ6A 3AERB 3K16A 4IO1A 3WOHA 3QHPA 1M2JA 4LC1A 4MI6A 2PD3A 3DA8A 3LP5A 5HJ5A 3HN2A 1GR0A 2XWBF 4RVNA 3RRNA 2I76A 4ZOCA 4G1VA 4GD3Q 4D8VA 1HZJA 3DLBA 1D9XA 3V8PA 2BFBB 1DAHA 1ZBQA 3ABQB 1X7WA 4P5PA 2P6NA 1U4NA 2J9RA 2LVBA 3OEED 2DFLA 1ZCJA 4WFIA 2CMFA 2H0RA 4PNZA 3JRXA 5CB4F 5KTRA 1RLIA 3B5JA 1E2MA 2OC4A 3D81A 2WVJA 2XXAA 3O7WA 3WMEA 1FNMA 3PIIA 2JZOA 3OSUA 3QITA 1FTQA 5J5CA 2R2AA 3MERA 2JGFA 4KVFA 2CV1A 2GYUA 4FS8A 2GEBA 3QYJA 1PK8A 4MPJA 4AJKA 1R88A 2HLHA 2QJTA 1Y8RA 1Z0SA 2QHXA 3G0OA 2ZAOA 4X1YA 3B1JA 1GZ7A 1FDRA 1SG0A 4L3OA 4XLZA 3DUFA 3M0EA 4OUDA 4DLVA 1WLYA 4EFDA 2QRMA 2HHAA 1VBMA 4I1IA 4EKYA 3U56A 3TOZA 4UPVA 4R1QA 4OVKA 1QVZA 1S5PA 5K45A 4EYQA 3SFZA 2OHVA 5ALEA 4CKBA 4MYCA 3Q3JB 4EUKA 4M9QA 2FKAA 5CXQA 2HMAA 3LT4A 5IAJA 4S35A 1TT5A 1RMQA 1T24A 3DOIA 1N6OA 2PUEA 3DOUA 4BO6A 1EUQA 1OILA 3HB5X 1TKRA 3NTUA 1P2BA 4Y9RA 5AWFC 1GFZA 3B1XA 3WLPA 4BVBA 4MPPA 5ER9A 4QYXA 1FSZA 1BVHA 2IH5A 1Z16A 2AFHA 2B9VA 2I3DA 4TYQA 1R0KA 2OBLA 2RH4A 3B3FA 3VQTA 2RGNC 3GRYA 2UV8A 2Q1UA 1ORWA 5AI8A 4HLQB 3VSAA 2B6HA 1XLVA 4LNUA 3S4YA 4FUQA 4EFKA 2IYNA 1SBHA 1SKAA 2QMYA 4PIMA 2G8LA 5EN4A 2XIQA 4NNOA 4FYIA 1QIIA 3K2IA 1WQ1R 3UO8B 2JGNA 1MR3F 4I1UA 3GD5A 1NBMD 2JFHA 5FBZA 1ODKA 3STHA 4KACA 5EE5B 1YDEA 2APJA 1OFUA 2ZREA 3G68A 3P2MA 2EBHX 3ZOKA 3EPPA 3L0IB 3NHLA 5H81A 1U81A 1ZLXA 3W2EA 5EJ5A 5DLPA 1U0NA 1ZVMA 2R6JA 4H3VA 1TZJA 4AY2A 4GC5A 3ZTYA 1IUPA 1DBWA 1BROA 1KPHA 2CMDA 3IOYA 3NCHA 4QVKA 3U7RA 1EJ6A 2PBRA 3AFNA 1GG5A 1HO3A 1Z7WA 5E7IA 1AMOA 1PKXA 2MSWA 1Y4ZA 3P45A 5K4AA 5KIAA 3EAQA 1FMFA 3H7AA 3QQ5A 1IWPB 2J5KA 2XLBA 2ISCA 4WVLA 2XV1A 1AGRA 1OFIA 1AZWA 4CHGA 4F5DA 1C4KA 4ON9A 3WK6A 1FFBA 2VSFA 4RD1A 1N3YA 3OJXA 4EHAA 1Q1GA 1ZGBA 2WNSA 5M7EA 2IUEA 3V4RA 3WLMA 2C5HA 4RE5A 4JAVC 4BVKA 3WMGA 4A6EA 4EWLA 1EZZA 3CR3C 2HQRA 4H6VA 3EZYA 2G9NA 1TUGA 3E27A 4HWOA 4HYEA 1RYNA 3PTAA 3ESRA 1D07A 5EP2A 4BE4A 1GFWA 5CB8A 1PDOA 1PGPA 4GR5A 5CXSA 3DOJA 4D4LA 5IU6A 2AMVA 3D5QA 4R8LA 1MH1A 4CM8A 3KRTA 3CPEA 4FFDA 1X0XA 4G8DA 3L4KA 4QLAA 1KJYA 4KHZA 4L08A 4ZN6A 3L4JA 1HDEA 3F7MA 1HDRA 4ER3A 5IT0A 4OKIA 3HBJA 3VNBA 1YQTA 3P0RA 3PENA 1Q77A 1X1BA 1K5PA 2ZSHA 3K9NA 4FGZA 3C3JA 4QGFA 3ZE2B 4ARZA 3CQFA 4QDJA 2WB2A 2PL5A 4BEJA 2DKFA 4EG6A 1KFBB 4J49A 5H7XA 1SXJC 1DINA 2WKPA 2FEKA 2RBKA 3MQ4A 4AX8A 1UBLS 3B9BA 3P1JA 2H4WA 2YZGA 1OGJA 2FQQA 2O3UA 4ZZ0A 2HU2A 1KWKA 1SXQA 1EX6A 1JSLA 3NH6A 4J94A 1XT6A 5A3VA 5C81A 4RW0A 1QP4A 4E1VA 1GFSA 4R9UC 4PN3A 4WKGA 4F21A 3EZXA 3JS5A 4BO5A 4B5KA 2WW8A 5DBFA 2I3GA 2IIBA 2GPYA 4IEEA 5JC1A 1XK6A 5IM5A 4UJ5A 1PJ4A 3G8DA 1IHXA 1T9DA 1PLJA 2RAUA 4HX5A 4TQUS 3K8ZA 4OQPA 4KGDA 4NTZA 3SVZA 3DQQA 5BXYA 3R0JA 1JG7A 3ESAA 2R6DA 3AONB 4O4JA 5JWOA 3R0ZA 4KDFA 1SHJA 2J7KA 1GPBA 1QGAA 4U6SA 4BZZA 4KITB 2XT6A 3C85A 4OAOA 4XEUA 2YRFA 2Y0EA 1KH2A 1A8HA 2HEGA 4RL6A 4KIWA 2C31A 2ACEA 2K7ZA 5JLAA 4B85A 2YIMA 4DIBA 3MQFA 3PRJA 1D2NA 4PG4A 2EARA 2QG9A 3PUJA 4ZCMA 2ZSDA 3I52A 3FYUC 1NLFA 1IVYA 4HAVA 1U0LA 1FFSA 3HUEA 1QV7A 2I6XA 3QH4A 4IDAA 4BFVA 2G63A 1ESCA 2QG6A 2FPWA 5BSMA 3VHLB 2B3TA 1KORA 4CF5A 3CONA 1P5ZB 4COOA 5KJEA 4QT4A 2ZIZA 2ZUEA 1E4EA 2YHIA 1YL5A 2JHGA 4IXMA 1RSZA 4Q3OA 4DR1B 1EGQA 1IBRA 3RSZA 3WGNA 2R7MA 2BPOA 1DBPA 4BKOA 4CKEA 4D43A 5K7SA 521PA 1KKMA 1M34E 3EFBA 1HWYA 1GL9B 1N5KA 1UJCA 3BWMA 2GF0A 3FCSB 3HJGA 3KV1A 4S1PA 5BUZA 1HEUA 2B8WA 4ZOQI 1YACA 1QGOA 5EJFA 5KZMB 1XEFA 3GN2A 4G0QA 1AGYA 5FBVB 2XAAA 2RC5A 5DN6A 1X14A 3DT9A 1JQBA 2HWKA 5TPZA 2XTAA 1Z2DA 2CNOA 5CVEA 1VYUA 2NV6A 4V38A 5B3LA 4UM9B 4XD7D 1SKUA 2QX8A 1U7PA 4JP3A 4N3AA 5E8JA 2AUTA 1A76A 4GVLA 3HB7A 4Q03A 3NEPX 4BPRA 3NNNA 3B9QA 2R96A 2BJWA 3GFFA 5EVCA 1VL6A 1FBNA 3UAZA 4L4YA 4DT1B 1BYUA 5BNTA 5C8VA 3DAPA 2EJVA 2IS6A 3KB2A 4OHRA 1N6IA 2PD4A 5I5GA 2YTZA 5AW7A 1YMVA 2QUJA 3UK6A 4CM9A 4LF8B 3WXBA 2MR5A 5J2TF 1EVYA 3T5MA 2N42A 3IS3A 4IHQA 3SWWA 4RQTA 3INTA 1ZVJA 2G7MC 2UYYA 2QORA 3IP3A 4CU2A 1HT2E 3WZLA 4KX5A 3U60B 4JBWA 1E3JA 4KXYA 4ZAZA 1RDFA 1SR8A 4LMRA 4YAIA 1IK4A 1KO8A 1BC5A 1YA8A 2QXUA 3F5QA 3HXPA 5T4EA 1Z75A 4CHTA 4M1EA 1ZYUA 1L4NA 1Y81A 2Z1DA 4F9GA 1ZUNA 3WLNA 1WR8A 1H23A 2V7TA 3NVDA 4KDEA 1CRQA 1U9IA 1P5FA 2FMUA 1QMGA 5ITZB 3OTQA 1H0RA 3KR1A 3FUWA 1KYVA 5AKXA 1C8VB 4GX5A 5HFNA 4AQ7A 3II6X 4UTPA 3QOFA 1QWSA 1YR6A 4L75A 2PUWA 3CNEA 3SDZA 1UBFA 2ZRFA 2W22A 4JC0A 4WBSA 5BNZA 1ZCFA 3BZWA 2C57A 4TN1A 3WSWA 3L18A 4EYKA 4PRYA 4Y1RA 1O5TA 1PLLA 3R3UA 4MUNA 1JB9A 2XYQA 2ALJA 3OAAA 4CR6A 2P40A 1C9EA 1JSRA 1TZ2A 1XVUA 4FDLA 4IIDA 2AN9A 1J0BA 2FR1A 4TMWA 9LDTA 2C1XA 5BOSA 2V45A 3NS7A 3O93A 4DCUA 3AVYA 1KDYA 1F0KA 3PFFA 4FKZA 2QN8A 1LPSA 4TKLA 4O4LF 4L50A 1XNJA 2ENUA 3C8HA 1EFCA 3IPXA 4AMYA 2OCLA 2YASA 2V6FA 1NUPA 1RP7A 1JG1A 2HOQA 3OZUA 1RFLA 1GG9A 3UA4A 4BLSA 5DNDA 4BLUA 4D6XA 2OC9A 1BN7A 3OSZA 4TVKA 4JDUA 4ER0A 5JZBA 1HC7A 1HE2A 4YR9A 1D1QA 4IICA 1WBJB 3N2NA 5HHTA 3G88A 3QVJA 3RYHB 2GN9A 1J0AA 3QWAA 1Z29A 4G5QA 4DC9A 4LXQA 4BNFA 5K01A 4HNGA 3RRBA 1E60A 3QP9A 3RPEA 1LXCA 5K6AA 5IC6A 4YCAA 1L4BA 4DEYA 3TKAA 4DRZA 2Z2XA 4EY6A 4JASB 5GZ6A 4ITRC 2ZTSA 5EJMA 1YQWA 1OC2A 1LD3A 1RIIA 4L0DA 5F2EA 4BXOA 2DFDA 1W85B 2VBIA 2BL4A 5EGSA 4PPGA 5CDFE 3WWEA 1J8QA 4N12A 3BX1A 3QUTA 3E9EA 4LTNA 4AVYA 2LP4Y 4K9QA 3RSLA 5DU2A 4I9UA 2PZGA 1RQNA 4KYVA 1GOTA 2JH8A 5FQOA 4F6RB 4G81A 2L82A 3SQXA 2JZCA 3ZQJA 3GJRA 2IUSA 1I30A 4ZVQA 3GVHA 4ALMA 4D42A 5GJCA 4E12A 2H2HA 4WHMA 5EPUA 3AW9A 1PU2A 4BQIA 5BSTA 3KKZA 2KLBA 2OHFA 3EQ9A 1OJLA 3MUFA 1WF3A 3HU2A 5BMVB 5JNLA 1A5ZA 1NTRA 2Y92A 3MN1A 3SS8A 4N4AA 2AA3A 2JAUA 2K5UA 4DWOA 5JISA 2IBTA 1GKLA 2IZ5A 1JHDA 1UH5A 1H5QA 3IHTA 3AHGA 3R0QA 4X0EA 4RELA 1Q0RA 5L3ZA 3OBIA 1QRDA 1YDFA 3GCZA 3HB0A 2AQKA 2LIPA 1ZG3A 1VCOA 3G7UA 2KJQA 4LXXA 2NTNA 3N8IA 3I9MA 4EEKA 3FW1A 4ZYZA 3CW8X 1L5MA 3MOIA 1LF0A 3OJLA 2OCPA 2GZDA 2AC7A 4KE8A 3P9YA 2FSHA 2M6SA 2FV8A 2XBUA 1TK3A 3BMCB 3G2QA 1KJ8A 5BW6B 5L95A 5IVHA 3H1BA 2FOXA 3OPYB 4YRTA 5LOVB 3AU8A 3IKTA 1NIPA 1YNSA 1ZVKA 4Q82A 1LK0A 4Q7LA 4Q4AB 1X7XB 1WPQA 2I65A 2IP4A 4S1WA 5EA2A 4A8JB 1OLXA 3K9FC 1JI3A 3D64A 3GPLA 1U28A 4CEJB 4O63O 1NVAA 5E2BA 3WSTA 3CEMA 3QVGA 5DSXA 3TUZC 1MB3A 3FHCB 5IUKC 2V4ZA 2O20A 1E9SA 3HKDA 1D2GA 3R6GA 4MCAA 5BR8B 3ZWXA 1JXMA 4HN9A 2B37A 2EWVA 3K0AA 1WUHS 1RI5A 3SYMA 2DHEA 5DHTA 4D1YA 4EKIA 3AM3A 1KFJB 2JLYA 3PGLA 4QUEA 1D3AA 2LDBA 3BHJA 1R4AA 2CJWA 2F59A 3DC2A 3JQGA 4EB6B 2AOTA 2E5LB 2DPXA 2WIDA 1OLSB 3A4VA 5CURA 1AS0A 1Q17A 2PK3A 4S1OA 3E22B 4LWOA 2IUFA 1E3QA 3MINB 4EO4A 4FDAA 3UMYA 2P9ZA 2F3RA 2WMDA 3ZD7A 4JLDA 3QKSA 5G0WA 2GD2A 2ECPA 5EJ2A 4EG1A 3WLOA 3BMOB 4A0QA 1IN4A 1P9RA 1U2SA 3VR0A 3JWJA 4NOMA 4CLRB 4IO0A 1EBFA 4X7PA 2DBYA 2QLLA 4IJ5A 5CDHA 4M89A 2OCXA 4ZTUB 1RRFA 3W2FA 2BGJA 2X23A 1GSAA 1H8ED 3LLMA 1UK8A 5BT9A 2PMEA 4B43A 4DEVA 2PYIA 4L3VA 4NZOA 3ICQB 5CNMA 4N82A 4G0XA 5IW8A 4CMKA 5GJVC 1TEHA 1TYCA 3GEIA 4HP8A 4TXNA 3RVSA 5IDYA 4B17A 1DBRA 3ULKA 2BGTA 2JIDA 4UHBA 1LVGA 2QVXX 3K5HA 2WWHA 3LS2A 5JZ9A 4FWTA 4MUEA 1M2WA 1VHTA 5AVKA 2FWJA 1ITZA 2C7OA 4FHZA 2AFHE 1N0VC 4Y67A 4S2EA 3R9XB 4HN4B 3C5HA 4BVEA 1KAGA 2PSDA 3O4RA 5GONB 2ODTX 1JR4A 2XCSB 4O3MA 3Q3IA 2B2XA 1XZBA 5LA6B 4S04A 2AT1A 4FOLA 3A9RA 5HK8A 4CTKA 2DUMA 4RMJA 1BQ4A 4J9VA 1I5OA 2QM7A 1YRQA 4O5OA 1IOVA 3F67A 1QZXA 5MHTA 4R1TA 2DG2A 3A6FA 5H1YA 3CRRA 2BFDA 1XZIA 2HIMA 2QZPA 2XMBA 3FGPA 1CBUA 3DJYA 3OZTA 4NULA 1VBKA 2GBGA 2K2QB 3PC7A 3ZZMA 5LP6B 1DDGA 1XJ5A 2FU5C 1GZHB 5I9LA 4BQFA 1ACLA 2C2OA 2MU1A 5IYZA 3E15A 3K94A 1TQ6A 4DUPA 4BNDB 3C6XA 4JITA 4WINA 1KC1A 1FXWF 2O2SA 5KOHA 4KAFA 4RTKA 2J3EA 1B1CA 2XYVA 1US8B 2D2VA 1E4VA 2EVWX 5A62A 4LFBB 5KHOC 4WERA 4AMGA 4RKWA 1OWNA 2YH2A 1YR1A 3PT9A 2BZ1A 3R1IA 5LQJA 1YULA 1FDIA 3U4GA 2YV4A 4WXEA 3PC2A 1IN8A 4FMCB 3AVPA 4IJVA 4LMBA 3U7QB 1E1RD 4BZQA 5LU9A 4C0AC 5CW1A 4W7SA 4TKZA 2JIZA 3KQQA 3LQ4A 3ZDCA 3RSOA 1EM8A 1SBCA 4HDRA 4BTVA 5JASA 1PDVA 1CEEA 1K8RA 3IKMB 4HMQA 2ZB3A 2VL7A 1G55A 1GGVA 4DTIA 4EY8A 3THSA 2BAGA 2V98A 1D0VA 4PGFA 3NBYC 3K70B 1ZD3A 2FLKA 2VDQB 3N2YA 2JFOA 3N0XA 4H0NA 3L4EA 3WXMA 3LF2A 3UJBA 4LNAA 1THGA 3SEQA 2F8MA 5IKPA 1XHEA 1QPBA 3NHWA 2QN2A 2V96A 2XNDD 1VECA 4L57A 4Y6QA 1HTBA 2HWUA 1E2EA 1XEXB 2FW7A 1C0LA 1YDHA 3DDSA 4FD2A 5CTJA 2WAAA 1DCKA 1DWPA 2VHQA 1OU4A 1UBSB 4BTEA 4CQLB 1B76A 5IF9A 2FP4B 3E35A 1B6SA 1XNHA 3L06A 2FSUA 4ZD6A 2D54A 1ARZA 1KJIA 3TB4A 3GCDA 1KVQA 1KRWA 3C8UA 3T95A 2VP2A 3NDPA 1I3LA 3LT0A 3QXXA 4YONB 4JI6B 2V7QA 3GJQA 3CN7A 4I1RA 4FNMA 4HEA1 4D9IA 1H2WA 3OQ1A 4GM4A 5JD5A 2FFQA 4XRGA 4BFZA 1VG8A 4Z49A 2ZWVA 3GHYA 4J76A 1OYYA 3C3WA 1P2SA 1M2VA 3PJFA 2WTUA 3KQNA 2PKWA 1IIBA 2VJQA 2YXBA 3K20A 3KEQA 3LU1A 3PGMA 4NBTA 2YNMC 1MC5A 1F12A 3KQWA 5AKEA 1QORA 3ROQA 2C9ZA 2GNOA 3ZCXA 1F2TB 2BEKA 5ABPA 4IW3B 3IERA 1Z28A 3O9ZA 5TJHA 2J9YB 1JS1X 2PLRA 3L5KA 4UM9D 4YFVA 5CFRA 1Q92A 2BGMA 4U9UA 2P8JA 1RPJA 4OI4A 3BMQA 5DM4A 1O77A 2BMJA 1AV7A 3B20A 3HZOA 4DLXA 5A6SA 5K4GA 2DTDA 2ORED 1FC0A 4M1ZA 1E2DA 2G1AA 5D51S 2Y1LA 3EQ8A 1ZMOA 3QM1A 4LGCA 1WCIA 4OI2A 5FFFA 4BNXA 1Y8RB 2VHUA 4KPUB 1LI4A 1E9BA 2PSHA 1F1BA 2J3IA 4KKXB 3OF5A 4Q66C 4E03A 4F5WA 4RDXA 1NG9A 1VC2A 4C9BA 4DUYB 1XQVA 1KI6A 1YR7A 2DPLA 2W6QA 1H1DA 4ND8A 4W8HA 3X43A 4AMUA 4B6OA 1K0FA 1F2DA 3HCNA 2HK9A 4J90A 2OFPA 3RUHA 1SC4A 6NULA 5FWNA 5ICGA 4CKBB 4KUGA 5FBKA 2D62A 3LO8A 3MLEA 2OVFA 4Y2JA 5K0JA 4BIIA 4R1NA 3O2JA 1T5OA 1PUXA 1OHHD 1T5HX 4BWFB 4G26A 2WU1A 2A1UA 4RGYA 1CEXA 4X41A 5FO0A 5T8KA 4AU1A 1O8BA 3E5NA 1DIAA 4O2BA 4ZT5A 3OD1A 3GCXA 2AFHB 1PVVA 3EIXA 3HJBA 1H6AA 1NVUQ 2CYBA 1FSSA 3MAGA 3MBKA 2OA0A 4L8VA 2X5NA 3QOYA 2UVPA 1HE5A 1QVVA 3EMBA 3VZCA 1MX1A 3A27A 4NP6A 1J5EB 2XE7A 4FD3A 2EHJA 4LGYA 3DVSX 1V26A 1CV2A 3NEJA 3OU2A 1U99A 1CC1S 1T0UA 4R9RA 2OR3A 3AFOA 4MH0R 4YP0A 2W2KB 1UC5B 3VZPA 5EINA 2BYTA 3FTFA 3LG2A 3TR0A 3ACCA 2WWRA 1UWKA 4QELA 4M46A 4NMXB 3SC3A 3VYUB 1LQ2A 3TH5A 1UIMA 1CDEA 1UK7A 3QBEA 5AM3A 2P6PA 1MUUA 2XOKA 2CY0A 1DRUA 2OP1A 4LXHA 3K1AB 3VTFA 1UDCA 1U0JA 3LRPA 3JWHA 1P73A 3IV6A 3CE6A 5CGZA 1EXVA 3RUCA 1BDJA 2GO7A 5DO9A 1M6YA 3ABIA 3MCUA 3R7FA 2HJ9A 1LNSA 2V8BA 2EFCB 4GI3A 2Y1OA 2H7CA 1HOTA 1X86B 2QAIA 2RKBA 2VJNA 1ZNZA 1GPJA 3LFHA 3I4LA 3ZW9A 5BN5A 5LDDC 2CNKA 1I4OA 2QVBA 1KY3A 1L5LA 1YV9A 3FKQA 3ZLBA 4GSKA 3NHMA 1YZGA 5HRUA 4X54A 3DD1A 3EXAA 2FYTA 1NN1A 2RC6A 2Q50A 2ZS9A 2JA2A 4P3YA 4RKYA 2AYXA 4Q7EA 3KETA 2WD8A 3TOXA 3IQGX 2NT3A 4MV8A 2JFWA 3GC6A 2K87A 3QIAA 4U2GA 4UBNA 2Q7XA 5DYIA 3DZDA 5AUQA 3USZA 1NZDA 1POXA 1YK1A 2WFAA 4ARZB 2DY0A 3RF7A 1YKSA 1C0PA 2H48A 1YI1A 1RI2A 4QHSA 3KLMX 5GM1A 4DMRA 3L7IA 2QNBA 1Q1NA 4OBBA 4GZ3A 3UT6A 1KL7A 2HT6A 2QTTA 5TQ0A 4TKMA 1E6WA 5EKUA 1ZI8A 1T3HA 5AI4A 4LZPA 3IJPA 1L5HB 3KS9A 4HT3B 1MO5A 1QANA 2AH5A 2QPLA 4PCLA 1PHRA 4I1SA 3ZR4B 5AW3A 1VL0A 2A9VA 4OHWA 3VI4B 1U7HA 1DJPA 3CPHA 5AHRA 4DMUB 2F4NA 3THRA 2Q5IA 2NZXA 1DCFA 4LX0A 1B2LA 2ABWA 3TLKA 4YYZA 2M2IA 1I4DD 5EQDA 2ZJOA 4LQCA 4NENA 2AG6A 4BB6A 2FZVA 2PGIA 1WG8A 2DLNA 2R751 1WZEA 3PF8A 4O4JB 1WMFA 5HQ3A 2GTHA 4HEA6 2CN1A 3EDOA 4DSUA 5IZCC 2D4AA 3MHTA 1WM1A 2BGWA 1HORA 3G7NA 2JJ1D 2WSLA 4V03A 3WK8A 2HQ1A 5IJXA 5JAUA 4DR5B 3VSBA 5EIHA 4B3DA 4YJGA 3D7KA 1G3IA 1N75A 3EF0A 3FYHA 4FSXA 3EWNA 5ANRB 3HL0A 2QN9A 2ZRGA 2ZIAA 4U8GA 1NRXA 4F4CA 1S8AA 5AUPB 3N8NA 4FFLA 1QF9A 4UXJA 1DMSA 2NO1A 4KQ1A 4PC6A 4UNPA 1L2TA 3LZDA 3LHDA 2HK8A 1N8KA 5CYFA 1E4EB 2YHIB 1SHKA 5AM1A 5EL0A 2ZIEA 3IOMA 4M0PA 1JXOA 4PCAA 2WOOA 2JCXA 1A1VA 4DDVA 1KXZA 3CUYA 5KB3A 5SY9A 3W1EA 2CK3D 3RS4A 3FMPB 5D3QA 3QBDA 2IYYA 1JQKA 1QGDA 4RV4A 2BFNA 3B78A 3FWKA 5AYVA 2EBUA 3QLJA 3O38A 3RTEA 2QUIA 1UBGA 4NE2A 1OI4A 3TBKA 1Q95A 2X15A 3E5MA 3GQBB 4FNOA 4L6AA 1B2RA 3BIXA 5DWVA 2WVAA 3FDFA 3IMEA 4RF4A 1N2OA 4DHEA 3RK0A 2OYSA 2BKLA 3HCAA 2HNBA 4KAJA 4NOKA 1YZHA 1E2JA 1UEJA 1ZJ4A 3HYLA 1TYDE 3UH1A 4N8SA 3UK1A 1Q20A 4K2HA 4A16A 4C6RA 2QMOA 5EC8A 1VE9A 3I5UA 1MVLA 2FPPA 1JXQA 2M1XA 1GCAA 1Z22A 3FF1A 1PD0A 2NQTA 1USVA 3H2KA 3MTGA 3OCCA 3QNWA 4LJKA 1W96A 1FS6A 2ZW9A 2PKYX 3LQYA 1P1FA 3C3XA 3TMKA 2C83A 4N5IX 3SF8A 3TJZA 2I78A 3ASVA 4R2MA 4WZZA 1EXWA 3L7DA 4BQPA 4V1CA 5DH9A 1XRRA 3HDYA 3UV3A 4M1QA 3P9RA 2VEOA 4KBYA 3MT9A 3MNFA 3EVDA 5M2QA 2HLPA 4J1QA 4EPWA 4LJRA 2DR0A 1YDGA 3QVTA 4EHIA 1JDUA 3LHKA 1GPDG 5LQRA 2MMCA 4Z51A 1KTVA 3JQ9C 2BUCA 4RZHA 5JCOA 4B40A 1EJ0A 5JJLA 3UMRA 1TGYA 3EWAA 3KTDA 2JCGA 1AX9A 1VI5A 3H5NA 1EB9A 2GD1O 2Z2IA 3G8AA 2ZJAA 2WLSA 4W5WA 3DZIA 2P68A 2C3MA 5CR9A 1GL3A 1ISMA 1K4YA 1T26A 3JQBA 2OL4A 1E59A 2Q6TA 4JYPA 4AFNA 1M1NA 3C87A 3LKZA 2G8NA 1DJOA 4CFYA 3D02A 3SBDA 2R60A 4EMTA 2AQHA 4Y1RB 3D8NA 1VL5A 2EEZA 4EJ6A 1Z68A 1AZTA 3O8DA 4NY1A 3EQ2A 3LYAA 3QKRB 1BA2A 1CNFA 2GRJA 3INYA 2IQ5A 3NHPA 4MUYA 4QFMA 1PAUA 4RH3A 3ROZA 4BHTA 4A0FA 5ADUS 1WRBA 3PNSA 1Z15A 4KW7A 4KR7A 3CU5A 4JJ8A 2EX0A 5H02A 4N1AA 5MFZA 1EAYA 4QJ4A 4IJKA 2ZATA 4JI1B 5BOSB 1G0NA 1SB8A 4XYEA 2VA9A 2OCGA 1H69A 1I7QB 2WUWE 1PZEA 3SJUA 2EU8A 1Z5GA 4YAOA 5DULA 1DWUA 1T0BA 1T9ZA 5FI3A 4AS3A 4D25A 1ULBA 1FRQA 4F5EA 3MGAA 2Y27A 2GN8A 5A1TA 5G3ZA 3V1YA 4XLTA 2PKCA 5F7JA 3RV3A 1Z8DA 2XI4A 1D4OA 3A3KA 3VR4H 3WP0A 3A7DA 1X8KA 4O8ZA 1JLLA 3O8OA 3DDHA 2LV8A 4NFYA 4C14A 2QTZA 3VDNB 1USGA 1IB6A 3MTAA 2MSLA 4XIJA 2FMTA 3CKKA 2FG6C 4GOKA 4EGFA 2VHWA 2H1HA 2R68A 4E0BA 4C7OA 1LLQA 4RACA 3K70D 3EXHA 5KNBA 3PV0A 4P08A 2R1ZA 1CRWG 4G5XA 3WKAA 4ZZ1A 3RUAA 4HNVA 1WTAA 2W2LA 2WSSD 3PJDA 4BXOB 1M66A 5KYTA 4TQAA 5AKLA 2RKWA 4DV4B 2P1DA 2W2OA 4FYVA 4MJ3A 3HVIA 5AVVA 1RBMA 4K9RA 1DARA 3MYYA 3PVSA 5EESA 2Q5EA 3L7KA 3RVDA 1IXSB 4P82A 4TRJA 4RZIA 2N1MA 4I5EA 2D7JA 2Z08A 3N6XA 3DE0X 4XQCA 1VL1A 2B82A 1PJ3A 1W76A 5AK3A 3RC7A 3KJZA 1IMOA 1JA1A 1Z5VA 1YQEA 3NBXX 1N2IA 3K9HA 3VKWA 4EKEA 1LBIA 2OGTA 3OT4A 3H9UA 4U2FA 4FYHA 1I0LA 2MINB 1WTCA 2WWVD 5K6RA 5K0LA 3G9ZA 3VKVA 4FEYA 1Y5NA 2FOLA 3O8BA 4MVWA 3IP8A 2YBDA 1DX9A 3U16A 4MA0A 3WZMA 3PQFA 2R65A 3N1UA 4ATNA 2VRBA 4C05A 1N3BA 1DAMA 2ZRPA 2QQFA 2YQ5A 4A36A 4RKQA 3DOCA 2AZTA 3DKIA 1N2BA 2G08A 2XA1A 2XMPA 3ZH9B 1CUFA 3IULA 4JU9A 4D79A 4FILA 2IF0A 4TROA 4OX9Y 2D0DA 2ZZNA 1DE0A 3EZLA 3KLPX 3L8DA 5AW9A 3LXMA 4DLBA 2Q49A 4OK3A 2GBPA 3HHPA 3G2NA 3KOWA 1KMMA 1N5JA 3JVDA 4ZALA 5G1OA 4Q01A 1UK9A 2CFOA 4M9UA 3VJKA 3A0UA 2I4IA 3DSRA 3V00A 2QQEA 2XXBA 1X0VA 1SKBA 2D2EA 3AKCA 1MDBA 2OEPA 3DDUA 4LDZA 1ZZGA 4ETMA 3KR2A 1E58A 1CQWA 5TX7A 5BQXA 1NN5A 3DEYX 3QFTA 1UMDA 3RJTA 1EK0A 2F1OA 2X0NA 2G80A 4KBFA 4Q6BA 1OLXB 3UB4A 3CH5A 2CYCA 2WWIA 5EE9A 2FI1A 5G0TA 3ESYA 2AKYA 2VVTA 5FORA 4BLWA 5D6NA 4E2YA 2UUBB 2OO5A 3HGTA 3OOJA 3COYA 4WNYA 3U6BA 2FN8A 4EI7A 3QVXA 4P2GA 5K3FA 5L40A 3MFYA 5KI6A 3K0AB 2GHIA 1S2IA 3D8UA 4L72A 3WJ1A 1V96A 3ZQ4A 4BMDA 5FTKA 4EEZA 2C84A 3TSOA 1U90A 1WP4A 2CJWB 3R4CA 3M5DA 4YJDA 1W0KA 2AOTB 1YGYA 4X3OA 2PUJA 4B6SA 4C07A 1F48A 3OPYI 2B2CA 1LV8A 4MTCA 3AB8A 3VTZA 3W8RA 3DV0A 4GDFA 1QH8A 4IM7A 1EDOA 3BFKA 3MJRA 5G4LA 1XRLA 5BN4A 2X3UA 3GROA 3QKSB 1K97A 3DH0A 3QVUA 2IEGA 3Q4GA 3V2HA 1KPGA 4CMIA 4YR7A 1IHUA 3KJFA 4IDNA 4M53A 3GDWA 3KB1A 2X4LA 3VOBA 1B23P 4GI2A 1PP4A 3BA6A 3VR2A 1TIKA 3HLTA 1SHTX 4D97A 3M4XA 5C8ZA 4OQDA 4V02A 4ZCLA 5IVIA 1ATIA 4DLZA 3VYWA 2X1MA 2QRLA 1ZGGA 2C94A 5HCUA 4RY2A 2JLQA 3RIYA 2WTAA 1DBQA 5DRYA 5KKNB 2XQJA 4RIFA 3GLFA 4JP5A 4KGZA 4AP6A 2B8EA 4E21A 3PPVA 1T8SA 2GZRA 4NMLA 1ECPA 2C7VA 1OMOA 2C8KA 2IYWA 5CDGA 4GL2A 5KAPA 3ZDYB 3WWYA 2SKDA 1ZRNA 4WK0B 4O25A 1CPYA 1UJMA 2R0QC 3H05A 4HGPA 1OH7A 2D2IA 4IGAA 2OZEA 1VE3A 3EYAA 1Q7CA 3QBTA 5LUAA 4QREA 5K8TA 1MC1A 2ADMA 3RSHA 3KZ1E 1VLLA 2DH5A 3JQQA 3E4CA 3HE3A 1CJVC 3MBIA 1MF7A 1YS1X 1RHQA 4PHGA 4GVPA 1IM5A 1JEQA 3FMOB 2V4UA 5GONF 4MP3A 2PX3A 3TS1A 1SOWA 4EHLA 3I72A 2BFDB 1V3QE 2VT2A 2V59A 5BO5A 2AOXA 3W7BA 2A0KA 3E9ZA 3IDZA 4E5DA 1FJXA 4E13A 2DOKA 4CMCA 1WMDA 3FE2A 5FNVA 4BNVA 2JD2A 3AOEC 3LHSA 3OQIA 4US2R 1D0IA 5BSRA 3UC9A 4QTUB 5JC8A 4W9NC 5KOHB 2WBLC 3CKMA 3TL6A 3F6BX 4CKWA 1BS1A 3AKYA 5LP6F 2Q28A 4B35A 5E3HA 1E9CA 2DX7A 5I7AA 2ZE5A 4W5HA 2PANA 3CLUC 3M6FA 1EX7A 4AG5A 1DAPA 1K3FA 1E3WA 1SELA 2ZXEA 1UBTS 3HCWA 3N8GA 4Y2UA 3SKXA 4ZHQF 1GRCA 2IHNA 2FSSA 2QT1A 3M6XA 2VWGA 3H2YA 1ZX1A 3KKMA 3OIDA 4YBZA 3AF4A 3FSJX 3QQPA 4I19A 4E1AA 2JCBA 4EG5A 1P1BA 2J59A 3OFNA 4JJ4A 4UMFA 4UUMA 3IAFA 1EM8B 1QHXA 3CUUA 4HDRB 1ZGZA 1J0XO 2ODBA 4ZYYA 3NZEA 3AH8A 3MTDA 1C3OA 4QOJA 4H08A 4FMCF