3G2MA

Crystal structure of the glycopeptide n-methyltransferase mtfa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
265
structure length
232
Chain Sequence
PVRTPHADVLLASVVLCDFYADGTSEAREFATRTGPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQGDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESEPLERLHVRHLPAEEIQEITIHPADEDPFVVCTHRRRLLAPDQVVRELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
molecule keywords PCZA361.24
total genus 67
structure length 232
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1040.40 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3g2mA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3g2mA02
5HFJA 5C1IA 2HV9A 1VIDA 1ZG3A 2QRVB 5DM4A 2C7QA 3G2OA 3BGIA 3S68A 1FJXA 3UJDA 5FA8A 5DM1A 4RTNA 2NNWB 4RX1A 3PLAE 2QY6A 4QPNA 3BGVA 3SVZA 4AZSA 5EZSA 3VYWA 4LWOA 1Q0SA 3DMGA 3DH0A 5DLYA 5EEHA 4DMGA 3F4KA 4PYKA 2I9KA 4C08A 5DX8A 5EMMA 5K0JA 1SKMA 2P7IA 5CUQA 2GS9A 3HA5A 3THRA 3PVCA 3OPNA 3P2EA 3T0IA 4MQ4A 3HVJA 1SUSA 5EOVA 4YUYA 4BP3A 2PJDA 3I64A 2H11A 2PX4A 2XYRA 2GH1A 3LKDA 3JWIA 3BWYA 2IP2A 4X60A 4P7KA 1V39A 3EVAA 4WXHA 1BHJA 1RI4A 3BUSA 3H2BA 4KVZA 4HRAA 4IKPA 3GRYA 3B3JA 3L8DA 3A25A 1D2GA 4PYLA 3NDIA 4KDRA 3SSMA 4R05A 2CKDA 3AXSA 1RJGA 3AWIA 3KPWA 2V74B 3BKWA 2NXEA 3CVOA 4AZWA 5M5BA 3LDFA 1HMYA 3LCUA 4C07A 3IEIA 4OBXA 1OR8A 2YXDA 3FUVA 3OU6A 2YR0A 2OKCA 3ERCA 2AN4A 3DMHA 3AY0A 3HCEA 4IV8A 5FWDA 4E70A 5E2AA 5DSTA 5KYGA 1SQGA 4E2YA 4G56A 4EK9A 1MJFA 2O06A 4LECA 3LDUA 5GINE 2G1PA 1DCTA 4GQBA 2YQZA 3ORHA 5K0FA 1WG8A 1NKVA 1JQDA 1BOOA 2PV0A 3LBFA 3OU2A 3E23A 5HEKA 4RTKA 2HNKA 3A4TA 3EVEA 3GXOA 4OQEA 1VPTA 1X1CA 2DULA 2PGXA 4DA4A 5E2BA 5KVAA 1X1BA 2PWPA 2UYOA 4M37A 5EGSA 5EIWA 5GM1A 3FTCA 1NV8A 4E30A 1D2CA 5BW4A 1YF3A 5EKXA 2IBTA 1YZ3A 3FPJA 1Q0TA 4RV9A 2AZTA 5CVJA 3GU3A 5FQOA 4E32A 4HC4A 3BZBA 5B1SA 4PYIA 3G2PA 4LG1A 3C3PA 3T7TA 4A6DA 4ER5A 2PT6A 4U7TB 3V97A 3PFHA 3DLCA 1SQFA 2NXCA 3HNRA 3B5IA 3LKZA 3HVHA 2GA9A 4X1OA 4XUDA 3EMDA 5DSXA 1P1BA 5T6BA 2VS1A 3E7PA 2ORED 5E1OA 3GWZA 2AR0A 3FRHA 4ISCA 1KIAA 3FZGA 5DX0A 3I9FA 2OB1A 4HGYA 3BWMA 2P3QA 5K0EA 3G88A 4AX8A 4IV0A 3OCJA 4CTKA 2QYOA 4HTFB 4FS8A 2F8LA 3OE5A 5DM0A 4F86A 5EPEA 3SM3A 4MWZA 2JG3A 4MIKA 2O57A 2ESRA 3K6RA 3P71T 4QVGA 5EMJA 4R6WA 3UJBA 4BLVA 5LR6A 3HTXA 3P9NA 3G5LA 5ICEA 3MHTA 2I7CA 1EQAA 4HG2A 4QVKA 2VDVE 4V0QA 2VDWA 2IGTA 3BWBA 4C04A 3O7WA 2WA1A 3JWGA 2VP3A 3B3GA 1EAMA 2KW5A 5E9QA 5E9JA 3FTFA 5K09A 1M0EA 3A7DA 2K4MA 2GB4A 2NP7A 3BWCA 1FP1D 1IXKA 4EVIA 3BKXA 2FK8A 4C03A 4HGZA 2HWKA 3V8VA 3JWHA 3A7EA 2IBSA 1WS6A 3EPPA 1AV6A 4PONA 4U7PB 2Z6QA 5KS2A 4RVHA 3QV2A 2Y1XA 3P97A 1NW6A 4PYQA 2IH4A 5DRYA 3P2IA 2AOWA 3OU7A 3ANXA 1NW5A 2XVMA 3TQSA 1IY9A 5FADA 2ZZNA 5BXYA 2PX2A 3DXZA 3HCFA 4DCMA 1NBHA 2UYCA 1EJ0A 2PXCA 2YTZA 3PB3A 5HZMA 1UFKA 3ELUA 4L7VA 3AXTA 2ADMA 2ONYA 4PCAA 4QDKA 3G8BA 4QQKA 1KHHA 1XCLA 2AN5A 3DLIA 2C7OA 2VZ9A 2PX5A 3BXOA 4PYNA 1P1CA 1RI1A 4FR0A 2AOTA 4RWZA 4OQDA 5U4XA 4C06A 1O9HA 3QOXA 4YV2A 4OA5A 3B89A 2Y1WA 1YZHA 5LQKA 1L1EA 3UA4A 3O4FA 2NXNA 3MERA 3ME5A 5E8JA 3KR2A 3DTNA 3TM4A 5HOQA 5CM2Z 5CCXA 1VQ1A 2ZIFA 2EFJA 2BR4A 2ZWAA 3KQYA 3CJTA 4GOMD 4ER0A 4FT4A 4PGHA 4RTRA 2ONZA 1RI5A 3DP7A 4PIMA 1XDZA 3SSNA 4BP1A 1EG2A 4E2WA 3GDHA 4E2XA 3FUXA 3EVCA 3HCAA 1NW7A 3KQOA 4CTJA 3LBYA 4YMGA 3MAGA 4GOOD 4NECA 3E8SA 3ELYA 5HIKA 2BM8A 1L3IA 4M36A 4KWCA 5FHQA 3KU1A 4ZTBA 1ZHFA 5F2OA 4POOA 3KPUA 2PT9A 2O07A 3KHKA 1JG3A 1O9GA 3R0QA 4QTTB 1BC5A 5K8VA 3P2KA 2QE6A 4F84A 2B9EA 3P9IA 3OZRA 2CWWA 4FZVA 2P1DA 1ZGAA 3ELDA 3HVIA 2GPYA 4GOND 4ATNA 4RSRA 3DUWA 3CKKA 4YMHA 2PSSA 4FP9A 2ZTHA 2G8NA 3GRZA 4GUAA 4RTPA 5EHGA 3HCDA 1KPHA 5FUBA 4EKIA 1JG4A 4Z2YA 2AOUB 3DOUA 3TPZA 5LQJA 1YB2A 2ZW9A 5DXJA 1JR4A 1R8XA 1JSXA 1XTPA 3G7UA 5E1MA 1B42A 3CGGA 3LGAA 3K0BA 4CKBA 3MCTA 3VSEA 4P7FA 3MTIA 4GEKA 2JJQA 4E31A 3FPGA 5DPMA 2YVLA 4QQNA 3TLJA 1JTEA 1XJ5A 3HM2A 5HIMA 5HIIA 1KR5A 1BKYA 4P7JA 3REOA 5ICCA 1R18A 3HVKA 5T67A 2HR1A 3R9XB 4MHTA 3G2QA 1KXZA 3I58A 3HEMA 5BW5A 3DMFA 3R3HA 2EG5A 2LD4A 2CMGA 8MHTA 3SSOA 3PTAA 1XDUA 1TPYA 1KYWA 3DXYA 3MGGA 1FP2A 3GIWA 5IH3A 3SXJA 3UJCA 1YFLA 3TFWA 2O05A 4DQ0A 2A14A 2CMHA 1XVAA 3ER9A 2PX8A 5K01A 1MHTA 5KQRA 1JTFA 1PJZA 1WXWA 3KQSA 3TRKA 1HNNA 1RI3A 4RVGA 3Q7EA 2PLWA 5FA5A 3U81A 3OFKA 5FQNA 1TW3A 1AF7A 4GF5A 2AOUA 3OE4A 3TM5A 1U2ZA 1WY7A 1WXXA 2IDKA 4PGGA 1JQ3A 2XBMA 5C0OE 1L3CA 1FBNA 1JG1A 2JHPA 3HA7A 2AS0A 1XDSA 3UJ7A 3LPMA 2HTEA 4FGZA 4DKJA 2Z6AA 3I53A 7MHTA 3HCCA 2XYQA 5F2NA 4AUKA 1VL5A 2FYTA 1QAQA 2JHCA 3M6UA 3Q87B 1NV9A 1I4WA 3D2LA 3RODA 4FT2A 3KQTA 3SR4A 1QAMA 3KPYA 2I62A 4H0NA 4RVDA 4YV0A 5LQRA 4OBWA 4DCGA 1R74A 3R24A 3EGEA 3UA3A 1KPIA 5K0BA 1EIZA 3E05A 4RTOA 5EMKA 9MHTA 2R3SA 3GJYA 4WVLA 1UIRA 2GLUA 3R6TA 4PNEA 1G38A 2AOXA 4RTSA 1D2HA 5E9WA 4DF3A 3G2MA 2ZBQA 3UJ6A 1JG2A 2ZBPA 2OZVA 5EEGA 5P8WA 3A26A 3TKYA 5MHTA 2P7HA 3EGIA 4PIPA 4RVFA 1ORHA 3NW9A 2AN3A 2ZLBA 2I6GA 3P8ZA 5FHRA 5EZQA 3M6WA 4DZRA 3DR5A 2ZVJA 3FTEA 2FCAA 3T7RA 3UJAA 3GRUA 4QPPA 4Y2HA 3CJQA 3FRIA 1AQJA 3GO4A 3PS9A 3PX3A 4KRGA 5D1NA 5F2KA 5EVJA 1M6EX 3KQVA 3CBGA 2IH2A 4IWNA 3FYCA 5T64A 3TR6A 4RYLA 1F3LA 2E5WA 4EKGA 2OB2A 4PYMA 5LSAA 5KQSA 4CWAA 1O54A 2QM3A 1XCJA 5FWAA 1NW3A 1UWVA 3MQ2A 3NTVA 3NWEA 5HILA 3OZTA 2UZ4A 5E1BA 3NVMB 5BP7A 3GGDA 3FPHA 2AOVA 1RI2A 3PX2A 2JH9A 3EVFA 3C6KA 3FUTA 4KIGA 5DT2A 5GOZA 2ZIEA 2ZIGA 2FRXA 4KDCA 3NWBA 4RTMA 2R6ZA 3VC2A 1I9GA 4GOLD 5DX1A 3UWPA 2PY6A 4GBED 1EJ6A 2HMYB 1SUIA 3M33A 1T43A 1N7IA 1X1AA 3HP7A 2BH2A 3GRRA 2BZGA 4E33A 4PINA 2AOTB 2G72A 5DTRA 3UBTA 1ZQ9A 3NJRA 2FK7A 4RTLA 3A27A 2XYVA 4JXJA 1YFJA 5GM2A 3C3YA 1M6YA 3JWJA 3M6XA 2OXTA 3TMAA 3M70A 3MTEA 5GIOE 4X61A 1RJDA 3M4XA 2P35A 4YUWA 5EC8A 4QDJA 4GC9A 3KR1A 2B2CA 2B78A 3RIEA 3WSTA 1QZZA 1YUBA 5CVDA 4M38A 3KQMA 3EVDA 4A6EA 5H02A 2C7PA 2ERCA 2QRVA 3EMBA 3PFGA 3C0KA 5LQUA 3EVBA 5HIJA 4UOEA 5C9ZA 1L3BA 2UYQA 2DPMA 3HCBA 3OZSA 3G8AA 5CVEA 5GP1A 3FYDA 5ICGA 3CC8A 3KQWA 2NP6A 5EQJB 2PKWA 5CVUA 3SX0A 5GIPE 1I1NA 2V7EA 2B25A 2OO3A 2C7RA 2WK1A 1FPQA 2ZWVA 3IHTA 2PWYA 4KIFA 4AZVA 2NXJA 2P41A 2GAFA 1H1DA 1X19A 3KKZA 1SVUA 2OPBA 3IV6A 4K6MA 4P58A 10MHA 3PT9A 3FUUA 2EJUA 1NE2A 2P8JA 3B7PA 4MTLA 4O29A 1G60A 4PWYA 4X41A 4C4AA 3BT7A 3EVGA 1DL5A 1G8SA 1Y8CA 1WZNA 2FPOA 1N7JA 2IIPA 3B3FA 1VE3A 2PXXA 1VP9A 1INLA 3RW9A 4EQZA 3KPJA 2OYRA 3OFJA 5K05A 3O31A 3G5TA 4P7GA 2Z6UA 3UFBA 4OA8A 4PCLA 4CKEA 5EKUA 2H1RA 3FUWA 3TOSA 1NT2A 5DM2A 4BLUA 3KPVA 4CXMA 1PRYA 2ZULA 2O0LA 4M7RA 4BY9E 5K03A 5D1HA 4BLWA 5G02A 1KYZA 2BR5A 3LL7A 4XUCA 4GC5A 1NW8A 1VBFA 1X1DA 3C6MA 3KR9A 1G8AA 4ER7A 1N2XA 3GCZA 3SMQA 2UYHA 4XCXA 5EMLA 3X0DA 3TKAA 5K0CA 2EX4A 3LHDA 2AVNA 5LQAA 3CJRA 3MB5A 1AQIA 3CCFA 1XXLA 1L9KA 1SG9A 3GRVA 2YXEA 5E8RA 4R8SA 3UJ8A 1JSZA 2ZZKA 2B3TA 2NYUA 2ZBRA 3NDJA 5DWQA 4EMSA 1QYRA 2VDUE 5DTMA 4RTJA 3EEOA 4Y30A 2ZCJA 2N47A 5CCBA 1RJEA 4F85A 4AZTA 4RTQA 3BGDA 3LCCA 2CL5A 3LCVB 4QTUB 4C05A 2IDJA 5EIFA 3QOWA 2IH5A 4B17A 3DULA 2PVCA 4R6XA 3MCZA 5FCDA 3ID6C 2P3OA 2G71A 4PYOA 3THSA 3ELWA 2AVDA 3DXXA 4YUXA 5E1DA 3NMUF 2YXLA 3G89A 1TW2A 2XVAA 5K0LA 5FULA 3HA3A 3I5UA 3SGLA 5CIYA 1KPGA 2IFTA 3LX6A 3P9CA 1ZGJA 3P9KA 4V0RA 4YV1A 1P39A 5CD1A 3AJDA 3FPEA 1G55A 3KQPA 4YUZA 1QANA 2BM9A 4FSDA 3KQQA 5K0NA 2OBFA 2EJTA 2P3LA 1Z3CA 1ZKDA 2OY0A 5IKMA 1R00A 5DTQA 1G6Q1 3FPFA 1VP3A 2H00A 3T7SA 2ZSUA 3UJ9A 4LWPA 3VC1A 3NVKI 2Q41A 2YX1A 4KW7A 4PYJA 4R8RA 1VLMA 3EEYA 1JQEA 1QAOA 1F38A 2ZFUA 5LQNA 4X63A 3LDGA 3EGVA 1ORIA 4ER3A 3EVZA 1KP9A 1IM8A 4DM3A 5JR3A 5LQCA 1P91A 5CVVA 5EG5A 2JHAA 3KR0A 2BR3A 2FHPA 3FTDA 4ER6A 2ZZMA 3LECA 1RJFA 2PXAA 4FSXA 5GWXA 4YUVA 1R6AA 2YUIA 4HTFA 1DUSA 4HSGA 4E2ZA 3UZUA 4OX9Y 4XUEA 5DXAA 2IPXA 3GNLA 5K0GA 2PBFA 3LSTA 5EHIA 3IYLW 5FTWA 2JH8A 5ICFA 1NBIA 4CKCA 4HH4A 5ERGB 2WA2A 3ER8A 1R8YA 3M6VA 5DRTA 2G70A 2P40A 5JUWA
chains in the Genus database with same CATH superfamily
4AW9A 2F4VB 2C7QA 1YS4A 3S68A 3TMYA 4BHTA 4D98A 1QKJA 5EIBC 4KCGA 1Y1TA 1KIMA 3EF3A 2SICE 2W0SA 2H7CA 4QPNA 1FYWA 3OM8A 4IDEA 1OI3A 3A6DA 3K9GA 3WGZA 4WFKA 4P5DA 3ZDQA 5K5EA 1C30B 1OU0A 3PF8A 4CHGA 5KYUB 5IS2A 1E5TA 1WW8A 3HDGA 5COAA 2JC3A 4FXOA 1UP7A 5EIEA 1MGOA 4L75A 3THWB 2OPHA 1BHQ1 4MV3A 4R8MA 3NGXA 3P2EA 2EKDA 1NN0A 1U1GA 4HB3A 1PR0A 1CNFA 3EC7A 3BGSA 4BP3A 1UZNA 2ACKA 4DQLA 5F52A 4DDVA 5IWCA 2NQ2C 3W8FA 1V11A 2P2ZA 4CIAA 2OV3A 3CZPA 4OHFA 3D0OA 1B6RA 4G0VA 1LH0A 2PQ6A 2ZTSA 3MWYW 1X9HA 3R4CA 4LN1A 1D2GA 3ED5A 4BC1A 4CMKA 1VLHA 4DV6B 1DXHA 4GWKA 1UKAA 1G20E 3BMOB 3JQFA 4CKXA 2E4XA 5JAOA 3KPWA 3TEFA 4DBLE 1QG6A 3CU5A 3E7FA 4JUIA 5GJVC 4AWAA 1N6KA 2DYKA 3PPVA 3CZ9A 4KQ6A 3CWZA 5BR8B 4NJMB 3A6EA 3KRTA 1LV8A 1QGUB 1XNGA 1YDMA 4E70A 2A9PA 1BQEA 1PX2A 2VF5X 2P0AA 3IP8A 5TS3A 4FLEA 2AG8A 1Z74A 1UPBA 6YASA 4WA7A 5FV4A 1CB0A 1J7KA 2F00A 3G79A 4Y2QA 3OJXA 4IFIA 5BNTA 3ZVKA 4P6VF 1V2GA 4C7OB 1F6DA 3EZLA 2CW5A 3NOOA 3LX4A 2JAWA 4TXNA 4NBNA 4KOEC 1RIFA 5ED0A 3UHPA 1U04A 1MR3F 1CYDA 4OHXA 4BBAA 2CV1A 3ZJVA 1PGOA 1VIYA 2CNWA 3BS4A 3IQHX 1JNYA 1DADA 1LLCA 2QRMA 2IYLD 3STVA 4A03A 4OHOA 2NZWA 1YD7A 3FWPA 1ZLYA 2GPNA 2DF8A 1YZGA 3QG1A 2NXCA 3HYCA 1U7UA 5TJHA 1FP4B 1KO1A 2GGSA 5GGYA 3IJEB 3ZWVA 3JQDA 2YV5A 5K9ZA 1J0CA 5I7RA 1TA4A 1PU2A 5IK2A 4QHSA 3B1KA 4BNIA 1XELA 3I12A 2ZG6A 3IVGA 1VSTA 4ZKEA 4V1CI 1BGWA 3H5WA 1W48A 4I9FA 3SQNA 1M10A 3S8YA 3QEKA 3UGQA 4K05A 5AVTA 1JEDA 1YTLA 1QR6A 2HF7A 2HNAA 3DVSX 1KO7A 4KK3A 4MLZA 4UEKA 1UFQA 3UK0A 4AUNA 3K6RA 4ZJPA 5CDFA 1R12A 1XNHA 4I81A 2JLWA 1I4TD 4V0KA 3CY6A 3U0BA 1A5AB 3OM1A 3H4IA 2Q4RA 3O3CA 2CCGA 2VP3A 2BDTA 4PGMA 2KW5A 4RS4A 1E3MA 2W2PA 2K4MA 2VHZA 1AUXA 3PQ4A 3OC0A 1BDHA 1ZA1A 4LC0A 4V0OA 1GL3A 2IELA 4TMTA 2ZB8A 3N8GA 4J91A 4KXUA 5FUQA 1CZLA 1OIVA 2OGTA 3LQFA 5MF6A 3RAEC 4P4NA 5KJ6A 4OIMA 3QBTA 2MR5A 3LCRA 2VRWA 1PD0A 3E15A 4JOCA 3VBCA 4YCCA 1QQ7A 5FDFA 2LDXA 3BEDA 1QGZA 3EXHC 1HE8B 3N5CA 5JC8A 3TQSA 2VAPA 5BV2P 1B8OA 3L40A 1EFPA 1N1DA 2B2XA 3ZI0A 1NBHA 4AAYA 4OLJA 5FO0A 4XYLA 1L4KA 4ETIA 1JHZA 2YTZA 3GFGA 2AH5A 4RJKA 5BUCA 5I4KA 2I8CA 3FDZA 3S2GA 4HSCX 3DLIA 1CETA 4HNRA 4YEDA 3ZCXA 5AW0A 2BV3A 3VZCA 1HG1A 1DG9A 4PYNA 2D1QA 2AOTA 2FOXA 3DB1A 5ADVA 2JW5A 2CFIA 4PSCA 4YV2A 1C0IA 2VJAA 2FZKA 2OFFA 3PNMA 2O9JA 3R1IA 3UWMA 3VXKA 1H8ED 2REQA 3G7NA 1RYMA 2CFRA 4K28A 4ZOLA 3ZUGA 4MUBA 4JT2A 3ME5A 1C9EA 4Q93A 1P80A 1T5LA 3R75A 4IWXA 1H65A 4M9ZA 1LUAA 2ZIFA 1W7AA 2RB4A 4N7BA 1VCOA 1JYFA 3JASA 4ZZ3A 3BCRA 2W2MA 1V95A 4CPDA 4IIBA 1EA5A 2QVBA 4OJNA 1ZINA 4X1YA 5HF6A 3HCPA 2CVOA 1E1CA 2WPDA 2ZE6A 4S1OA 4ZVNA 1R3DA 4E2XA 3HZHA 2N75A 1JQBA 2RH9B 3K1AA 1P1FA 2GK7A 4GOOD 4QREA 4HFNA 3SQWA 4H1HA 1DX6A 2PIAA 4R40A 1PW5A 3PRKE 1K08A 1H4SA 1XQWA 1S7GA 2F2TA 3N74A 3G2LA 4IDNA 1RC8A 3AVUA 3LSYA 5C3MA 4F84A 5IMBA 1E2DA 2P79A 3D2CA 2ATVA 5DULA 3GRCA 2JGNA 3N2LA 3NKFA 3DL0A 2BT4A 2X77A 1RCUA 2BWJA 5B53A 5IJXA 2WWVD 2GPYA 1J1UA 1GGFA 3OOHA 1S9DA 4PC7A 1QE0A 3P9XA 5JQGB 4L5JA 1PD1A 4U2FA 4XI9A 1EFRA 4KQ9A 1C1XB 4OHKA 3DCIA 5EHGA 1ZM7A 4IHAA 2JKZA 2WV9A 3G0DA 3NWJA 4MUNA 2PJRA 3AP1A 1Z38A 1PG2A 1QOZA 2XUPA 3UJNA 4NOJA 1UKCA 5KO2A 1DXQA 1BS9A 3EXEA 2G06A 4LMRA 2I76A 1WCIA 1ODFA 3K1ZA 2WYIA 3VNSA 4I3FA 3ZGVA 1HDZA 1P2FA 3LRXA 5DSZA 3DTVD 4JASB 5ALUA 3GQBA 2GASA 2OCKA 3M7IA 4C3ZA 1YB5A 2EX1A 1ZNXA 1RRVA 1R7RA 5U1PA 4RMNA 2GZSA 1PG5A 3B51X 1QS0A 3I0NA 4JFRA 2YWXA 5T67A 4MGYR 5B4TA 2Q3FA 2PTHA 3R3ZA 1VKHA 2FW1A 1EK0A 4D4HA 1E2JA 2QN6A 4UUMA 3R3HA 2Q3CA 4FI3C 3OZGA 1NLFA 1WWKA 2HSWA 1FRVA 2KQUA 3OESA 1FFXA 3B1FA 2KLHA 4NYIR 1YBFA 2D0DA 4DT1B 2HCBA 3PA6A 1RBMA 2WF7A 3HJHA 4X7MA 2R7LA 2DFDA 3DV0B 3L0SA 3O73A 5TQ0A 3JQAA 3GLUA 4DIDA 1G16A 4IWYA 3T9AA 3QUBA 4L1KA 4QU9A 2R4TA 4GOKA 2BEVA 3OFKA 2GCPA 4OGWA 5KVQA 3T3HA 3V1TC 5DEOA 1YKGA 1CFZA 1XMOB 4ZN6A 5JNSA 1GM5A 3H5LA 1KKMA 2Z57A 4ZQHA 1Q77A 3TJRA 4BEJA 2O1XA 3QSGA 3KYCA 5HK9A 2CLFB 1UAGA 2G25A 3K16A 5DIZA 1AQ6A 1LK0A 1GYRA 2R8ZA 3FLAA 2EV9A 4I5FA 5JQGF 5DOVA 2G76A 5CXQA 4X8LA 3WRYC 2YIJA 1G8MA 2HPVA 2QWXA 2F3QA 4HWRA 5A05A 5LUBA 1COWD 1UM9B 3LQYA 3ZIAA 4AUKA 5ALYA 4FFOA 2C42A 2XKAA 3D2LA 1ULZA 2V3WA 1P2GA 1YRYE 4H0NA 5LQRA 3DBVO 3RD5A 4B3DA 2NN3C 5DT9A 2WJZB 3OCXA 1LSUA 1R74A 1VL0A 3V32A 4EDHA 1JP7A 1KJNA 1Z07A 3E05A 2QSJA 1NN5A 2R3SA 3NTUA 3PHLA 4IMRA 4AJ2A 9MHTA 5EWLB 3E58A 3W3ZB 5IVDA 3Q8LA 3H2HA 1OHHA 4M1OA 3RLFA 3U7FB 1S96A 1N4DA 5KOHB 3PFBA 3Q7PA 3TFQA 1FTQA 1U31A 2I6GA 2CBZA 3P8ZA 3THOA 3ZGNA 2CNNA 3TBFA 2FZLA 5M3BA 4NMLA 1XPUA 1NUPA 2I3ZA 3KD2A 3FVRA 4FYJA 3VPSA 1EWQA 4LXUA 3NUGA 4R8LA 3MLAA 3O9ZA 4U7DA 3AI7A 1GHTA 1K7SN 2E1PA 3DO5A 1KAQA 3CBGA 4J8PA 3C3JA 2EW2A 2KPOA 5IW8A 4D79A 3R77A 4YMIA 4L5BA 3GLHA 4CWAA 2XWQA 1U2DA 3DDUA 3IOCA 1QBGA 1VKOA 3MBIA 3OTWA 3W3AA 3U7JA 1CUDA 1N92A 3JQEA 4CZ2A 4FEAA 4OHCA 4BO1A 1MN6A 4NV0A 5TARA 3TLYA 1U3VA 2BUAA 1N2GA 2ZUSA 3MBKA 3I9V6 1O94C 3DFZA 4X3PA 5FNZA 2V6MA 1G6HA 4M7WA 5EE1A 4HGQA 4DSUA 1VHQA 3DL7A 1C7IA 1UQRA 2ZUBA 4LX8A 4UHEA 4A0FA 1M83A 1C3LA 3H1EA 4PZEA 3UWPA 4L8FA 2E49A 1OIXA 3PF9A 1U28A 2ZXFA 1TCAA 2HWXA 4JH0A 5I8ZA 5D2CA 5IX8A 5BO5A 2C95A 2JD0A 3PRJA 5H83A 2BSQA 3OTGA 2MSDB 2RFLA 2OXTA 3RT7A 3UXYA 1NZJA 2FPKA 4U7JA 3MRVA 1O8BA 1QHIA 5C1DA 1IAVA 1PDOA 1YMUA 4GXRA 1YQWA 4R98A 2NU8A 1BE8A 5DTEA 1TEHA 1THMA 5CHEA 1NYQA 5B3KA 3WYAA 5D87A 5IANA 3QLUA 5K3BA 4FFSA 1PWZA 4CR6A 3AM1A 1ITZA 1FQWA 1LRJA 3CX8A 3KLPX 4OHMA 1PKXA 4MMZB 4OHBA 1SBYA 2EKQA 3B6EA 1FFYA 4XASA 3QVMA 1Z4OA 1Y8RB 2QN7A 5JO9A 2D59A 4CL8A 5JD5A 4PC2A 3V3KA 2F9MA 3WGOA 1ZZGA 3G0CA 2F9LA 4IIXA 1S3IA 4KG7A 3QE9Y 3MA0A 4IHJF 5FO1A 4MARA 1LF5A 1AGRA 3KYIB 3M5WA 2AHOA 3D9QX 4EHBA 1F5NA 1Y8CA 3CNNA 4L4YA 4Z7JA 1MC5A 1UKBA 3NEPX 4R81A 4JD5A 2ZIVB 3K8OE 3AZQA 4CF6A 1AHNA 5JW6A 4FNAA 3CZMA 5FV7A 4NAVA 1E79A 3GRAA 3I4LA 1LW7A 4RDCA 4OFXA 1Y9DA 2Z6UA 3PPYA 2G4LA 3WDSA 4QTXA 4Z9FA 1DB3A 4OFWA 1SUAA 2WI8A 4XEUA 1Z2NX 5PGMA 5JBIA 5DM2A 3GLHB 1BX1A 4WNAA 1AKQA 1H94A 1ZK0A 2VIIA 3DE1X 4FYMA 4OREX 4Y7CA 3TBKA 3TXXA 3ICQB 1H9BA 1YCGA 2IXBA 3LL7A 1DVRA 3PTZA 1NW8A 1X8JA 2RGNC 2ZJ4A 4O4IA 4WOJA 5JSZA 3JYOA 4LRXA 2A35A 3HYTA 1JLHA 5K0CA 1NPTO 2HADA 1XXLA 2QX6A 4JKIA 1MHPA 5DJ5A 5IT0A 1HYEA 5LD2C 3RC8A 1RT9A 4RLFA 1FYVA 4GI2A 3WIVA 4M9CA 3AU9A 3E2IA 4MQEB 5EWJB 5DYNA 1II9A 1J8DA 1QYRA 5K3SA 4CFYA 3CR8A 3Q12A 1N1MA 4RA9A 3SFTA 1GR0A 2HRCA 2OP1A 3AMVA 4PZDA 3LCCA 2YY6A 2ICAA 2RBEA 1XOIA 4O5AA 1A5BB 2QT1A 4Z51A 2AZ4A 3O5AA 1IE3A 4ZOEA 3QYAA 3KC2A 4FMCB 2AQKA 1BVUA 3WFZA 3FKSA 4OYLA 3IR7A 3ROMA 3ITNA 3L7BA 4K1LA 1WB9A 4DJDC 1NU8A 2DC1A 2PK3A 1Y6GA 4WZBB 3HFSA 3FOEC 3IP3A 1SC6A 1MBZA 5KNCD 1QLHA 1U9CA 4QULA 3QEBZ 1X9IA 4V0RA 1I2DA 5H9VA 1Z25A 3WLNA 3AJDA 4FSDA 1MH9A 3EUFA 4FXPA 2ZEJA 3GVCA 4OBBA 2PLFA 4KRXA 4B6SA 4BVBA 4GMFA 1VYTA 2HI0A 1IOLA 2IUTA 2WZBA 5GAJA 1JZSA 5U4QA 3DOFA 5K8TA 2CXRA 3PP8A 4CV1A 4KE6A 5B36A 3FOFC 4MXDA 3KJXA 2XZOA 1KBZA 3ESYA 1ISPA 2ZFUA 4PVDA 1JFSA 1P9NA 4H77A 2WUWE 3EGVA 4MOWA 3GELA 4BL5A 2R84A 4ER3A 1GCGA 1ZPDA 3PDIB 2GSWA 2WICA 1E7QA 1GZVA 1P91A 3IKMB 4PGAA 1E2UA 3VR5A 1QLJA 3FTDA 5F4ZA 2BE7A 4JKYA 3MJVA 4QATA 4KLZA 5I7VA 3K0AA 1P1RA 2JI4A 4HSGA 4Y98A 5EQDA 5IT4A 3GNLA 4ZGWA 1EB8A 5DVZA 3OTQA 1EP2B 1QK3A 3W06A 3IDSA 1TQ2A 3NCTA 4L5IA 5L45A 4HH4A 1T34A 1KFEB 2ZJ3A 1SCDA 2XLBA 2ZSBA 3M9LA 4HDNB 4WFJA 1NVVR 3FDIA 3I45A 2HV9A 4ZQCB 3K2BA 4OATA 5FA8A 2QRPA 3NCHA 1P3JA 4B85A 1HOXA 2Y4OA 4NESA 5K3CA 1UKZA 1J0EA 4HI0E 4DWWA 2IJGX 3A2KA 2F1IA 3BGVA 4LDAA 4U00A 2J8ZA 3H9JA 3RHFA 9GPBA 3CNOA 4QGHA 3VO8A 3AVVA 5EZYA 4KOAA 3V34A 1H66A 4II2A 4MKIA 1XO1A 2C5EA 4Z3DA 5CUQA 4A92A 4UMVA 3TQTA 1CEQA 1QO0A 3THRA 2GHQA 4Q15A 3FPCA 1IZ9A 1L5LA 2ATEA 2ZYWX 3EMVA 1WP4A 3GMDA 2XTMA 3KEFA 4BJ5A 4HN2A 3J7TA 1UADA 3KLBA 4A4DA 4TMWA 4YPOA 3JWIA 3HFJA 4KKXB 3H2KA 2BJHA 3GUZA 3HV0A 1T3GA 1YUNA 5LU9A 2BGGA 1DRJA 2B37A 2IY9A 2QR5A 3A25A 5FWYB 4J49A 3VZDA 3ZWAA 5HTOA 4XWWA 5IDQA 2GRJA 2P6UA 2YQ5A 4HBZA 1MC4A 4QEZA 1GFIA 3AB8A 5KBYA 1HSOA 1RHQA 5M5BA 4WGGA 2FZWA 5KYNA 3HDTA 2R6JA 3OU6A 2WAXA 3CZQA 3I5YA 2HA2A 4QRHA 3SYNA 3DBHB 2FUCA 3H19A 4MK4A 1TD1A 2P6PA 1WKCA 5GINE 2QLBA 4LDZA 1ZM9A 1YVEI 2QMOA 2XUIA 4EW2A 3GWGA 4ZDWA 3RTGA 1AS3A 4IDGA 5LZ4A 4KXXA 5CJ2A 4D3ZA 4X84A 1F8UA 2CUNA 1JT9A 2SKDA 2W8BB 3FNQA 2VDOB 4Q37A 1DEHA 1K5HA 1TIKA 2JIOA 3K0HA 4G5XA 1NVUQ 1OFUX 2PH3A 4LYDA 3QFCA 1E2LA 1QYCA 4KR7A 3GBSA 3MTGA 1A9QA 3DE7X 2MSWA 4NZ9A 4PFJA 3SBXA 4E7OA 2ZRQA 1FFCA 2Z9BA 3OLVA 1ZD1A 2IYWA 3CVWA 5FYQA 3ZHYA 3HXKA 1RRGA 4H17A 4CDGA 5BNWA 3C3PA 1T4MA 5ITZB 5B1IA 3R9IA 3PFHA 1D6SA 3AILA 4BECA 4XJXA 3PTAA 2GM4A 4LSZA 3QU9A 4G63A 3F0TA 1SBNE 1JBEA 1R6TA 1XQ1A 2P91A 2VS1A 2WWWA 3IUNA 5E1OA 3RHTA 1CZUA 1YQQA 3WLHA 4F12A 5HHTA 1D3AA 3LBAA 2IYTA 3D3WB 1T25A 1OBVA 3I83A 5B1EA 3SZUA 1JT2A 1IJBA 1OTHA 1S9HA 4CTKA 1JI0A 3U56A 2KM1A 1JKMA 1UK9A 2OESA 4LYEA 1DBPA 3DDWA 3L7IA 2Z6AA 4X64B 3WBFA 4MP8A 1J20A 4O63O 1BXRB 2RGXA 2WIFA 3PJDA 1NHWA 3G5LA 5EESA 3UJ3X 4G4IA 4QAQA 1QG4A 3RUHA 3E18A 3LBHA 5L3VA 2IUSA 2XHEA 3EIUA 3PR1A 4ND3A 3CH4B 4URHA 1Q1NA 2K87A 1W1IA 2VHWA 4QFMA 1ZFLA 1QX4A 1XB2A 1JDPA 3W2TA 5E9JA 1YIDA 1M0EA 1JAIA 3O93A 2FR8A 5A3VA 5JHGB 2W83A 1NNLA 1N2OA 3AIOA 5EXEA 1FTYA 4QPDA 1V8FA 3JARA 2HHCA 1AV6A 3O3OB 3HBFA 2Z6QA 1TB4A 3C6ZA 3QV2A 1NW6A 1SIBE 3DAPA 3HKDA 4G25A 3P2IA 2IV7A 3OU7A 4LJRA 2HU7A 4UUAA 1V6CA 1WKVA 2H3HA 4FIZA 3U5ZB 3OT4A 1NG1A 2PU5A 3ROPA 2IHZA 3OIVA 4UBLA 1NU6A 9LDBA 1V0JA 2I2DA 1GFSA 2CYCA 4CIYA 4KPYA 3ADBA 4BQEA 4LGCA 2PUEA 4ND7A 5TQJA 5I45A 1LXCA 3RVRA 1WXDA 1J8QA 1GL7A 2AMJA 2HMSA 2Q0HA 1QF6A 5AW5A 3VYTB 3NBFA 4GVLA 3VSBA 5JMWA 1H8HA 1QNFA 4L9SA 3AZPA 1UBMS 1AHIA 3DOJA 1D4AA 3GZNA 3T9FA 1X80A 2R8XA 4J2TA 5C4MA 3LDHA 1BQ4A 2OBYA 3EF1A 1M3SA 1XDZA 1W49A 2YWBA 4P3KA 3AHDA 4UTPA 2ZXUA 2Y0PA 3ONEA 4D0SA 3FDXA 4PN7A 5A3QA 3IEVA 2YCLA 2V3VA 1HLPA 1KH3A 1JI3A 4WW0A 1YVPA 3PUJA 1TIBA 3VTZA 3N0TA 4DUYB 3ISVA 2ZI5A 3R6LA 1LCIA 1UK7A 4ZICA 1E9VA 3ECAA 1YQGA 2XV1A 3VI4B 2E89A 5IXSA 2P30A 2KJQA 2E4WA 2QRGA 2QMEA 3ZN2A 4P3PA 1B0PA 3M2TA 5LB2A 1IQRA 1EFKA 4NPAA 5H3LA 4ZCRA 2OQVA 3DUWA 1I6WA 3ORQA 3R9KA 2LNDA 2OZKA 4RTPA 1B0AA 2LRHA 2ZVDA 4HEQA 3JTEA 3ORYA 5IJ9B 5K99A 2GO7A 2X1HA 2C57A 5AKXA 4PFSA 2QTLA 3GOHA 5LQJA 3DMTA 3TRFA 3TD9A 1XZJA 4LK3A 3D8SA 1XKLA 3HADA 1I94B 3AVXA 3BAFA 2WTEA 2FP4B 3TR5A 2X23A 3DBLB 5I9BA 4UCFA 2BFOA 4P7FA 3JR3A 4X54A 4LYHA 3S81A 3VKGA 4LBZA 3U7EB 1XEWY 2XR1A 1FBTA 2P1RA 3NKVA 1T8UA 1PSDA 2PZMA 4FHGA 3GN1A 1AQLA 3L0YA 4PXAA 3GD5A 1Z5UA 3U9TA 1MVOA 4KN8A 4AP9A 4CW7A 4E5MA 2XA1A 4HEJA 1NJ2A 5JNUA 2XEDA 3HBJA 1J07A 4X91A 4B34A 3BJZA 3ZHUA 2PAAA 5L3SA 2NUPB 4KYIB 4JC0A 1EP3B 1QF7A 3ESZA 1E6EA 4B3XA 4DE5A 2VI5A 3TRHA 3IBSA 5G3YA 1E7SA 3SSOA 2BZSA 1XDUA 5DMHA 3SXJA 5C52B 3NMUF 2EX0A 4OHWA 1KFJB 3EEQA 2QGZA 1JHDA 3KUCA 2AK2A 2CF6A 2F1OA 5JE8A 3EODA 4IJWA 4O6VA 2PX8A 1RQLA 4MPRA 1A9PA 2GUGA 5K01A 2NUAB 3U81A 4KMOA 1GDTA 1H6CA 4YRAA 3LBIA 3BX1A 5G1NA 3UANA 3A9TA 2A8YA 2G8LA 1ZP6A 1Y3IA 1ZI6A 2J6BA 3E1KA 4M55A 4PCUA 3UTDA 3WIDA 3JZAA 3O1IC 3P0JA 5AK4A 3PUYA 5EXTA 5AVJA 3T5PA 2VG8A 2QHXA 1RMQA 4HLCA 2F1JA 1WDWB 3EWAA 3HABA 1L3CA 4LRTB 1FBNA 3P20A 2WP0A 4R7ZA 3RS2A 2D2EA 1XDSA 1PJAA 4XIIA 1ADGA 3ETLA 1TTPB 1I32A 1V16A 2HXYA 4BTEA 3T1TA 3HC7A 3ZWMA 2Q0XA 3Q9NA 1Z2EA 4Q6WA 4HNVA 4L6AA 2XA9A 4BO0A 4EITA 1NUQA 1WXEA 1P7WA 3NH6A 3OJ0A 3AONB 1NV9A 1BXGA 3NDPA 1GG2A 1QTRA 2FSVA 1Z0SA 4M0PA 3A1SA 4X92A 4OBWA 5AI5A 1W9HA 3H4VA 2P9QA 1KMHA 4UATA 4Y6QA 2DFTA 3D8NA 4JSRA 4WOBA 2FLKA 2FEOA 1VE6A 2FSUA 3RK4A 4E51A 1YMQA 2QROA 3ZV5A 1T4CA 4V1CB 5LOVA 3SWWA 2IA5A 5BYAA 3D7SA 3EGIA 2B6NA 2VNKA 1IH8A 4G1BA 4UVIA 5CXXA 4J6EA 5H8WA 1XD2B 2AJ8A 1GRNA 3GFQA 3WS7A 3ZY3A 1FE8A 1BU8A 4DZRA 1IEVA 1W9MA 3JQFC 1Q95A 2LCIA 4EHHA 4I1YA 2J3KA 3LT2A 2B0CA 4B31A 4HN9A 3H3FA 1D1QA 3K0EA 3C87A 4QDOA 4DB4A 1LJUA 4C14A 3OMXA 4K9NA 2GT1A 3WGVA 4LF6B 4N01A 3Q2KA 1OAOA 2D1RA 1XCJA 4IKOA 1KEEB 3MQ2A 5JCXA 1VIMA 3KXKA 4MNTA 1FDIA 1RAFA 2QNBA 1UKEA 2HQOA 2O2ZA 3JVIA 4OOEA 4DN6A 1SEVA 2FW6A 3FNGA 2A33A 2PZ8A 5CNIA 1SXJE 4FOTA 3W6UA 1V5IA 4WY8A 5CDYA 4L73A 1OXSC 3ZCSA 1HT1E 2FR8C 5A2GA 2ZB7A 4K26A 4KTVE 1U6JA 5E6RA 3GIDA 1A4UA 1K7YA 1QIEA 2IHKA 2OT3B 2YHSA 3HP7A 1EK1A 5HZGA 1PJ2A 2HEGA 4TV9A 3COYA 4EA9A 1ZQ9A 3AM4A 4Q21A 4WCFB 1E2PA 4QSMA 4YQZA 7ADHA 4BQIA 4F4IA 4I5IA 4YXFA 1OJ7A 4GPZA 4KX3A 4UAJA 4UHJA 4YQEA 1XD8A 1RJ9B 5EI5A 1NQ5A 4L8GA 5AUQA 2J33A 4N3CA 2ZYUX 1OZFA 2BKVA 4G5FA 5LN1A 3BHJA 4I55A 1N6IA 1B73A 1ZN2A 2IEIA 4NHOA 3TLBA 2WF9A 4POAA 4DVGA 3I62A 3LUFA 5A04A 1KETA 1QRTA 1D9ZA 3AKZA 1LTQA 5CLQA 1IATA 3GUHA 1ESZA 2ZWOA 1KI3A 2KYRA 2VAXA 3NTRA 3USZA 1H6DA 2V5AA 3CLTD 3HKBB 4Q4JA 3FJOA 2F8TA 1T8RA 3QQPA 3FYDA 3GNSA 4K1XA 3VDRA 4A2QA 5T4EA 3CC8A 1NPDA 2BI7A 2W4IA 3IAXA 3WKBA 2NP6A 2UZ0A 3W0LB 4PLVA 4BFXA 1LBIA 2C7RA 4CIXA 5LL6P 5IABA 3INNA 2O5VA 2C2OA 2NXJA 4PG7A 1Q12A 1E0SA 1RHJA 1RRMA 1UBOS 1KJIA 4HTAA 5F76A 5AXAA 4DAOA 4ZDKA 10MHA 4RK6A 2AWNA 1E1MA 3DWIA 3QYFA 4MV4A 2RGRA 4K6FA 5F64A 4ZCPA 4WTOA 3LKBA 5B1DA 1G8SA 1MB3A 4IHKA 3SU8A 1AGYA 1RWQA 2FPOA 3KBBA 1YB4A 1VE3A 2ZVPX 1KZ4A 3KPJA 4UNNA 2HUNA 2P6NA 3BQMB 5BWMA 3TL6A 421PA 1PJBA 3PWTA 4XAQA 3STYA 1GUAA 2AFHA 2YOGA 4ZOCA 4Z9XA 1FXUA 1Z28A 4D9CA 5JSHA 3NHPA 2PANA 3BRQA 3PUZA 1MOZA 2ZULA 3QTTA 3D7NA 3ZQ4A 1VC2A 1W47A 4K8OA 1KYZA 1X7YB 1VPVA 2WE7A 1GNTA 1E98A 4ZGGA 2PXHA 2F3TA 3X0DA 1DI0A 4EJ6A 4O2AB 4JBXA 3CCFA 3PGXA 4WOKA 3SZOA 4C0WA 1N34B 2P0YA 5BYJA 4L28A 2CFTA 4B3HA 2DEUA 2DKFA 4Y6PA 2JFPA 4BMOB 5EJMA 3ILHA 1Z4NA 3WIBA 4HDOB 1FPMA 4F8YA 1V9LA 2BMAA 5DNDA 1U3DA 3WRWA 1RJEA 3KJHA 1EK5A 1LVHA 3ISTA 5HXAA 4ZHQF 3D3EA 2VPYA 4YXWA 3K0SA 2PVCA 2DVMA 3PUVA 1QHYA 1ZM2A 2GN9A 3EF0A 3THXA 1U3GA 1ZVQA 4A82A 5AUPB 3TK1A 1EAYA 2IEBA 2OCPA 2G71A 4AI6A 2ATXA 2B98A 4QX6A 1XKQA 1IJKA 1WRBA 2VXBA 4E6PA 1Y7TA 2KHZA 2QRJA 2XVAA 5TR9A 3OX4A 1I7LA 1OYOA 4JGBA 1P5RA 5AESA 2PUFA 2CHVA 2VBGA 1BKSB 2JZOA 4M0EA 3SQLA 3WMFA 3PIRA 1XRRA 3IKTA 1F1BA 1W44A 1FNNA 3F3YA 2BBOA 3LUPA 1WP9A 4MV0A 3VR4A 5CURA 2FMUA 1UMCB 4CTNA 2FPPB 2HCFA 3NAQA 2D00A 1E3QA 4JP8A 1IVSA 2ARKA 2V4ZA 4JELA 4YBZA 4AQYB 1JEQB 1N3BA 1QAOA 3AR2A 4Y1EA 1Z83A 3HSSA 1ZBDA 4GL4A 4RADA 1VKJA 2RH5A 3P9QA 4DPKA 3EZ2A 3B1VA 3N8HA 4YYZA 5CB4B 4BIMA 3ADCA 1D03A 2W2XA 2FI1A 2ZTUA 4LRYA 2H92A 2R62A 4X20A 5TPZD 2IEAA 3DEIA 1I1OA 4EOGA 4FSXA 1T6XA 5DHTA 4YUVA 4MKHA 2OMKA 1R6AA 1B8VA 4DBLC 1R0WA 5KVSA 2A1TR 1JHYA 3KM0A 5FTKA 5LQDA 1PZFA 3LYAA 3AU8A 5KVCA 4O4LB 2PBFA 3BE8A 3NHJA 2CSUA 4BWVA 2HREA 5YASA 2R7NA 4LYGA 4CMBA 1VG9B 2F90A 4DV7B 2WM9B 4BDTA 2VPTA 2WA2A 3Q85A 4TL9A 1EFLA 3ER8A 2NLOA 1F12A 2P40A 3UK6A 1ND5A 2AT1A 4PPYA 4IIJF 5BWLA 1XQXA 1DQYA 2XQGA 3G2OA 5AJXA 3QKTA 4Q00A 4U0JA 4GPEA 5IUNC 1W0CA 3JRXA 2J41A 4G5SA 4TV8B 1MAVA 3SVZA 1CDOA 1HT0A 1PBNA 3HXPA 3N87A 4XWKA 4PTLA 4MVJD 2YMMA 1NVAA 3DAGA 3F4KA 3ROTA 2EIXA 1FFAA 4PYKA 3SYLA 4B4DA 2I9KA 3GJZA 2GBFA 3D4PA 2N42A 5K0JA 4W5HA 1F5SA 3B1JA 4HAZA 3E6AA 3BD6A 1O7JA 2Y1FA 3M34A 4H6XA 3AERB 4ZT5A 4E13A 3O8BA 4I4TA 3T0IA 3GNQA 4ZDJA 3PXUA 3PKJA 3NPMA 3WL4A 3WGIA 4OCZA 4M98A 4YUYA 4EPTA 3GA0A 1XZPA 1RBZA 5G41A 2BFFA 2W6OA 4KEAA 2XYRA 3A9RA 1A8UA 1Z26A 4LY0A 3SR3A 4EJ2A 2GTIA 1W2HA 3N0XA 1T9DA 3Q10A 5F1OA 5B2EA 3VKHA 3C8UA 1AXEA 4NONA 2AXPA 4WGFA 3QLEA 1R1DA 3CE9A 5JBNA 3UMGA 3ZU3A 4II3A 4C1BA 1U1IA 4XM0A 1D04A 2EP5A 4A1OA 2V74B 2V6IA 4YH1A 1GDHA 1M7GA 1U2TA 1YVRA 1FDOA 5CYGA 4L8YA 3AF6A 3QI2A 1JU4A 2Y92A 3FUVA 4U5QA 2OKCA 2Y6VA 4AO6A 2AN4A 4AG5A 2Q3MA 3HCEA 3UC5A 4JQSA 1X0VA 3D6NB 4EI9A 5KYGA 5JPIA 1E2FA 3G8CA 3U4GA 4RULA 2XCRB 1R6BX 4RKWA 3OCYA 3RJ5A 2YQZA 3UH1A 3ZY2A 4CIWA 4YIHA 2FSVC 1NKVA 2ZRDA 3NONA 2PV0A 4AZ3B 4MAMA 5JPDA 3HBLA 1T36A 1PR4A 1IOWA 2C2ZA 5DBEX 4PICA 4KITB 4YI3A 3VAYA 5DMXA 4ZCSA 4M0KA 1Q7BA 3D64A 2A1TS 3VH2A 2C92A 3I01M 4NCKA 3VOBA 3C41J 2BGTA 4MLPA 1D6NA 2X9QA 1MO3A 4U2CA 1OH6A 4R2LA 4G1FA 4NV3A 1HGXA 4HC4A 1KQ3A 3JQ8A 4FW8A 1RXUA 4LG1A 4XW2A 5G0SA 1EVKA 4F5YA 3ESDA 1AK9A 3DLCA 1BQ3A 1YS1X 4HDNA 3MRTA 1XAGA 2R1UA 2GA9A 3ST7A 1ZH6A 4L0CA 3UCXA 1T0IA 4LYAA 1AQUA 1Q0LA 4FHZA 5T6BA 1ZRNA 2OP0A 5HG0A 2FWJA 4D57A 4E88A 4QARA 2HWYA 3PHIA 2AB0A 3PFWO 2CT8A 3ACDA 3O2JA 3DCYA 4HNAA 4X1IB 4AX8A 3KEQA 3W5DA 1YHYA 1NAIA 1A9SA 4H4EA 5IEJA 2BHRA 3FCXA 4AY2A 4JP1A 4XE5A 3MM4A 2JG3A 2CVZA 2O57A 2A0KA 3GDOA 3QGMA 4KLRA 4BNUA 1X1TA 1G5IA 2GHTA 4IMJB 1R4ZA 1IBCA 4HP8A 4BE7B 2JBAA 3KWMA 5BNFA 3KDPA 1IZYA 3QBDA 1OXMA 2CDNA 3A70A 3UKOA 4LZPA 4BWYA 3QU4A 4C04A 1VE5A 3L8GA 2DG2A 4KK4A 2EWWA 2JBWA 4YGYA 1RWMA 1V8PA 3IKLA 2Y99A 1WE2A 3CRNA 2IWRA 1EIWA 5GGXA 3DEYX 2HRRA 3TD6A 3KUDA 3GGCA 5EE9A 3W05A 4FCVA 4QUEA 1HNZB 1I01A 3RYFA 3FNIA 2FTKE 3H5NA 4WFIA 5K4GA 3QFTA 3TINA 2Q4BA 4MR9B 3VVMA 2IH4A 1M66A 4FWBA 2EXXA 3H86A 3HHEA 3C5VA 4RHFA 4RSHA 3T41A 2PXCA 3BB4A 2R751 3WNVA 2V54A 3ITDA 4KX5A 4DIBA 3IO5A 1L6RA 1RADA 5HMMA 5IC5A 1XN1A 2BIFA 4GGOA 2AN5A 2QTFA 2OEPA 1KQOA 4Y9TA 1TVKA 2C83A 2QL7A 1YI0A 3WIOA 1KFKB 2XCLA 3VO9A 4ZD6A 3H1AA 5A7HA 1YRBA 3W6NA 3BVPA 4DSNA 2CV0A 3R3VA 4AJNA 1WO8A 1QZTA 5E8JA 4GEGA 4JC4A 1Z16A 4GM0A 1VXOA 3O38A 1WCYA 1SH7A 3LNCA 1TQDA 3CVJA 1BMTA 4GOMD 4RCYA 4X6LA 5KWIA 1N33B 1QFZA 1TZCA 2GYUA 2IW3A 1GLVA 2H54A 3DP7A 1DP4A 2OXFA 1KZ6A 1GG9A 1J2EA 2WRZA 1E1QD 1AKVA 3OF5A 2WAMA 4PYRA 1BMQA 4XGNA 2F43A 3ZW8A 1E7MA 1GU7A 3DDSA 3LBYA 3JD3A 3DKKA 5G0TA 4MX8A 3Q15C 4PLPA 1Q44A 4AKHA 1IEXA 4KWTA 5F23A 2VYFA 3UVEA 1JHAA 1PG0A 1O96B 1UKYA 4CKEB 4POOA 2HM7A 3TX2A 3H1BA 3Q98A 1VBMA 1QP8A 4AMUA 2WDPA 3ROXA 3FX2A 3SKYA 3HB7A 5B64A 2PKEA 1PJQA 4KZKA 4QM6A 3C8ZA 2GR9A 4JZYA 1ZNYA 2ZBEA 3DDNA 4BNYA 2HSGA 4MGEA 3F46A 3A36A 4M21A 3F74A 3GR6A 3H75A 3G23A 4GMHA 3CLRC 3Q0TA 1QMGA 2C4KA 4JODA 4JT4A 4FDMA 3U37A 4B7UA 1RTKA 1Z6ZA 4MKRA 1GNPA 5ALOA 4AXXA 1EX9A 2WTNA 2ZS7A 3E5MA 3F98A 1P4GA 5IM4A 4L8LA 2Q5JA 2J3MA 4PNZA 1EHIA 1SHKA 2VDNB 1YB2A 1S1MA 1L4MA 1XYVA 2HCTA 2IZ1A 1T2UA 1MPXA 2H4FA 4LCBA 3ZJ5A 3M1IA 2W6ZA 1ZIPA 4BN0A 4HK4A 4QBHA 1DMRA 1QRAA 3PJGA 3TPFA 2D5IA 3E0QA 3ENKA 1XRNA 4F4JA 2JCYA 1PWEA 1S2MA 2JJQA 3QENA 1RE0A 3KZMA 4HH0A 4OX9B 3JQ9C 1Y1LA 2VTDA 3OQ1A 3L0BA 1B93A 1PYOA 4YJHB 3WHIA 4CM9A 4NX2A 2WJYA 3REOA 2PUHA 2C9OA 4K9KA 3RGGA 3WKCA 4ZO9A 4Y67A 2C9YA 2KWIA 1FLAA 4NEQA 4F21A 1H0KA 3DT8A 1YQ9A 4I1RA 4OUDA 3DMFA 1JXAA 3HWX1 3EQ7A 5CVTA 2H2HA 3K5PA 3RIXA 4RO0A 4RIFA 1QJ4A 4CLRA 2V45A 1DXOA 2I2XB 2P3SA 2D74A 2I34A 2AEJA 3ER9A 5COBA 3RC1A 1TZBA 4OQNA 3TNJA 1RCFA 4TZKA 3ESRA 4O2BF 1GL9B 1N2IA 3ZOKA 3HDQA 1DIBA 2QLTA 2P27A 3M4YA 4GP9A 1AF7A 1UC5B 1UJNA 2NVUA 5P21A 3SJCA 2B7CA 2EWVA 5G1PA 4W8GA 1EFRD 1WXXA 5AJHA 4KR6A 2R8BA 2ZSFA 3N2KA 3LA8A 2WHQA 2Z3WA 4JLNA 3QE4A 4ND1A 4PGGA 4DXHA 3H99A 3IHLA 4Z9AA 1FDTA 2O2SA 5SICE 3I9KA 1J42A 1CQXA 4ZO7A 1K7CA 1T5TA 2V98A 5KPJA 1KRHA 2BJWA 2HA5A 5C3UA 1BHSA 1WR8A 4TYMA 2O2CA 4FGZA 1NLUA 3SNKA 1E99A 4JYPA 8AT1A 3ANLA 5KYWB 1K8YB 1FP6A 2FYTA 3C74A 4F06A 4JLPA 3UAOA 3CS3A 2GKOA 4DR4B 2MHCA 3N8NA 1NVKA 3ZQ6A 3DVQX 3RVSA 2VHVA 5JCJD 1I2BA 3NM5A 3S27A 1QO9A 4GSKA 2BKAA 2IZOA 5ADUS 4EPYA 4E7PA 4QHYA 4UTZA 2Q3JA 1MJ5A 3G2MA 4LBVA 1JSCA 5KOHA 4UUPA 1Q17A 4KFUA 4GQIA 5IAOA 4D9IA 4LVUA 4LW8A 1EGHA 1JJVA 2J6CA 3T06B 2A9QA 1RD4A 4RZIA 1BFUA 3LLCA 3A4LA 3H0CA 3MFQA 1NUAA 1P5FA 1U2QA 4YJ2F 1F6BA 4Y9UA 4KPFC 5A5FA 2XSZD 5CB0A 5K0SA 1E7YA 2PO5A 1T4BA 2Z4TA 2M6SA 1VRCA 2CNLA 1WPQA 2XSZA 3BMQB 3I2KA 4LOHA 3KQVA 4LV8B 3RRBA 4DUPA 5TF4A 1KU6A 3K9NA 1R88A 4MR8B 4NV1A 3MCAA 4I50B 2FSHA 2R87A 3L1IA 4QHTA 3X1MA 5KQSA 3OICA 1X70A 1UWVA 2A2ZA 4LCEA 4WACA 5CA1A 1JS1X 3BF7A 3D4OA 2V0CA 1JLLA 3AETB 4QGAA 4RAOA 3S2FA 4EI7A 4JHXA 3U60B 2JIDA 3I28A 4G0UA 1IU9A 5AI4A 3G9UA 4GX2A 2C04A 2BEUB 4XJVA 2JH9A 4IMPA 3UMJA 3K72B 4J7CA 3FWKA 5E38A 4DC1A 1KWKA 3AHFA 1TAUA 4V0LA 1N6PA 2GLXA 1GPDG 3WAKA 4ZTUB 1MA0A 4XEHA 1H4QA 3RUIA 3W4JA 2B20A 1NN1A 3UEOA 3WZ2A 1COWA 2BF4A 3AF1A 1NQXA 5EWMB 5HE9A 4YCJA 4D99A 2Q1SA 4FCCA 4P2GA 3QA3E 8ABPA 5J43A 2Q21A 1K1EA 2GZMA 3E9YA 3RS5A 2VK4A 4D6YA 3CLUD 4PAGA 2QAGA 3IMFA 2VYQA 3TIVA 1ZR4A 3ZD7A 4BX8A 1S0UA 3GJXC 3GFTA 1KVUA 3JWJA 1SU7A 3M6XA 1GTRA 2B4AA 2FXVA 1M1YB 1A5TA 1DKQA 3M4XA 1U0OC 4MQBA 4BGIA 2DBRA 2ZJFA 1K27A 1XEFA 4RZ3A 5FXMA 3VTFA 4Z4HA 4DR1B 1GVNB 2PMFA 3BGWA 4GC9A 2VVTA 2G7ZA 1OZAA 2C9ZA 2B78A 2J9FA 3F5MA 2QNRA 4DLLA 2VJCA 5CFZA 4MQLA 3WSWA 2PX6A 5AVWA 3ZHTA 3UXEA 4KYUA 2FG5A 5H02A 4QKQA 3VJRA 5E0OA 4QASA 3N05A 1L4LA 1OI2A 1ZK3A 3PHGA 4ZYYA 1U9ZA 2IKSA 1ODCA 4HAVA 3WISA 4MMXB 9ABPA 4RDXA 1E3TA 2WB4A 5CHYA 3HJCA 1T8TA 1QZ3A 5JDCC 4M7PA 2NIPA 2WY2D 5DU2A 1KEZA 2PMWB 2IV3A 3SS9X 3SBEA 4E5NA 5JNRA 1FU4A 1IAQA 3SX0A 5JXJA 4HMOA 1T9GS 5DFAA 1EESA 3B1ZA 5G40A 1RFLA 2Q3BA 4LX0A 3ZVMA 4Y2RA 3QIAA 4HDCA 3LKVA 5KDOA 1FSZA 1EUDB 1IHDA 2OPBA 1A8IA 4CT4B 3KALA 3KU4A 4QLBA 5CDHA 5JPCA 1MTZA 1MOPA 5G0UA 2HLDA 4ARAA 4CIBA 3DMRA 4TVBA 2I66A 4UXIA 3S55A 1YI8A 2CHQA 3IIMA 4P35A 1L5VA 2NQTA 3IXMA 3QE2A 4EQZA 1EKXA 1WBJB 2ZJ6A 2JRCA 2JH3A 3HE3A 5I7EA 2HWUA 2JIZA 1YC2A 3OIWA 3QI7A 2JAOA 1CJBA 2VPXA 3QWAA 1SELA 4PW0A 3PXGA 1T0UA 5ESWA 3DTVB 4OA8A 2YQ4A 4QUIA 2ZU6A 4DRXB 4V0MA 3SVLA 4ZAGA 4QYSA 3ZGZA 2JGDB 3K70C 3FYTA 2AKAB 3DBHA 2B30A 3I9OA 3IB6A 1M2KA 3UOWA 5KYKA 1U7HA 2G9UA 5AJWA 4DMMA 1ZUNB 2IXTA 1PFKA 1X1DA 3F97A 3KR9A 3LLVA 4DRXA 4LSMA 5BQPA 1D5CA 1G291 4FNOA 3RANA 3RSLA 3EEIA 3LHDA 621PA 1WHTA 3MB5A 1ZCBA 4M9SA 2BMJA 3ZGLA 3AF0A 3PYMA 5I7SA 3RROA 2VHQA 1UK8A 3T4UA 3UJ8A 1XMVA 4O4JF 5F73A 2Q9AA 2ZROA 5I9NA 3HUFA 1XRSB 3HS3A 1D0VA 3K2QA 3GPLA 2AKEA 5C31A 4AZTA 3G6WA 1JFFA 4MV8A 1E9FA 1HFEL 1BFKA 2JGFA 1PEYA 1Z75A 2YY7A 3B3AA 4EB6B 2XGMA 2CLKB 3SXUA 4DA7A 1AO3A 1O95C 3GPDG 5JMTA 1E1KA 4B81A 4TQGA 2P3OA 2VPIA 4RS3A 5LVAA 1JEOA 2AVDA 2DETA 1SHUX 1IZZA 1OH7A 3RRXA 1FQKA 4CL2A 1TW2A 1IYZA 1WEKA 2LIPA 4IOKA 4H7JA 3I5UA 3U4AA 4EY5A 4KREA 1KK2A 4FZ3A 3QTBA 1FXSA 1KPGA 2H07A 2NUBA 5KWEA 2B8WA 1J56A 3FMVA 4F72A 4YV1A 4Q3EA 4YJ3F 1CRZA 4MUGA 2GA8A 4YUZA 5TGTA 2HA6A 2W6QA 2ZJ5A 5BW8A 2QLLA 3OZUA 1L5GB 4FI3F 1XK7A 2DJ5A 2J0VA 4U6QA 2JLSA 1CJUC 5CR9A 3EARA 4A8JB 1DINA 2H08A 4CETA 1NTOA 3ILVA 3C48A 4QDXA 2SBTA 1LLUA 3L8CA 4F0JA 5A5GA 1R8JA 3OLWA 3MLEA 2BMVA 4KB5A 3CT4A 4DCCA 3G9TA 2H6EA 4RV4A 3RSOA 4AF6A 5HUJA 2VHCA 1C0LA 1U5AA 1KZHA 3ZEIA 1BH6A 3WMEA 1IVNA 1S02A 5CVVA 2NO5A 4PU0A 2GPBA 4ZCLA 3QEAZ 2PXAA 2D06A 4BX0A 1SR8A 2UZAA 3OQ6A 4MRNA 3RJTA 2Q0SA 4ZCTA 5MN6A 1EVQA 1LDBA 3HXMA 1YA8A 2VPZA 2H31A 4OL9A 4KQEA 2QQ5A 3RC7A 3VRHA 5IXYA 1LDMA 5EJ6A 2HO4A 3QRWA 1XZHA 1JXMA 1BE0A 2BI8A 3CKMA 1P4HA 5TPWB 1EGMB 1GUDA 3PUIA 3S99A 5A1JA 3IBYA 3IGFA 4YPFA 2ZB2A 5FPKA 1LA2A 2QDKA 1CKEA 3AKDA 4N40A 1RYDA 1X8LA 3AFOA 4RSMA 4JI1B 3BQNB 4CKCA 4FS3A 1LWNA 3O75A 4PZPA 3BAZA 3I4CA 2GEDA 5AI6A 5BN1A 4R1UA 4Q48A 4D9GA 2QRVB 1ZN7A 4ZV9A 3BGIA 1PN3A 2H16A 1J09A 2XADA 2QD3A 1KGDA 4LC1A 5DO9A 4WZBA 1CFJA 4Y1FA 3IIKA 1DBVO 1RYFA 1ZRMA 3TZCA 1JA1A 1HV8A 5EZSA 3VYWA 3DMGA 4KN9S 1RYEA 1RQ2A 2JJMA 3TRIA 3QH4A 3UAGA 5KU1A 1XQVA 1J33A 2D4AA 2X8JA 1C4XA 2OBXA 4NPCA 1M1NB 2WYHA 2W5UA 4IDHA 1L5YA 2HB6A 3CB4A 2IPNA 3HVJA 1YE8A 3N59A 1T5OA 4X7BA 3T8YA 1LLDA 1TK2A 4LQLA 2PJDA 3I64A 3QX9A 1IY0A 1V39A 4HRYA 2GNOA 2RHBA 1RI4A 3HP4A 4CIVA 4I8DA 1Q3TA 4NABA 4W4TA 1J49A 1D0IA 3VH4A 4ITRC 4OMFG 3UMRA 1GQRA 1NDQA 3RYTC 1JFRA 2HK6A 4ZQGA 1FRQA 4XCVA 4C3OB 4MVYA 1KHTA 4RH0A 4CN9A 2OAEA 4XPZA 4EG3A 1CY1A 4RVCA 3CLSD 2PCLA 1DOZA 4K46A 3ERCA 4FIDA 3PD0A 4NRDA 1TJ5A 2PMKA 2X2PA 4DMRA 4WNAB 3DLTA 5CFRA 1M76A 4HFRA 4EA7A 3IVCA 4XM2A 3AF5A 3NBYC 2OHXA 1P77A 4GX0A 2G0AA 2X5NA 4M54A 2G09A 5EY5B 4ZJUA 1F06A 1SD1A 3OX2A 3OOYA 4I9HA 4PXYA 4Q3NA 2O19A 3MQ4A 3K9BA 4I14A 2XMRA 3ZYCA 4TXMA 1S7CA 2ACWA 2PWPA 4OKNA 2V96A 2BYTA 2A9JA 3IERA 1JAXA 3TG8A 1E66A 2GZ2A 1Z6XA 4LE0A 4ND8B 5BW4A 4CQNA 3ZI7A 1Q0QA 2O8CA 4DW8A 3DWEX 3PFKA 4IXMA 1NVMB 2J5RA 4NS4A 4PFKA 5LC1A 3L7YA 1EXDA 4JI7B 2YJ6A 1USWA 1NUTA 2ZWMA 5EGNA 3BMNB 3DR3A 1E1NA 1XMJA 2GBLA 4A6DA 5BVHB 1ZM3A 4Q7LA 2QVLA 1FS6A 4U7TB 4OGLA 1ORRA 5KPDA 5EZYF 2FN8A 3F67A 3KEGA 4KXQA 4DDWA 1XL1A 3HVHA 3Q3VA 4H4DA 2ZSDA 4X1OA 4ZP1A 1GSAA 1VPDA 4PY2A 5KTOA 3V55A 1LD3A 3O6VA 2OD9A 4KVGA 4D8TA 1KRXA 2WOOA 3GWZA 3ESBA 1X2EA 3D0QA 3GUCA 2DRIA 1SIWA 2XXAB 1TCCA 4I3HA 2WKPA 3LC2O 3IXLA 1TJPB 3ULKA 5K0TA 3TZKA 3TNYA 4MWZA 3K1YA 4P2BA 4GW3A 2F59A 4W6ZA 4Q1AA 1VGRA 4WNCA 4BQPA 1ZVVA 1DOAA 3N9IA 1B23P 1BA2A 1P61B 3B5JA 2CBXA 1OJLA 3DFFA 3BFPA 3MNFA 5K20A 5AICA 3IH5A 2AJBA 4K2AA 1XZIA 2H0QA 2SKEA 3GEHA 2QNIA 3MTBA 4N3NA 4D3SA 1ABEA 4C4ZA 5K09A 4LJSA 5JS8A 1KYIA 4LGMA 4NZYA 4QOSA 4Q4DA 3LUHA 3S29A 4J0EA 3KZ1E 2YOFA 1ZN8A 3K1JA 4B5KA 3RRYA 4C03A 2O8FB 1NASA 3NM4A 3V8VA 3RS9A 1NNSA 4OB6A 2ABWA 2HDNB 3EGOA 3O9VA 5I5EA 4ZRDA 4QECA 1MC1A 2DLDA 2V7TA 2VXCA 4JJ8A 1BWQA 3U3DA 2AOWA 5HWSA 2B8EA 3E9QA 3OPQA 4LZLA 2HPZA 4WLOA 4BNXA 3IDQA 1CUCA 2F6RA 1WW3A 3VPFA 1OGJA 1MZVA 3KZNA 2J46A 4R84A 3RVKA 3PVZA 1SCBA 1G2QA 4ZXFA 3GT0A 2UYCA 2BKEA 4IXDA 5A3JA 1CCWA 2OFXA 2ONYA 3G8BA 4J0IA 2VTEA 4OI4A 4L50A 4QDKA 2IYVA 4MR8A 5ER6A 3VC7A 3ZWYA 1W0KA 3TZLA 1TAGA 4OH1A 3E0XA 4JY7A 3WP1B 1JPJA 3DMTC 4JQOA 2XUHA 1CUGA 1PQYA 2M98A 3QQ5A 5CBPA 3VPCA 1TVKB 1V5GA 3CUEF 3KR2A 1MX5A 3LUJA 4L07A 4W1PA 3LVRE 4X8HA 3EXG2 3UYKA 1YZNA 3TQFA 2PUBA 3PX7A 3U5TA 1D4ZA 1E5DA 1JILA 4E15A 4RTRA 1JAYA 2JASA 1XALA 2P2GA 2VH5R 2ZR0A 3KTOA 4I6GA 4PIMA 3RUPA 3WB2A 3TOXA 2CXOA 4CLRB 3VI3B 4WBNA 3IBTA 3GG9A 3KQOA 3AI3A 3IULA 2VN8A 1GGEA 4NECA 4K81B 4C6TA 1L4YA 2ZK7A 1L3IA 1W5FA 5CTAA 4KWCA 3STUA 3KU1A 2QUJA 5F2OA 4PRKA 1UEJA 4MGKR 4BCCA 3N7TA 4D4MA 5KTTA 3KHKA 4LHEA 1JQLB 4GG1A 5IF9A 1HA3A 5EXPA 1GTL1 5KAPA 4RSGA 3CZRA 1YOVB 1UJCA 3H1FA 3DL4A 1HG0A 1P8JA 4RPCA 4ANFA 1U0LA 3IQZA 5BRAA 3QVTA 3ELDA 1EZ1A 1LK7A 2H0RA 3DA8A 1BFDA 4GOND 3RI3A 4EJ0A 1UZUA 4LSGA 1KOJA 1ZGZA 5KC9A 1RWXA 2G8NA 2RE8A 4W9NC 2CFCA 2CEKA 4NWIA 2Y05A 1Y3DE 3P5SA 1J5EB 2XF8A 3SHFA 4MDYA 1N2ZA 2FMIA 1A5ZA 4Q3OA 1FF9A 3RRFA 2V58A 1JXOA 1MORA 1ZZEA 2X6TA 4RD6A 5DXJA 4Q9NA 1XZKA 3VOSA 3E27A 3CGGA 3LGAA 4PPFA 3EDQA 3VSEA 2XIQA 1N0UA 3S7ZA 2I71A 5ITSA 1VA5A 1Y8QB 3L93A 5NLLA 1DKLA 2FQWA 3A9UA 1KFBB 1ZITA 2P90A 4BQOA 4KR2A 4KI0A 4X90A 2FPRA 5JU6A 3WRYA 5CLFA 1LSOA 2BP7A 5JWHA 2GFHA 3CB2A 1FMFA 3B5EA 1IXSB 5EVCA 1KOFA 3BA6A 3S8MA 3I58A 4CMEA 2Q29A 1C9DB 1H2ZA 1TADA 5JJCA 2AI3A 3QVSA 4GICA 3UJCA 2VJNA 4EJSA 3AI2A 3I39X 4IQ8A 4Q6BA 2AC2A 4HQRA 4Q05A 5IVHA 3QELB 3E2PA 4OM8A 1BX0A 1DV2A 2DHQA 1MB0A 3L82B 3SHTA 4EM6A 4PM4A 3DD1A 2F3PA 5JADA 4RVGA 3QELA 1KOLA 3PBKA 5FQNA 3WA7A 3IR5A 3CH6A 2X2FA 1BMFD 2N0SA 3CE6A 1H2EA 3OE4A 1ZBQA 2IOHA 1JHPA 1TYBE 4H59A 4BIIA 1E6UA 4DIOA 2QJRA 4GAEA 2VBFA 4ENQA 3KJIA 1JQ3A 4DG9A 4TKLA 1A71A 1DJQA 1IONA 1XMPA 2H0AA 2J3QA 4TYNA 2XBMA 2QV7A 5IASA 4GOJA 2GD6A 3LPMA 3F8WA 4F9FA 2HKIA 2WJ4A 2MJLA 3CLTC 4FYHA 1AUVA 2YYYA 4EGSA 1Y33E 5CLJA 2H1HA 4NBSA 2QBYA 2AE1A 1XBTA 4YQFA 1GSOA 2R11A 4BP1A 5AWFC 2YZMA 2O0KA 4B35A 3HVNA 1T0BA 1Z6GA 1FY2A 3L4KA 2O7VA 2JIMA 1T13A 5CYOA 2X6RA 1L7QA 4F4UA 4BWFB 4DCGA 3R24A 4LWZA 3TGPA 1KMNA 1V25A 1G18A 2DWUA 2NSYA 2R4UA 4TTAA 3RTDA 3R4VA 2WFLB 3VV3A 4MICA 1Y5MA 4TLEA 4REMA 1QUEA 5DK4A 2WQZA 2JARA 1TU0A 2Q8PA 4DMLA 4IO0A 4RVFA 2Z58A 1P75A 3AQIA 4HQNA 5J40A 2IHUA 4A1FA 4Z7NB 4CKWA 1U4SA 2H17A 3KAKA 3PQDA 3M6WA 3QKIA 2XNCA 1A5SB 1GAXA 2JI7A 2IF2A 3ND9A 4TV8A 3R7NA 3FRIA 3RH0A 2PCJA 3COPA 3DT9A 1PW7A 3WWYA 3ZZMA 1YKFA 2QQ0A 3PS9A 3GGGA 4RK4A 5GV8A 3SPXA 2CHUA 2Z9CA 5JC1A 1IXZA 1WDLA 3JVDA 4IAOA 4A0SA 1UINA 4BXOA 4ZMBA 4DHEA 1YHNA 2OB2A 4NTZA 4W5NA 1JALA 2MR6A 3OQHA 1O54A 2UVDA 2H9IA 3B52X 3AVPA 5HILA 4E5VA 4G4SP 4O2BB 3WL5A 2J3HA 1ENOA 1WUYA 1E9RA 1JPVA 1S2IA 2C00A 2XUAA 4O4LA 5TRTA 4J0HA 3ZDBA 2AI1A 4H6VA 4OHYA 2ZM6B 2IU3A 3JVEA 1RCTE 4YRBA 1ADCA 2MU1A 5DLQC 4MR7A 3T99A 2PPVA 4MCAA 1PNTA 2X22A 3MT7A 4MUYA 2QPAA 2RBGA 2GEKA 4E33A 2GAJA 4FGJA 3F96A 3VSCA 5KVAA 4QODA 3TSYA 1J7JA 1W0KD 4Y1GA 5CT9A 3VZBA 2VHJA 2X1VA 4B47A 1HT3A 3AR4A 4J2HA 4ARBA 1XG5A 2I4OA 3WR5A 4XVRA 1Y3HA 3B1WA 3EQ2A 3RB8A 4DILA 1XTIA 3C70A 4DQVA 3WK6A 1V9CA 3L7MA 2IV2X 2RHGB 4MZDA 2Z1DA 2CMDA 3WNBA 3B13B 3BHIA 3G13A 5JG7A 2OZPA 4BGEA 2OHIA 2RK4A 3KZCA 5A9SB 5SYNA 2UVPA 3I72A 3PC2A 4EY8A 5DGDA 4RHYA 1QZZA 1AQNA 4LFBB 1EVIA 4QJBA 3GLFA 3D81A 1U7PA 2I7XA 3OY7A 2QSYA 4EFKA 4B76A 4A73A 3KVRA 1NUUA 2IYYA 5AOBA 3C0KA 4L72A 4W5QA 3IF8B 3LT5A 3EVBA 5D86A 1HETA 2QB5A 1L3BA 3R9WA 3IKVA 4JX9A 3KUXA 4ZVMA 1RC0A 1NQOA 3TLMA 2I54A 2QQFA 1TOAA 2W2NA 4JJ6A 4O1HA 1DUVG 2AXNA 2PKWA 3DWGA 5IRCD 1E2EA 3DKRA 3BJEA 5D6OA 2Q0QA 4PQGA 4NICA 4HLUC 2WK1A 4JFAA 3DGEC 3LYLA 4PGFA 4L2IB 5C8DA 3OEHA 3Q7TA 4G65A 4YO8A 1DEAA 1YZVA 2UYGA 4B6JA 5FH9A 3ZH9B 1UJ6A 4JUBA 2BC9A 1N0HA 3ZXSA 4NYJQ 1KZYC 3PT9A 4LY6A 4AP5A 3AVWA 1UZAA 1YU6A 3F1KA 2IOYA 1MFPA 3MMZA 3HY4A 1Y82A 4IUBS 2QT9A 4TLBA 3BT7A 2J9YB 1ML4A 2I22A 2VSYA 3JATB 1EP9A 4N7JA 5CEJA 1RXYA 3QXHA 1HWYA 3U4CA 4QSHA 1RACA 2AE2A 2I8LA 4FOOA 5KYVA 1V8OA 2WFAA 2PGLA 4C3UA 3ZXIA 2YHAA 4JLAA 1YR8A 3CEAA 2M6LA 4QU0A 4X7PA 3KJGA 1AK2A 4B45A 1BROA 1E9AA 4RETA 2YIDA 1B1CA 4HMPA 1SWWA 3F5DA 2WF6A 3K94A 1S2LA 4X45A 3SS8A 3LUKA 5LNK6 4UULA 5G02A 3OQOA 1VBFA 3B9PA 4XR4A 2ZPUA 4QLOA 2PS9A 4UMEA 1QPBA 4W63A 4ZV4A 1JIIA 3DTYA 2JDID 1SCNE 4GZ3A 1C7QA 1H0HA 3F9RA 4XCXA 4LZNA 1OUMA 1P4AA 1EDDA 4ETNA 2OM6A 3LGSA 4KI7A 5GTDA 1ND6A 3PFIA 3F78A 4H15A 4J1NA 4R8SA 2V6BA 4DJAA 1BE6A 1CQJB 1X14A 3DOCA 3KT6A 5AKZA 4CQMD 4BLSA 4EF6A 2JZNA 4HH3C 1V11B 2PE5A 3KL4A 4J3FA 2NACA 1G9XA 3L05A 3KV1A 1E2MA 1OFIA 1P18A 3PHJA 5B3AA 5FEMA 2TRSB 4BLOA 1VYUA 2VUTA 3AERA 4LTMA 3PWKA 4PX3A 4XGKA 1WVIA 4X8MA 1NRXA 4EH1A 3I9JA 2ZIUB 4GSYA 4CEJB 1JV2B 4PLWA 2HA3A 3ON5A 1NDHA 3FYUB 2DHEA 3MWJA 4UMDA 1ADYA 5ALXA 4HEHA 4CDRA 3KOZA 3CVVA 4ILEA 1QYVA 3SG0A 1U0BB 5IDXA 5JJBA 3L18A 1HZZA 3O26A 3GLFB 3HKDB 2IHTA 5H4HA 4GU5A 4TWAA 4KIUA 4Q01A 4OUDB 3KKKA 4QYXA 3RFVA 1ANKA 3O1LA 4YJHA 2O4CA 3H6KA 2ZUTA 3ZBTA 2UUAB 1PJLA 2FUNB 4ZJZA 3AVTA 1VP3A 5EINA 1Z36A 4LNUA 1L4EA 1UF9A 3UJ9A 1RPJA 2D5AA 1NBAA 3I2IA 1PTKA 3GFBA 3INYA 3NNNA 4JOBA 4WZAA 1O2DA 2J59A 3A6FA 3C16C 4L85A 2HHJA 3NH9A 3FGZA 5CNKA 5DIFA 1COZA 1SD2A 3PDCA 1FTWA 3WQRA 5KTKA 5E6RB 2V55B 4ZREA 1B2RA 5IVPA 5CA1F 3BF8A 5SYMA 2CBGA 5JRJA 1I7QB 2HF9A 2ZJ1A 4FYYA 3O2QB 4HXYA 1SXJB 5AXBA 2IPOA 3GY0A 3J80A 1XAIA 2R5WA 5AKHA 4DREA 4ENTA 1L4NA 1V37A 2QENA 2ZR9A 3SZMA 5DXAA 1YTUA 4AB1A 1R0YA 4KHPB 1AKTA 3DMPA 3H8WA 4AU1A 3AJEA 3A3NA 5I9TA 4ZVTA 3G9XA 2AC7A 3MGCA 4LZJA 3JY6A 1X7HA 5ERGB 1C9KA 2EW8A 2G70A 4H7KA 3DFIA 3LMKA 1MW9X 1X8XA 1VIDA 1REQB 2JEYA 5DM4A 3SLGA 4UM9D 3LHFA 4ABTA 1O0CA 1YXMA 4IJ5A 3NV7A 3CX4A 3SE0A 3T52A 2G5CA 3T3GA 1PDVA 1YDHA 4DLKA 2JAXA 4O2LA 1SUWA 1UXHA 1C9MA 1OLOA 1XD2A 5J2TF 2EGHA 1MDFA 2W9XA 4MWDA 5JYCA 1IIBA 4NU0A 1RJ9A 4S1TA 4BLWA 4F5WA 1T4CB 2X9NA 1RW4A 5LPNA 2WM2A 1HMPA 1BCSB 3CXRA 3TKLA 3ZWWA 1SUDA 4K6GA 2VT2A 1CEXA 3T38A 1W34A 2M32A 1FVOA 2CD9A 3REFA 3TVTA 2IT1A 2PX0A 4HDRB 4R5MA 1NRWA 2YN2A 2C4TA 2IP2A 1BDMA 4E6EA 1K6XA 3MAAC 4BV9A 4FQ5A 4MKZA 4B6RA 4ENVA 3LI2A 3GRYA 3B3JA 2UUPA 3L8DA 1D1TA 3MJHA 4KQJA 4LBWA 4PYLA 4RH3A 4KDRA 4UDOA 4E0BA 4A91A 2PH1A 3S8EA 4B3MB 1UXIA 2Q3LA 1C8KA 1Z2AA 2HHLA 4H6PA 5BUZA 4Y2GA 2WUGA 3A6ZA 1HOTA 1VM6A 1EXWA 4FN5A 4IDCA 2IP4A 5FBHA 3AY0A 4IV8A 3VAAA 3BMCB 1NQTA 1PV2A 4O4IF 4EG4A 1K68A 2ZJ7A 3SDZA 1GPAA 1L5MA 2GZDA 2IYUA 3AW9A 3H9EO 4RFLA 3UPUA 1DCTA 1LC0A 2F4NA 4QBKA 4O4HB 4ZANA 1K3FA 2DB3A 1T5IA 1VPTA 2VF4X 4PO9A 1E6WA 1SUFA 2NTYC 3WL8A 4YMSA 1XV5A 2BFDA 4D0LB 2AFHE 4Q3AA 6ABPA 4RFSB 3L1HA 1NXVA 2ET6A 2ZR7A 1D2CA 1SVIA 3C14C 4JYCA 4E30A 2IBTA 1YZ3A 2VR1A 4RV9A 3ZE8A 3KTFA 4ALIA 4MCJA 1PWXA 3S2UA 3D1LA 1SN7A 3F1LA 5DLDA 3J7AC 5AIAA 3NZEA 2C88A 1G6KA 1SQFA 2PS3A 4B4UA 3H2JA 2VLBA 3M6MD 4WNYA 4YP5A 3W1VA 4QIHA 1P1BA 1IRIA 1N6HA 2FQQA 1WY5A 1V5FA 2CK3A 4NEHB 4P4SB 4UQOA 2QMHA 1NF8A 5ANRB 1ADFA 1I5RA 4LDNA 1JMYA 2P3QA 3BWMA 2ZRMA 4L08A 4GE3A 3ZE7A 1YDFA 2P2YA 4DIMA 3EGDA 3KJNA 2TYSB 1X8KA 2PTGA 1QIFA 3MOIA 2RIRA 2YFQA 4IIDA 1T8PA 5EPEA 5H1YA 3RVOA 1IPFA 3C3DA 3S2ZA 1EDZA 4GKKB 1VJGA 3QPWA 2NV0A 1XMXA 5KCMA 4GT1A 3G02A 3CRW1 1G59A 4JI4B 2EVWX 1CUFA 4TTSA 3IEKA 3PDUA 2IHVA 5J1TB 3HGMA 4D41A 4KV7A 1KO8A 1LI4A 2QMZA 5T4BA 3AG6A 1YJAA 4AMVA 1RQGA 1W5SA 1Z88A 3D6JA 3SC6A 4UCWA 1E2KA 1XDGA 5EHQA 5HJ7A 4EVIA 2P2SA 3BKXA 1XEXA 4JU9A 4OP2A 3D2AA 3ETCA 1N9KA 4NIMA 1U1FA 4BV2A 3D1VA 3E9MA 1NJ1A 4HGZA 2WTMA 4F56A 3LPAA 3IEMA 3IPXA 4F2HA 1S89A 2DH5A 2V7VA 3DDOA 5ULLA 3ZX5A 2XXJA 4O4HF 2KE5A 3MT9A 5DRYA 3RBZA 4UU7A 3DHNA 2XCOA 3BMCA 2ZTLA 3ETEA 1BGXT 3MWLA 4HDMB 3ANXA 1PYGA 4TUYB 2ZZNA 5L3QB 2DPYA 2OORC 2XRMA 4Q7EA 1KEPA 4XH9B 1WZUA 1BWPA 5F7OA 3T34A 3VKWA 2PZAA 1E62A 3D7LA 3LWBA 2WTBA 3O8RA 1O6ZA 5BPHA 1KHHA 1RZUA 3QVLA 1BXKA 3E4CA 1DJLA 1XYGA 3C8HA 1L4UA 1ZOIA 2EW1A 2PGNA 4FOSA 5U4XA 3QOXA 4C06A 4D46A 4EEZA 2VQSA 1AMOA 2Y1WA 2X5OA 1BRTA 4J7UA 1R50A 5CCEA 2FZCA 3EFBA 3UUGA 1MIOB 4IXWA 3NP7A 5HZKA 2M1XA 3T7AA 5F3WB 5K2OA 3DTNA 2DOKA 4LV5B 3V6LA 3ANSA 2CZQA 5BQXA 5JAPA 4S1NA 1EUCA 5CRIA 3GJQA 4ALLA 4B8ZA 2VJDA 1DNPA 2QTWB 1N36B 2J31A 4M3NA 1EDBA 2FR0A 1L0BA 5ENDA 4R83A 2WU4A 1TKRA 3GMIA 3KAJA 4IR7A 4XYEA 3V5NA 5JH7B 3H05A 3G0HA 2Q6KA 5EJGA 4LY3A 4EVQA 3IAHA 1A4RA 3FPKA 3M5DA 5AYVA 5AOCA 3OT1A 1WUTA 1S8NA 2CXNA 2WILA 3H5IA