3IF8B

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
237
Chain Sequence
b'LFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHRIFFTNMVTCSQVHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 71
structure length 237
sequence length 252
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3if8B02
3.30.1040.30 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3if8B03
3IF8B
chains in the Genus database with same CATH superfamily
1NWMX 2BG9E 2QRXA 3RIAA 4DNDA 5HEHA 4IHJE 1PFOA 4KBMB 4Z91A 3G06A 1YD8G 3AEAA 4BJMA 5LGNB 3A8YC 1X79A 4U72A 4H9RC 5FXWA 3AE3A 3Q9DA 2CA5A 2CCQA 4OFZA 2YDSA 3UT5E 5JTGA 4TV9E 2W62A 4QHOA 2V7IA 2Q9QD 4TZ4C 3T8OA 4EIWA 1J5WA 5LMUT 3PU8A 3UFEA 5ABGA 4GK5E 4L5GA 4YJ3E 4Q25A 1SA0E 4AKRB 4H63H 4EV6A 2WP9A 4CI2B 3PUWF 5LHIB 2VURA 4AQYT 3UU8A 3CX6B 4B3ST 2H88A 2UU9T 4JI1T 2XQ7A 3CWZB 3MJXA 3EDUA 4WW0A 2WDRA 4DVDA 4DR3T 3T1HT 3PDYA 2J62A 3QUJA 5LBMA 4AKGA 2XM1A 3AVRA 3EDVA 2R6GF 2WMNA 5AQSB 1T8BA 4LF9T 4YY3T 4CZZB 1XWMA 4B3RT 3LK42 4UF0A 2KZ7B 1OEDE 1NEKA 5LNKA 2BBHA 2I0MA 4DV4T 4O2BE 2XQ3A 5AQNB 1HNZT 5FKYA 2Q9QC 3RH3A 2WU2A 5A1LA 3ZT5A 4QX7B 4X20E 2PTFA 4ANJA 3C4ZA 3PE0A 4CXWA 2BKOA 2H7VC 3VRAA 1OWAA 4LFCT 1LVFA 3TKLB 2VVSA 4ZI2D 3SOLA 4GK0E 4HN9A 5JDLA 3TLVA 2Y6XA 2DHRA 1D0YA 2F4VT 1MIYA 2YN6A 3NRXA 4UIGA 5AQKB 2W4XA 3LBXA 1JNRA 3RF1A 5LP6E 3FZMB 4JI7T 4C91A 3UQ7A 1FIOA 2JMHA 5M4YA 1T7SA 1O3XA 5CFBA 2X67A 3PUYF 3F31A 2LLYA 2HPJA 4YJ2E 3P50A 4YSYA 4IL4A 2WB5A 3HKDE 4A56A 4JBWF 3KV9A 2Q9QB 5AQTB 2VKHA 4OYKA 3MK7C 1US7B 3HI2A 2YDRA 4DR7T 4PK4A 4U31A 2KNDA 3BQLA 3NZPA 4WNKA 4BA9A 5LB7B 2V26A 4JI0T 3O4XE 4HE8A 5DJQC 4H9NC 3QB5A 3ZSSA 1D1BA 4EOZB 5EK2A 2RP4A 3C50A 3UU4A 1MMNA 4AQFA 1M7KA 2IMLA 3PJAJ 3ANWA 2DWGA 4TUYE 4ZI2C 1SUMB 1XMOT 3G2QA 3DP7A 4DR5T 1OEDC 3UU3A 3IA3A 1HF8A 1N33T 3RX6A 2CHNA 3P4WA 4PK6A 5KDMC 5AQUB 4ILCA 1QLBA 4X1IE 3U78A 3K8PC 5JH7E 2EHOA 2H3RA 3R6NA 2ZM2A 3KV5A 3PJVD 3NRYA 2QGSA 1YXRA 2X66A 5HYAA 3RC8A 2L9QA 3ETVA 4DV7T 3UU5A 4JLEA 2NP9A 3RI5A 5AFUL 2KSRA 2GK9A 3KVAA 2CWOA 5J0ZA 2QVAA 5J2UE 5L4HA 2CLYC 5FY7A 4QXCB 2VB6A 4WBOA 3MA9A 4NUVA 4NIQA 5CGMA 1KNPA 3ETUA 5JDFA 4CQIA 3I1AA 1OEDB 2DI4A 4HFEA 4DR2T 2WCAA 2V7MA 2BBJA 5AQVB 5KMGP 5CA0E 2A3DA 2W0GA 3AE2A 5ADXL 1KFYA 3H3AA 4DR1T 3DTOA 2Y8DA 2LKHA 2IC9A 2N9DA 4FJOA 3ZMUB 3ZC1A 3QC9A 4EXTA 2WDQA 2WMOA 4IE7A 2ACXA 2V6YB 4G63A 1LKXA 3RYFE 3KINB 4BJNA 3LSVA 4DV2T 5CJ5A 2VQET 3RC3A 3BQIA 2FUPA 2HH7A 5AQJB 1N34T 2CLYB 2W2UA 5JVDE 4WZXA 4KI0F 3ZSTA 3ZPOA 1MMAA 5AQFB 3PUVF 4X5TA 3RKGA 1WCRA 2LRKA 5FNVE 1HG5A 5HEUA 4ZI7E 3OYXA 4DO0A 5AQRB 2JQQA 3OYZA 2X0HA 4DMWA 2UXBT 3RYCE 4FI5A 3OKQA 1BR4A 3FZLB 2FJDA 3AA7B 3ZC0A 4ZI3D 4LMLA 2ZM0A 3PUQA 5FL0A 3AEBA 4YSZA 4UVAB 2VKOA 2XQYA 1CHUA 2B76A 3AECA 2IUBA 4CN6A 3G2OA 4U74A 2YKSA 5HXHA 3IBPA 1S3RA 4KHZF 2LRLA 4JI3T 1WR0A 4PK5A 3RRWA 3P8CD 1GQEA 2V1DB 4QKNA 4TWHA 4B3TT 2V5CA 2P9BA 3JC6C 4CI3B 3RQUA 3HVNA 2NW8A 1XMQT 2LKGA 2D5UA 4A97A 3SS1A 3PURA 2XQAA 4J2CA 5C2TA 1QSDA 5EK4A 2ZMAA 1D1AA 3RGLA 2FJEA 4AISA 2LSGA 3AEFA 5LHGB 3O1JA 1UURA 1HTJF 2YOEA 3CMLA 3E08A 5L3CB 4ZI3C 1UX5A 4U3CA 3LDQB 2XQ6A 1H7CA 3LK3B 2OLTA 2KWHA 4JV5T 2W66A 4K0KT 3OVUA 2A2FX 5FP3A 2RPAA 4UXNB 2H7OA 1LVKA 3KVBA 2YDQA 2XQ4A 4QWNB 4DIDB 5LA6E 3QNUA 3TLWA 4BAYB 2C5IT 2X9WA 2C5KT 4EZ4A 3EI0A 4YHHT 5L3BB 3CPZA 2ODUA 3N9NA 4JI4T 2XY8B 3DJBA 3WAKA 4Z8XA 4NXNT 4LFAT 1WFDA 4IT4A 1L0VA 2VL8A 2A9UA 3E22E 1ZP0A 4LF7T 3PUXF 2Q9QA 3EHZA 3AXJB 5HEGA 3GN5B 2L3LA 3PUAA 2ZM6T 2H89A 3KV6A 5DQVA 4H9SE 2HPLA 3ONJA 3JAFA 5JDNA 2ABZC 4YFSA 4DV3T 3PUGA 3N9LA 5F5WA 1D0XA 4LF4T 5ABFB 1WYBA 4XZCA 1FMVA 3K3QC 2BVMA 3AEDA 5AQHB 4ZZCA 3RYIE 3ZN1B 2UXDT 3QOFA 2E9XD 2PBIA 1UCUA 3C4XA 3AVSA 3N9PA 5EZYE 2LSIA 2WS3A 2W63A 5GONE 2KWIB 4ASKA 1IBKT 4A5XA 3MACA 3PUSA 5IWAT 4PJJA 4I4TE 5ETWA 3Q5DA 1BR1A 2DWKA 4C90A 3G2PA 4HFIA 4AKLA 3P4PA 4ADZA 2JIWA 4TX5A 2M6IA 4LMJA 4CN1A 2QA7A 2BG9C 2CMRA 4N78D 4O2AE 4HWHA 4PW8A 1VCSA 4EEBA 1Y64B 2WM9A 3AAIA 3JCFA 2MAWA 2NTXA 4LMKA 4F6RC 2V7KA 4ZHQE 2JRKA 3ZMSB 1I94T 1MMDA 3LK2B 2VK9A 3CK6A 5IHYA 2D9DA 2BS2A 3P4RA 1OEDA 1ZV4X 4HWCA 4JI6T 5JRCB 4AI6A 4HKAA 2JQ9A 3N9OA 4G2AA 3MZKB 3E0ZA 4E7SA 3FZFB 4DV1T 2XSAA 5ABHA 3EUHA 5IUXA 4I43B 2LE8A 3A7MA 3CQFA 4ILAA 3L39A 2FJBA 3N2GE 2N1GA 2XQ9A 3UUXB 1YW0A 4MALA 4KX6A 3PTRB 2CBJA 3GA8A 3BQKA 2WY2A 5HXRA 2BG9B 3V5UA 4TWFA 4GYSA 3FBZA 2Y48B 2V6YA 4HTEA 2VQFT 4AKIA 5L2LA 4PAGA 3ZMTB 2XHEB 4IDOA 3BK9A 1WRDA 3Q5EA 4DV6T 3CX8B 2G0UA 1YKEB 4A98A 2D0TA 4OX9T 2OA5A 3MXZA 2LJLA 2UUBT 2KT9A 3AA6B 2LSJA 2ES0A 5DABA 3FHNA 2E9XB 3AA0B 5L4EA 2UXCT 5ABEA 1YQ4A 4WYVA 2CWYA 3O9XA 3ZEFB 5LGUB 5AQPB 2CBIA 3RHWA 2K9AA 4EEDA 4IGUA 3EABA 3UU6A 3Q5XA 4DV0T 2KXPB 4DBQA 3HL6A 3UUBA 4PJLA 2SPCA 2I59A 1KNRA 3AE7A 1G8XA 4KP3C 2WU5A 3FZHB 4X65T 4MFRA 4JUYA 5C3JA 2JMKA 3RQWA 3A5XA 3ZJ1A 4X66T 3I0OA 2XZEA 3ZT7A 4X1KE 1FJGT 3K3NA 4ISTA 2XAQB 2NWBA 5HCJA 4GKKT 1W9RA 4ZS2A 4ZZBA 3VKGA 5DQWA 2E5VA 3K1SA 3ZMZB 3AA1B 4MHCA 4U2ZA 5JREA 2IW5B 4WBNE 3O1HA 1T98A 1VCTA 2DL1A 3L3PA 2K5BB 3ZT6A 3ESLA 3CQCB 4O4JE 1U4QA 4JEUB 3ZYKA 1WYCA 1Y01A 2XQ5A 2E2AA 5HAXA 3OPCA 1XNRT 2YK0A 1YQ3A 1QUUA 2WWVA 5BMVE 5FY0A 4IL9A 4M1PA 5LG3A 1WLXA 3VRBA 5JDQA 3LG7A 3O1IA 4L9IA 4E7ZA 4QH4A 3R84B 4OYJA 4HWIB 3S4UA 5LJNA 5AQLB 4YTPA 3KV4A 3SWHA 2CXLA 4I0UA 2X9YA 2XAFB 2I6HA 3I9WA 2BKPA 3RRCA 5H6QB 1MMGA 5LGTB 5JDMA 5FY1A 2PJQA 2V6XA 3FB2A 3CQGB 2UUAT 5FVLA 4O4HE 3AXJA 2LHNA 2VASA 4TN7B 4PFOA 4B3MT 5H6RB 2NW9A 4IDZA 3ANWB 1W09A 2KINB 4IE4A 5LBQB 1HR0T 4UELA 4EB6E 5ABFA 4EZHA 4QH1A 2BVLA 3UQ4A 5BR8T 3AE6A 1J1JA 2BS3A 4UV8B 2N2NA 3H3MA 4MBQA 4AXPA 4P09A 3AE1A 3N2OA 4QH5A 5CB4E 2XTLA 2LSKA 4PJNA 4YTNA 3F57A 4YSXA 2CE7A 3GMIA 2IHR1 1HFAA 4AQGA 3ZCIA 4HSCX 3RLFF 2MOZA 1SHZC 2X0YA 1IJ6A 1ZFIA 3AEGA 3IEEA 5AQQB 3HKBE 4QXHB 4H9PC 1Z0PA 3ZCJA 4P0BA 4K0UA 5HWYA 3AAEB 1YKHB 2DCFA 4KUMB 3ZYMA 4H9OC 2WWUA 4CI1B 1DTDB 3N2KE 5JR9B 3V5SA 3SFEA 3RIUC 2HHHT 4QXBB 3N9MA 1UX4A 5JRCA 3EAMA 4X64T 3J9X1 5C8YE 2XJ7A 4HFHA 4HFCA 4ZEYA 5FL1A 1BR0A 3AAAB 1B7TA 5IYZE 4IDPA 2VVNA 2CM0A 4EYYR 4YTMA 3OBVE 5CA1E 2XSBA 3RKOA 2CXDA 3B57A 4TV8E 2L8KA 2ZLYA 4HFDA 2M67A 4GOUA 1ZHCA 4ILUA 4TWDA 5E0OA 5F3JA 2IC6A 2CRBA 5JQGE 5HEOA 2BS4A 2LHRA 2BG9A 1M3IA 1SE7A 4UV9B 3SFDA 3C51A 2HN2A 5FVKA 1N32T 1W0BA 1T72A 1D0ZA 1J5ET 5LG4A 1R8IA 3WI3A 4LF5T 4TNVA 1HX8A 2KLQA 3PV0F 3CIRA 4NXMT 2XAGB 2QYWA 3C64A 2CPTA 5HXSA 3JAEA 4V1Av 2WZIA 3CX7B 4XBFB 2E9XA 4EYUA 3U3IA 4U7YA 5KX5E 4ZS3A 4HFBA 3WAJA 3D0TA 1DTVA 1N36T 1BR2A 3RPUA 4ZOLE 2LT3A 2VL0A 4YHJA 3N9QA 4O4LE 1HG2A 4TNWA 5LHHB 2WQYA 3P4SA 3FBLA 2E8IA 4DUZT 2B1EA 4EGWA 3FXDB 3PJAA 1D1CA 4IE0A 3UUNA 4XAXB 4HEAA 3QB5K 1XDPA 2W00A 4CXYA 4IE5A 3ZYLA 4LFBT 1OXZA 1XDOA 4L0RA 3W15B 2UUCT 4PJMA 2VKDA 4Z90A 2C0SA 1XNQT 3VKHA 5L3EB 1ZFLA 1Z8UA 3AEEA 1VRBA 4UVBB 3KBTA 1LRZA 2V7LA 4AIUA 3KFWX 5HXEA 2A72A 2LEHA 4AKHA 2MPKA 2E9XC 2NW7A 4LF6T 4MLKA 2W61A 3M3ZB 2YEVC 3CKDA 2LSYA 5KXJA 1KNZA 4JEHB 4QX8B 2M6BA 3AE5A 1DU2A 1S35A 3Q5WA 5AQGB 3UUMA 5L3GB 4CXXA 3ZMVB 1NENA 2JJ9A 4HWDA 4BIKA 4HGAA 1HNWT 4IREA 2K24A 4GIWA 2K48A 3K3OA 4HFVA 2BKNA 2JQKA 5HWXA 2XM2A 3UULA 4IIJE 3UFGA 1S94A 5L47A 4NPPA 3HR0A 3RYHE 2C5JA 5AQMB 3EVYA 3VR8A 2FJAA 5JDHA 4GKJT 1MIVA 4DUYT 3CQXC 2FBWA 4KMCA 2AE9A 1W0AA 2X9XA 3VU7H 3OJAA 4YT0A 1KK7A 3C4WA 4H9QC 3HA4A 1JNZA 4PNIA 5LJMA 2RA1A 2X68A 1U5PA 4OK0A 2Z6EA 2D0UA 4IE6A 2WDVA 2V7JA 2LOPA 1M62A 2XUEA 2CEAA 3ZN0B 3F2EA 4F8HA 3MKDA 2CXFA 1HCIA 2EHOD 5LCYA 2XQ8A 1UK5A 2V8SV 4GYRA 2W67A 3M65A 3IF8B 5J2TE 3VR9A 3X1DA 4UF0B 2LM2A 2IIUA 3AE4A 1ZKEA 4U7IA 4IDQA 3NVOA 2JPFA 4I55E 1AJ3A 1HX1B 3QK6A 1I6ZA 3L09A 3G2MA 2WBLA 2OV9A 4LF8T 4O4IE 5FXZA 2YU1A 4PFPA 3NBXX 2AXDS 1E2AA 5L3DB 2NOXA 2XAHB 2X51A 5AQOB 4UEMA 2WAUA 4HWFA 4AQFC 5FXXA 1XZYA 4DR6T 3LJCA 3AE9A 1ZEEA 1E1HB 3HKCE 1KF6A 5JR9A 1FEWA 4U33A 4UR9A 3H37A 3LBXB 3RIFA 3KDSE 2E5LT 2PG8A 2YU2A 3ONXA 5F8PA 1ZOYA 3I9YA 1X9BA 2XAJB 1IAPA 5L3FB 3FZKB 4DV5T 5AQIB 4OHFA 2VWAA 2KMFA 2EHOC 1CUNA 1MNDA 2ZM8A 1IZNB 2NR4A 3L8RA 5HEJA 3AE8A 2IAKA 2MYSA 4UVCB 1FMWA 5FMNA 2XASB 3P7IA 3OTOT 5LMNT 3P4QA 4H63V 4JYAT 4P1NA 3PU3A 3TLTA 2DNXA 3JC6D 3SRZA 5EK3A 1MIWA 2J4GA 1V9DA 4EAHA 3GN5A 3JADA 1E7PA 4CN4A 3TLUA 2YINA 3RIUA 3TLSA 4X62T 4KHPT 2XPKA 1HS7A 5JR9C 3NZQA 4I50E 2J1DG 5JDGA 5J1GA 2X0LB 2BDEA 2ACZA 2HN1A 2MBGA 4YXDA 3NWIA 2WSSV 2BZBA 5FXVA 2K3WA 4ILBA 1UGOA 2DLRA 2EHOB 4JI5T 4U2YA 1MNEA 2MTQA 2IDOB 3C98B 1KEYA 2D2SA 2LM9A 3UTKA 5LOVE 1VOMA 1WR6A 2LOSA 1IBMT 3ONLC 4NUUA 1NAFA 5FYMA 3FXEB 3GWHA 3I0QA 4O8SA 3AB3B 4IDNA 4DMVA 2JQHA 3Q2MA 2X9HA 2NTYA 4JI8T 2CHOA 4X1YE 2ODVA 1M3JA 3N5LA 4DR4T 5HXCA 4ERRA 4JI2T 4ISSA 2UXXB 2J47A 2UXNB 3ABVA 1G73A 3KBUA 4ZXLA 3ZKRA 5LYJE 4P0AA 2V5DA 3J7Yq 4B6XA 3PUZF 4YLHA 3T1YT 5LXTE 3HKEE 3VHLA 1UUSA 4COFA 3IHRA 4DBRA 3LFMA 5HCMA 3CVRA 2PFVA 3B13A 1EZ3A 5TAOA 3NKZA 2VKJA 3ZJ2A 3ZLIA 3B5MA 1HNXT 1IBLT 1IJ5A 2WZHA
chains in the Genus database with same CATH topology
1NWMX 4L0RA 3ZPOA 1MMAA 3Q5XA 4DNDA 3W15B 4IHJE 1PFOA 4PJMA 4KBMB 2VKDA 1YD8G 2C0SA 5FNVE 1HG5A 2KXPB 3VKHA 4ZI7E 5L3EB 3OYXA 4DBQA 4DO0A 3HL6A 4BJMA 2JQQA 1VRBA 3OYZA 4PJLA 4UVBB 4DMWA 2SPCA 2I59A 1LRZA 3KBTA 5LGNB 3RYCE 4FI5A 2V7LA 1G8XA 3KFWX 3OKQA 4KP3C 5HXEA 1BR4A 1X79A 4U72A 3AA7B 3ZC0A 2A72A 2LEHA 4ZI3D 4H9RC 2ZM0A 3PUQA 4AKHA 4MFRA 4JUYA 2E9XC 5FXWA 4UVAB 2JMKA 2NW7A 2CA5A 2CCQA 2VKOA 3Q9DA 4MLKA 2W61A 2XQYA 3A5XA 4OFZA 3ZJ1A 2YEVC 3CKDA 3UT5E 2LSYA 3I0OA 4TV9E 4X1KE 2W62A 3K3NA 4QHOA 4ISTA 2XAQB 2V7IA 2NWBA 2Q9QD 4TZ4C 1KNZA 3G2OA 3T8OA 4EIWA 4ZS2A 3VKGA 4JEHB 4QX8B 4U74A 5HXHA 5DQWA 3PU8A 1S35A 3ZMZB 3UFEA 3AA1B 3Q5WA 4MHCA 5JREA 3UUMA 2IW5B 4GK5E 3IBPA 1S3RA 4WBNE 3O1HA 4L5GA 1T98A 4YJ3E 5L3GB 3L3PA 1SA0E 2K5BB 4AKRB 4CXXA 3ESLA 4H63H 3ZMVB 4PK5A 3CQCB 3RRWA 3P8CD 1U4QA 4JEUB 4O4JE 2JJ9A 3ZYKA 4BIKA 4CI2B 1WYCA 2V1DB 4HGAA 4QKNA 5LHIB 5HAXA 2P9BA 3JC6C 4CI3B 2K24A 2YK0A 4GIWA 2K48A 3K3OA 1QUUA 3HVNA 5BMVE 4HFVA 5FY0A 2NW8A 5HWXA 2D5UA 3CX6B 4M1PA 3SS1A 1WLXA 3PURA 4J2CA 5JDQA 3LG7A 3O1IA 3CWZB 1QSDA 3UULA 4L9IA 4IIJE 4E7ZA 3MJXA 5EK4A 2ZMAA 3EDUA 1D1AA 4WW0A 2LSGA 4DVDA 5LHGB 3R84B 3PDYA 4OYJA 1S94A 3O1JA 3QUJA 1HTJF 3S4UA 3HR0A 3RYHE 5LBMA 2C5JA 4AKGA 3EVYA 3CMLA 3AVRA 5LJNA 5JDHA 3EDVA 3E08A 1MIVA 5L3CB 3CQXC 2WMNA 3KV4A 3SWHA 2CXLA 4KMCA 4ZI3C 2X9XA 1UX5A 2X9YA 4CZZB 3VU7H 3OJAA 2XAFB 3I9WA 3RRCA 3LK42 5H6QB 1KK7A 1MMGA 1H7CA 3C4WA 3LK3B 4UF0A 2KZ7B 5LGTB 5JDMA 5FY1A 2KWHA 5LNKA 4H9QC 3HA4A 2PJQA 3FB2A 4O2BE 4PNIA 3CQGB 2A2FX 5FP3A 5LJMA 2Q9QC 2RA1A 2X68A 1U5PA 4OK0A 2Z6EA 2D0UA 4IE6A 4UXNB 3RH3A 2H7OA 1LVKA 2V7JA 5A1LA 4O4HE 2LOPA 3KVBA 4QWNB 4QX7B 2XUEA 2CEAA 5LA6E 3ZN0B 2LHNA 2VASA 4X20E 4TN7B 3F2EA 4ANJA 3MKDA 2CXFA 4BAYB 3C4ZA 4PFOA 5H6RB 1HCIA 2C5IT 2EHOD 5LCYA 2X9WA 2C5KT 3PE0A 4GYRA 4CXWA 4EZ4A 2NW9A 2H7VC 3M65A 4IDZA 3ANWB 1OWAA 3IF8B 5L3BB 1LVFA 3CPZA 2KINB 2ODUA 3N9NA 3TKLB 5J2TE 4IE4A 4ZI2D 3SOLA 4UF0B 5LBQB 3DJBA 4GK0E 4HN9A 5JDLA 3WAKA 4Z8XA 2Y6XA 4UELA 1ZKEA 2DHRA 1D0YA 4EB6E 1MIYA 4EZHA 3NRXA 2VL8A 4UIGA 3E22E 2BVLA 2Q9QA 3LBXA 2JPFA 4I55E 1AJ3A 4UV8B 2N2NA 3QK6A 5LP6E 4MBQA 3L09A 4AXPA 3GN5B 2WBLA 2L3LA 3N2OA 3PUAA 4P09A 3G2MA 4C91A 4O4IE 5DQVA 2YU1A 3KV6A 4PFPA 5FXZA 4H9SE 1FIOA 3NBXX 2JMHA 5CB4E 2HPLA 2XTLA 1O3XA 2LSKA 4PJNA 5M4YA 5JDNA 5L3DB 4YFSA 2X67A 2XAHB 2NOXA 2X51A 3F57A 3F31A 3PUGA 4UEMA 2HPJA 2WAUA 4AQFC 5FXXA 3N9LA 4YJ2E 1D0XA 2CE7A 3GMIA 3LJCA 1HFAA 3HKDE 4AQGA 1ZEEA 3ZCIA 1WYBA 4A56A 1E1HB 4HSCX 3HKCE 4XZCA 5JR9A 1FEWA 1FMVA 2MOZA 1SHZC 3H37A 3K3QC 3KV9A 2Q9QB 1IJ6A 3LBXB 2BVMA 3KDSE 2VKHA 3RYIE 3IEEA 3ZN1B 2PG8A 2E9XD 2YU2A 4OYKA 3MK7C 3HKBE 1US7B 2PBIA 3HI2A 3ONXA 5F8PA 4QXHB 4H9PC 1Z0PA 3ZCJA 4PK4A 4P0BA 1UCUA 3C4XA 2KNDA 3AVSA 3I9YA 3N9PA 3BQLA 2XAJB 3NZPA 5EZYE 1IAPA 5L3FB 2LSIA 4WNKA 4BA9A 2W63A 2V26A 5GONE 2KWIB 3O4XE 4K0UA 4HE8A 5HWYA 4ASKA 5DJQC 3AAEB 4H9NC 4OHFA 3MACA 3PUSA 1D1BA 1YKHB 4EOZB 4PJJA 2DCFA 2VWAA 4I4TE 5ETWA 5EK2A 2KMFA 2RP4A 2EHOC 1CUNA 1MNDA 2ZM8A 1BR1A 1IZNB 3C50A 1MMNA 4KUMB 4AQFA 2DWKA 3ZYMA 4H9OC 4C90A 3ANWA 2WWUA 4CI1B 3G2PA 2DWGA 4TUYE 4AKLA 2IAKA 4ADZA 3N2KE 5JR9B 2MYSA 4UVCB 3V5SA 1FMWA 4ZI2C 3G2QA 4TX5A 5FMNA 2XASB 3DP7A 4QXBB 3N9MA 1UX4A 2QA7A 3P7IA 2CMRA 4N78D 4H63V 5JRCA 3J9X1 4O2AE 3PU3A 5C8YE 2DNXA 3JC6D 1HF8A 4PW8A 1Y64B 3SRZA 2WM9A 3AAIA 3RX6A 5EK3A 1MIWA 1BR0A 3AAAB 1V9DA 4EAHA 1B7TA 2NTXA 5IYZE 3GN5A 4PK6A 4F6RC 5KDMC 2CM0A 4EYYR 2V7KA 4ZHQE 3OBVE 5CA1E 4X1IE 3U78A 2JRKA 3K8PC 5JH7E 2EHOA 3RKOA 2CXDA 3B57A 2H3RA 4TV8E 2L8KA 3ZMSB 1MMDA 2ZLYA 2YINA 3LK2B 2M67A 3R6NA 4GOUA 1ZHCA 2ZM2A 3KV5A 4ILUA 2VK9A 5E0OA 5IHYA 3PJVD 5F3JA 2IC6A 3NRYA 5JQGE 2QGSA 1HS7A 5JR9C 2LHRA 1ZV4X 2X66A 5HYAA 3NZQA 3RC8A 5JRCB 2L9QA 3ETVA 4AI6A 1M3IA 4I50E 2J1DG 4HKAA 3N9OA 4JLEA 5JDGA 2NP9A 3MZKB 4G2AA 3E0ZA 5AFUL 4E7SA 2GK9A 3KVAA 4UV9B 5J1GA 2CWOA 2X0LB 2BDEA 3C51A 2MBGA 2WSSV 2BZBA 3EUHA 5FXVA 4I43B 2LE8A 5J2UE 2CLYC 5FY7A 4QXCB 3CQFA 2DLRA 2EHOB 2VB6A 3N2GE 1MNEA 2MTQA 4WBOA 1D0ZA 2N1GA 3C98B 2D2SA 2LM9A 3UUXB 1YW0A 4MALA 3MA9A 4NUVA 3PTRB 3UTKA 5LOVE 3GA8A 1VOMA 3BQKA 1WR6A 2LOSA 5LG4A 3WI3A 4NUUA 1NAFA 5FYMA 3ETUA 3FXEB 3GWHA 1HX8A 5JDFA 4CQIA 3I1AA 5HXRA 2KLQA 2DI4A 3I0QA 3V5UA 4O8SA 4GYSA 3AB3B 3FBZA 2XAGB 3C64A 2Y48B 4DMVA 5HXSA 4V1Av 3CX7B 3Q2MA 2V7MA 4HTEA 2X9HA 4XBFB 2NTYA 5KMGP 2E9XA 5CA0E 4AKIA 4X1YE 4EYUA 5L2LA 2ODVA 3U3IA 4PAGA 1M3JA 3ZMTB 3N5LA 2A3DA 5KX5E 2W0GA 5ADXL 2XHEB 5HXCA 4ERRA 4ZS3A 3BK9A 1WRDA 3WAJA 3H3AA 3D0TA 4ISSA 3CX8B 1BR2A 2G0UA 3DTOA 4ZOLE 3RPUA 1YKEB 2Y8DA 2UXXB 2LT3A 4YHJA 3N9QA 4O4LE 1HG2A 2IC9A 2UXNB 5LHHB 1G73A 3KBUA 5LYJE 4P0AA 2N9DA 4FJOA 3ZMUB 3FBLA 2D0TA 3J7Yq 4B6XA 2OA5A 3ZC1A 3QC9A 4EXTA 2E8IA 2B1EA 4YLHA 3MXZA 2LJLA 2WMOA 5LXTE 4IE7A 3FXDB 3HKEE 3VHLA 2KT9A 3AA6B 2LSJA 3IHRA 4DBRA 2ACXA 2ES0A 5DABA 3FHNA 1D1CA 4G63A 1LKXA 3LFMA 4IE0A 3RYFE 3KINB 2E9XB 4BJNA 3AA0B 3CVRA 2PFVA 3UUNA 4XAXB 3B13A 4HEAA 3RC3A 1EZ3A 2CWYA 3BQIA 5TAOA 3O9XA 2HH7A 3ZEFB 2W00A 2VKJA 3ZJ2A 3ZLIA 5LGUB 2CLYB 1IJ5A 4CXYA 4IE5A 2K9AA 3ZYLA 5JVDE 4IGUA 1OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 B; 
#chains in the Genus database with same CATH topology
 1NWM X;  2BG9 E;  2QRX A;  3RIA A;  4DND A;  5HEH A;  4IHJ E;  1PFO A;  4KBM B;  4Z91 A;  3G06 A;  1YD8 G;  3AEA A;  4BJM A;  5LGN B;  3A8Y C;  1X79 A;  4U72 A;  4H9R C;  5FXW A;  3AE3 A;  3Q9D A;  2CA5 A;  2CCQ A;  4OFZ A;  2YDS A;  3UT5 E;  5JTG A;  4TV9 E;  2W62 A;  4QHO A;  2V7I A;  2Q9Q D;  4TZ4 C;  3T8O A;  4EIW A;  1J5W A;  5LMU T;  3PU8 A;  3UFE A;  5ABG A;  4GK5 E;  4L5G A;  4YJ3 E;  4Q25 A;  1SA0 E;  4AKR B;  4H63 H;  4EV6 A;  2WP9 A;  4CI2 B;  3PUW F;  5LHI B;  2VUR A;  4AQY T;  3UU8 A;  3CX6 B;  4B3S T;  2H88 A;  2UU9 T;  4JI1 T;  2XQ7 A;  3CWZ B;  3MJX A;  3EDU A;  4WW0 A;  2WDR A;  4DVD A;  4DR3 T;  3T1H T;  3PDY A;  2J62 A;  3QUJ A;  5LBM A;  4AKG A;  2XM1 A;  3AVR A;  3EDV A;  2R6G F;  2WMN A;  5AQS B;  1T8B A;  4LF9 T;  4YY3 T;  4CZZ B;  1XWM A;  4B3R T;  3LK4 2;  4UF0 A;  2KZ7 B;  1OED E;  1NEK A;  5LNK A;  2BBH A;  2I0M A;  4DV4 T;  4O2B E;  2XQ3 A;  5AQN B;  1HNZ T;  5FKY A;  2Q9Q C;  3RH3 A;  2WU2 A;  5A1L A;  3ZT5 A;  4QX7 B;  4X20 E;  2PTF A;  4ANJ A;  3C4Z A;  3PE0 A;  4CXW A;  2BKO A;  2H7V C;  3VRA A;  1OWA A;  4LFC T;  1LVF A;  3TKL B;  2VVS A;  4ZI2 D;  3SOL A;  4GK0 E;  4HN9 A;  5JDL A;  3TLV A;  2Y6X A;  2DHR A;  1D0Y A;  2F4V T;  1MIY A;  2YN6 A;  3NRX A;  4UIG A;  5AQK B;  2W4X A;  3LBX A;  1JNR A;  3RF1 A;  5LP6 E;  3FZM B;  4JI7 T;  4C91 A;  3UQ7 A;  1FIO A;  2JMH A;  5M4Y A;  1T7S A;  1O3X A;  5CFB A;  2X67 A;  3PUY F;  3F31 A;  2LLY A;  2HPJ A;  4YJ2 E;  3P50 A;  4YSY A;  4IL4 A;  2WB5 A;  3HKD E;  4A56 A;  4JBW F;  3KV9 A;  2Q9Q B;  5AQT B;  2VKH A;  4OYK A;  3MK7 C;  1US7 B;  3HI2 A;  2YDR A;  4DR7 T;  4PK4 A;  4U31 A;  2KND A;  3BQL A;  3NZP A;  4WNK A;  4BA9 A;  5LB7 B;  2V26 A;  4JI0 T;  3O4X E;  4HE8 A;  5DJQ C;  4H9N C;  3QB5 A;  3ZSS A;  1D1B A;  4EOZ B;  5EK2 A;  2RP4 A;  3C50 A;  3UU4 A;  1MMN A;  4AQF A;  1M7K A;  2IML A;  3PJA J;  3ANW A;  2DWG A;  4TUY E;  4ZI2 C;  1SUM B;  1XMO T;  3G2Q A;  3DP7 A;  4DR5 T;  1OED C;  3UU3 A;  3IA3 A;  1HF8 A;  1N33 T;  3RX6 A;  2CHN A;  3P4W A;  4PK6 A;  5KDM C;  5AQU B;  4ILC A;  1QLB A;  4X1I E;  3U78 A;  3K8P C;  5JH7 E;  2EHO A;  2H3R A;  3R6N A;  2ZM2 A;  3KV5 A;  3PJV D;  3NRY A;  2QGS A;  1YXR A;  2X66 A;  5HYA A;  3RC8 A;  2L9Q A;  3ETV A;  4DV7 T;  3UU5 A;  4JLE A;  2NP9 A;  3RI5 A;  5AFU L;  2KSR A;  2GK9 A;  3KVA A;  2CWO A;  5J0Z A;  2QVA A;  5J2U E;  5L4H A;  2CLY C;  5FY7 A;  4QXC B;  2VB6 A;  4WBO A;  3MA9 A;  4NUV A;  4NIQ A;  5CGM A;  1KNP A;  3ETU A;  5JDF A;  4CQI A;  3I1A A;  1OED B;  2DI4 A;  4HFE A;  4DR2 T;  2WCA A;  2V7M A;  2BBJ A;  5AQV B;  5KMG P;  5CA0 E;  2A3D A;  2W0G A;  3AE2 A;  5ADX L;  1KFY A;  3H3A A;  4DR1 T;  3DTO A;  2Y8D A;  2LKH A;  2IC9 A;  2N9D A;  4FJO A;  3ZMU B;  3ZC1 A;  3QC9 A;  4EXT A;  2WDQ A;  2WMO A;  4IE7 A;  2ACX A;  2V6Y B;  4G63 A;  1LKX A;  3RYF E;  3KIN B;  4BJN A;  3LSV A;  4DV2 T;  5CJ5 A;  2VQE T;  3RC3 A;  3BQI A;  2FUP A;  2HH7 A;  5AQJ B;  1N34 T;  2CLY B;  2W2U A;  5JVD E;  4WZX A;  4KI0 F;  3ZST A;  3ZPO A;  1MMA A;  5AQF B;  3PUV F;  4X5T A;  3RKG A;  1WCR A;  2LRK A;  5FNV E;  1HG5 A;  5HEU A;  4ZI7 E;  3OYX A;  4DO0 A;  5AQR B;  2JQQ A;  3OYZ A;  2X0H A;  4DMW A;  2UXB T;  3RYC E;  4FI5 A;  3OKQ A;  1BR4 A;  3FZL B;  2FJD A;  3AA7 B;  3ZC0 A;  4ZI3 D;  4LML A;  2ZM0 A;  3PUQ A;  5FL0 A;  3AEB A;  4YSZ A;  4UVA B;  2VKO A;  2XQY A;  1CHU A;  2B76 A;  3AEC A;  2IUB A;  4CN6 A;  3G2O A;  4U74 A;  2YKS A;  5HXH A;  3IBP A;  1S3R A;  4KHZ F;  2LRL A;  4JI3 T;  1WR0 A;  4PK5 A;  3RRW A;  3P8C D;  1GQE A;  2V1D B;  4QKN A;  4TWH A;  4B3T T;  2V5C A;  2P9B A;  3JC6 C;  4CI3 B;  3RQU A;  3HVN A;  2NW8 A;  1XMQ T;  2LKG A;  2D5U A;  4A97 A;  3SS1 A;  3PUR A;  2XQA A;  4J2C A;  5C2T A;  1QSD A;  5EK4 A;  2ZMA A;  1D1A A;  3RGL A;  2FJE A;  4AIS A;  2LSG A;  3AEF A;  5LHG B;  3O1J A;  1UUR A;  1HTJ F;  2YOE A;  3CML A;  3E08 A;  5L3C B;  4ZI3 C;  1UX5 A;  4U3C A;  3LDQ B;  2XQ6 A;  1H7C A;  3LK3 B;  2OLT A;  2KWH A;  4JV5 T;  2W66 A;  4K0K T;  3OVU A;  2A2F X;  5FP3 A;  2RPA A;  4UXN B;  2H7O A;  1LVK A;  3KVB A;  2YDQ A;  2XQ4 A;  4QWN B;  4DID B;  5LA6 E;  3QNU A;  3TLW A;  4BAY B;  2C5I T;  2X9W A;  2C5K T;  4EZ4 A;  3EI0 A;  4YHH T;  5L3B B;  3CPZ A;  2ODU A;  3N9N A;  4JI4 T;  2XY8 B;  3DJB A;  3WAK A;  4Z8X A;  4NXN T;  4LFA T;  1WFD A;  4IT4 A;  1L0V A;  2VL8 A;  2A9U A;  3E22 E;  1ZP0 A;  4LF7 T;  3PUX F;  2Q9Q A;  3EHZ A;  3AXJ B;  5HEG A;  3GN5 B;  2L3L A;  3PUA A;  2ZM6 T;  2H89 A;  3KV6 A;  5DQV A;  4H9S E;  2HPL A;  3ONJ A;  3JAF A;  5JDN A;  2ABZ C;  4YFS A;  4DV3 T;  3PUG A;  3N9L A;  5F5W A;  1D0X A;  4LF4 T;  5ABF B;  1WYB A;  4XZC A;  1FMV A;  3K3Q C;  2BVM A;  3AED A;  5AQH B;  4ZZC A;  3RYI E;  3ZN1 B;  2UXD T;  3QOF A;  2E9X D;  2PBI A;  1UCU A;  3C4X A;  3AVS A;  3N9P A;  5EZY E;  2LSI A;  2WS3 A;  2W63 A;  5GON E;  2KWI B;  4ASK A;  1IBK T;  4A5X A;  3MAC A;  3PUS A;  5IWA T;  4PJJ A;  4I4T E;  5ETW A;  3Q5D A;  1BR1 A;  2DWK A;  4C90 A;  3G2P A;  4HFI A;  4AKL A;  3P4P A;  4ADZ A;  2JIW A;  4TX5 A;  2M6I A;  4LMJ A;  4CN1 A;  2QA7 A;  2BG9 C;  2CMR A;  4N78 D;  4O2A E;  4HWH A;  4PW8 A;  1VCS A;  4EEB A;  1Y64 B;  2WM9 A;  3AAI A;  3JCF A;  2MAW A;  2NTX A;  4LMK A;  4F6R C;  2V7K A;  4ZHQ E;  2JRK A;  3ZMS B;  1I94 T;  1MMD A;  3LK2 B;  2VK9 A;  3CK6 A;  5IHY A;  2D9D A;  2BS2 A;  3P4R A;  1OED A;  1ZV4 X;  4HWC A;  4JI6 T;  5JRC B;  4AI6 A;  4HKA A;  2JQ9 A;  3N9O A;  4G2A A;  3MZK B;  3E0Z A;  4E7S A;  3FZF B;  4DV1 T;  2XSA A;  5ABH A;  3EUH A;  5IUX A;  4I43 B;  2LE8 A;  3A7M A;  3CQF A;  4ILA A;  3L39 A;  2FJB A;  3N2G E;  2N1G A;  2XQ9 A;  3UUX B;  1YW0 A;  4MAL A;  4KX6 A;  3PTR B;  2CBJ A;  3GA8 A;  3BQK A;  2WY2 A;  5HXR A;  2BG9 B;  3V5U A;  4TWF A;  4GYS A;  3FBZ A;  2Y48 B;  2V6Y A;  4HTE A;  2VQF T;  4AKI A;  5L2L A;  4PAG A;  3ZMT B;  2XHE B;  4IDO A;  3BK9 A;  1WRD A;  3Q5E A;  4DV6 T;  3CX8 B;  2G0U A;  1YKE B;  4A98 A;  2D0T A;  4OX9 T;  2OA5 A;  3MXZ A;  2LJL A;  2UUB T;  2KT9 A;  3AA6 B;  2LSJ A;  2ES0 A;  5DAB A;  3FHN A;  2E9X B;  3AA0 B;  5L4E A;  2UXC T;  5ABE A;  1YQ4 A;  4WYV A;  2CWY A;  3O9X A;  3ZEF B;  5LGU B;  5AQP B;  2CBI A;  3RHW A;  2K9A A;  4EED A;  4IGU A;  3EAB A;  3UU6 A;  3Q5X A;  4DV0 T;  2KXP B;  4DBQ A;  3HL6 A;  3UUB A;  4PJL A;  2SPC A;  2I59 A;  1KNR A;  3AE7 A;  1G8X A;  4KP3 C;  2WU5 A;  3FZH B;  4X65 T;  4MFR A;  4JUY A;  5C3J A;  2JMK A;  3RQW A;  3A5X A;  3ZJ1 A;  4X66 T;  3I0O A;  2XZE A;  3ZT7 A;  4X1K E;  1FJG T;  3K3N A;  4IST A;  2XAQ B;  2NWB A;  5HCJ A;  4GKK T;  1W9R A;  4ZS2 A;  4ZZB A;  3VKG A;  5DQW A;  2E5V A;  3K1S A;  3ZMZ B;  3AA1 B;  4MHC A;  4U2Z A;  5JRE A;  2IW5 B;  4WBN E;  3O1H A;  1T98 A;  1VCT A;  2DL1 A;  3L3P A;  2K5B B;  3ZT6 A;  3ESL A;  3CQC B;  4O4J E;  1U4Q A;  4JEU B;  3ZYK A;  1WYC A;  1Y01 A;  2XQ5 A;  2E2A A;  5HAX A;  3OPC A;  1XNR T;  2YK0 A;  1YQ3 A;  1QUU A;  2WWV A;  5BMV E;  5FY0 A;  4IL9 A;  4M1P A;  5LG3 A;  1WLX A;  3VRB A;  5JDQ A;  3LG7 A;  3O1I A;  4L9I A;  4E7Z A;  4QH4 A;  3R84 B;  4OYJ A;  4HWI B;  3S4U A;  5LJN A;  5AQL B;  4YTP A;  3KV4 A;  3SWH A;  2CXL A;  4I0U A;  2X9Y A;  2XAF B;  2I6H A;  3I9W A;  2BKP A;  3RRC A;  5H6Q B;  1MMG A;  5LGT B;  5JDM A;  5FY1 A;  2PJQ A;  2V6X A;  3FB2 A;  3CQG B;  2UUA T;  5FVL A;  4O4H E;  3AXJ A;  2LHN A;  2VAS A;  4TN7 B;  4PFO A;  4B3M T;  5H6R B;  2NW9 A;  4IDZ A;  3ANW B;  1W09 A;  2KIN B;  4IE4 A;  5LBQ B;  1HR0 T;  4UEL A;  4EB6 E;  5ABF A;  4EZH A;  4QH1 A;  2BVL A;  3UQ4 A;  5BR8 T;  3AE6 A;  1J1J A;  2BS3 A;  4UV8 B;  2N2N A;  3H3M A;  4MBQ A;  4AXP A;  4P09 A;  3AE1 A;  3N2O A;  4QH5 A;  5CB4 E;  2XTL A;  2LSK A;  4PJN A;  4YTN A;  3F57 A;  4YSX A;  2CE7 A;  3GMI A;  2IHR 1;  1HFA A;  4AQG A;  3ZCI A;  4HSC X;  3RLF F;  2MOZ A;  1SHZ C;  2X0Y A;  1IJ6 A;  1ZFI A;  3AEG A;  3IEE A;  5AQQ B;  3HKB E;  4QXH B;  4H9P C;  1Z0P A;  3ZCJ A;  4P0B A;  4K0U A;  5HWY A;  3AAE B;  1YKH B;  2DCF A;  4KUM B;  3ZYM A;  4H9O C;  2WWU A;  4CI1 B;  1DTD B;  3N2K E;  5JR9 B;  3V5S A;  3SFE A;  3RIU C;  2HHH T;  4QXB B;  3N9M A;  1UX4 A;  5JRC A;  3EAM A;  4X64 T;  3J9X 1;  5C8Y E;  2XJ7 A;  4HFH A;  4HFC A;  4ZEY A;  5FL1 A;  1BR0 A;  3AAA B;  1B7T A;  5IYZ E;  4IDP A;  2VVN A;  2CM0 A;  4EYY R;  4YTM A;  3OBV E;  5CA1 E;  2XSB A;  3RKO A;  2CXD A;  3B57 A;  4TV8 E;  2L8K A;  2ZLY A;  4HFD A;  2M67 A;  4GOU A;  1ZHC A;  4ILU A;  4TWD A;  5E0O A;  5F3J A;  2IC6 A;  2CRB A;  5JQG E;  5HEO A;  2BS4 A;  2LHR A;  2BG9 A;  1M3I A;  1SE7 A;  4UV9 B;  3SFD A;  3C51 A;  2HN2 A;  5FVK A;  1N32 T;  1W0B A;  1T72 A;  1D0Z A;  1J5E T;  5LG4 A;  1R8I A;  3WI3 A;  4LF5 T;  4TNV A;  1HX8 A;  2KLQ A;  3PV0 F;  3CIR A;  4NXM T;  2XAG B;  2QYW A;  3C64 A;  2CPT A;  5HXS A;  3JAE A;  4V1A v;  2WZI A;  3CX7 B;  4XBF B;  2E9X A;  4EYU A;  3U3I A;  4U7Y A;  5KX5 E;  4ZS3 A;  4HFB A;  3WAJ A;  3D0T A;  1DTV A;  1N36 T;  1BR2 A;  3RPU A;  4ZOL E;  2LT3 A;  2VL0 A;  4YHJ A;  3N9Q A;  4O4L E;  1HG2 A;  4TNW A;  5LHH B;  2WQY A;  3P4S A;  3FBL A;  2E8I A;  4DUZ T;  2B1E A;  4EGW A;  3FXD B;  3PJA A;  1D1C A;  4IE0 A;  3UUN A;  4XAX B;  4HEA A;  3QB5 K;  1XDP A;  2W00 A;  4CXY A;  4IE5 A;  3ZYL A;  4LFB T;  1OXZ A;  1XDO A;  4L0R A;  3W15 B;  2UUC T;  4PJM A;  2VKD A;  4Z90 A;  2C0S A;  1XNQ T;  3VKH A;  5L3E B;  1ZFL A;  1Z8U A;  3AEE A;  1VRB A;  4UVB B;  3KBT A;  1LRZ A;  2V7L A;  4AIU A;  3KFW X;  5HXE A;  2A72 A;  2LEH A;  4AKH A;  2MPK A;  2E9X C;  2NW7 A;  4LF6 T;  4MLK A;  2W61 A;  3M3Z B;  2YEV C;  3CKD A;  2LSY A;  5KXJ A;  1KNZ A;  4JEH B;  4QX8 B;  2M6B A;  3AE5 A;  1DU2 A;  1S35 A;  3Q5W A;  5AQG B;  3UUM A;  5L3G B;  4CXX A;  3ZMV B;  1NEN A;  2JJ9 A;  4HWD A;  4BIK A;  4HGA A;  1HNW T;  4IRE A;  2K24 A;  4GIW A;  2K48 A;  3K3O A;  4HFV A;  2BKN A;  2JQK A;  5HWX A;  2XM2 A;  3UUL A;  4IIJ E;  3UFG A;  1S94 A;  5L47 A;  4NPP A;  3HR0 A;  3RYH E;  2C5J A;  5AQM B;  3EVY A;  3VR8 A;  2FJA A;  5JDH A;  4GKJ T;  1MIV A;  4DUY T;  3CQX C;  2FBW A;  4KMC A;  2AE9 A;  1W0A A;  2X9X A;  3VU7 H;  3OJA A;  4YT0 A;  1KK7 A;  3C4W A;  4H9Q C;  3HA4 A;  1JNZ A;  4PNI A;  5LJM A;  2RA1 A;  2X68 A;  1U5P A;  4OK0 A;  2Z6E A;  2D0U A;  4IE6 A;  2WDV A;  2V7J A;  2LOP A;  1M62 A;  2XUE A;  2CEA A;  3ZN0 B;  3F2E A;  4F8H A;  3MKD A;  2CXF A;  1HCI A;  2EHO D;  5LCY A;  2XQ8 A;  1UK5 A;  2V8S V;  4GYR A;  2W67 A;  3M65 A;  3IF8 B;  5J2T E;  3VR9 A;  3X1D A;  4UF0 B;  2LM2 A;  2IIU A;  3AE4 A;  1ZKE A;  4U7I A;  4IDQ A;  3NVO A;  2JPF A;  4I55 E;  1AJ3 A;  1HX1 B;  3QK6 A;  1I6Z A;  3L09 A;  3G2M A;  2WBL A;  2OV9 A;  4LF8 T;  4O4I E;  5FXZ A;  2YU1 A;  4PFP A;  3NBX X;  2AXD S;  1E2A A;  5L3D B;  2NOX A;  2XAH B;  2X51 A;  5AQO B;  4UEM A;  2WAU A;  4HWF A;  4AQF C;  5FXX A;  1XZY A;  4DR6 T;  3LJC A;  3AE9 A;  1ZEE A;  1E1H B;  3HKC E;  1KF6 A;  5JR9 A;  1FEW A;  4U33 A;  4UR9 A;  3H37 A;  3LBX B;  3RIF A;  3KDS E;  2E5L T;  2PG8 A;  2YU2 A;  3ONX A;  5F8P A;  1ZOY A;  3I9Y A;  1X9B A;  2XAJ B;  1IAP A;  5L3F B;  3FZK B;  4DV5 T;  5AQI B;  4OHF A;  2VWA A;  2KMF A;  2EHO C;  1CUN A;  1MND A;  2ZM8 A;  1IZN B;  2NR4 A;  3L8R A;  5HEJ A;  3AE8 A;  2IAK A;  2MYS A;  4UVC B;  1FMW A;  5FMN A;  2XAS B;  3P7I A;  3OTO T;  5LMN T;  3P4Q A;  4H63 V;  4JYA T;  4P1N A;  3PU3 A;  3TLT A;  2DNX A;  3JC6 D;  3SRZ A;  5EK3 A;  1MIW A;  2J4G A;  1V9D A;  4EAH A;  3GN5 A;  3JAD A;  1E7P A;  4CN4 A;  3TLU A;  2YIN A;  3RIU A;  3TLS A;  4X62 T;  4KHP T;  2XPK A;  1HS7 A;  5JR9 C;  3NZQ A;  4I50 E;  2J1D G;  5JDG A;  5J1G A;  2X0L B;  2BDE A;  2ACZ A;  2HN1 A;  2MBG A;  4YXD A;  3NWI A;  2WSS V;  2BZB A;  5FXV A;  2K3W A;  4ILB A;  1UGO A;  2DLR A;  2EHO B;  4JI5 T;  4U2Y A;  1MNE A;  2MTQ A;  2IDO B;  3C98 B;  1KEY A;  2D2S A;  2LM9 A;  3UTK A;  5LOV E;  1VOM A;  1WR6 A;  2LOS A;  1IBM T;  3ONL C;  4NUU A;  1NAF A;  5FYM A;  3FXE B;  3GWH A;  3I0Q A;  4O8S A;  3AB3 B;  4IDN A;  4DMV A;  2JQH A;  3Q2M A;  2X9H A;  2NTY A;  4JI8 T;  2CHO A;  4X1Y E;  2ODV A;  1M3J A;  3N5L A;  4DR4 T;  5HXC A;  4ERR A;  4JI2 T;  4ISS A;  2UXX B;  2J47 A;  2UXN B;  3ABV A;  1G73 A;  3KBU A;  4ZXL A;  3ZKR A;  5LYJ E;  4P0A A;  2V5D A;  3J7Y q;  4B6X A;  3PUZ F;  4YLH A;  3T1Y T;  5LXT E;  3HKE E;  3VHL A;  1UUS A;  4COF A;  3IHR A;  4DBR A;  3LFM A;  5HCM A;  3CVR A;  2PFV A;  3B13 A;  1EZ3 A;  5TAO A;  3NKZ A;  2VKJ A;  3ZJ2 A;  3ZLI A;  3B5M A;  1HNX T;  1IBL T;  1IJ5 A;  2WZH A; 
#chains in the Genus database with same CATH homology
 1NWM X;  4L0R A;  3ZPO A;  1MMA A;  3Q5X A;  4DND A;  3W15 B;  4IHJ E;  1PFO A;  4PJM A;  4KBM B;  2VKD A;  1YD8 G;  2C0S A;  5FNV E;  1HG5 A;  2KXP B;  3VKH A;  4ZI7 E;  5L3E B;  3OYX A;  4DBQ A;  4DO0 A;  3HL6 A;  4BJM A;  2JQQ A;  1VRB A;  3OYZ A;  4PJL A;  4UVB B;  4DMW A;  2SPC A;  2I59 A;  1LRZ A;  3KBT A;  5LGN B;  3RYC E;  4FI5 A;  2V7L A;  1G8X A;  3KFW X;  3OKQ A;  4KP3 C;  5HXE A;  1BR4 A;  1X79 A;  4U72 A;  3AA7 B;  3ZC0 A;  2A72 A;  2LEH A;  4ZI3 D;  4H9R C;  2ZM0 A;  3PUQ A;  4AKH A;  4MFR A;  4JUY A;  2E9X C;  5FXW A;  4UVA B;  2JMK A;  2NW7 A;  2CA5 A;  2CCQ A;  2VKO A;  3Q9D A;  4MLK A;  2W61 A;  2XQY A;  3A5X A;  4OFZ A;  3ZJ1 A;  2YEV C;  3CKD A;  3UT5 E;  2LSY A;  3I0O A;  4TV9 E;  4X1K E;  2W62 A;  3K3N A;  4QHO A;  4IST A;  2XAQ B;  2V7I A;  2NWB A;  2Q9Q D;  4TZ4 C;  1KNZ A;  3G2O A;  3T8O A;  4EIW A;  4ZS2 A;  3VKG A;  4JEH B;  4QX8 B;  4U74 A;  5HXH A;  5DQW A;  3PU8 A;  1S35 A;  3ZMZ B;  3UFE A;  3AA1 B;  3Q5W A;  4MHC A;  5JRE A;  3UUM A;  2IW5 B;  4GK5 E;  3IBP A;  1S3R A;  4WBN E;  3O1H A;  4L5G A;  1T98 A;  4YJ3 E;  5L3G B;  3L3P A;  1SA0 E;  2K5B B;  4AKR B;  4CXX A;  3ESL A;  4H63 H;  3ZMV B;  4PK5 A;  3CQC B;  3RRW A;  3P8C D;  1U4Q A;  4JEU B;  4O4J E;  2JJ9 A;  3ZYK A;  4BIK A;  4CI2 B;  1WYC A;  2V1D B;  4HGA A;  4QKN A;  5LHI B;  5HAX A;  2P9B A;  3JC6 C;  4CI3 B;  2K24 A;  2YK0 A;  4GIW A;  2K48 A;  3K3O A;  1QUU A;  3HVN A;  5BMV E;  4HFV A;  5FY0 A;  2NW8 A;  5HWX A;  2D5U A;  3CX6 B;  4M1P A;  3SS1 A;  1WLX A;  3PUR A;  4J2C A;  5JDQ A;  3LG7 A;  3O1I A;  3CWZ B;  1QSD A;  3UUL A;  4L9I A;  4IIJ E;  4E7Z A;  3MJX A;  5EK4 A;  2ZMA A;  3EDU A;  1D1A A;  4WW0 A;  2LSG A;  4DVD A;  5LHG B;  3R84 B;  3PDY A;  4OYJ A;  1S94 A;  3O1J A;  3QUJ A;  1HTJ F;  3S4U A;  3HR0 A;  3RYH E;  5LBM A;  2C5J A;  4AKG A;  3EVY A;  3CML A;  3AVR A;  5LJN A;  5JDH A;  3EDV A;  3E08 A;  1MIV A;  5L3C B;  3CQX C;  2WMN A;  3KV4 A;  3SWH A;  2CXL A;  4KMC A;  4ZI3 C;  2X9X A;  1UX5 A;  2X9Y A;  4CZZ B;  3VU7 H;  3OJA A;  2XAF B;  3I9W A;  3RRC A;  3LK4 2;  5H6Q B;  1KK7 A;  1MMG A;  1H7C A;  3C4W A;  3LK3 B;  4UF0 A;  2KZ7 B;  5LGT B;  5JDM A;  5FY1 A;  2KWH A;  5LNK A;  4H9Q C;  3HA4 A;  2PJQ A;  3FB2 A;  4O2B E;  4PNI A;  3CQG B;  2A2F X;  5FP3 A;  5LJM A;  2Q9Q C;  2RA1 A;  2X68 A;  1U5P A;  4OK0 A;  2Z6E A;  2D0U A;  4IE6 A;  4UXN B;  3RH3 A;  2H7O A;  1LVK A;  2V7J A;  5A1L A;  4O4H E;  2LOP A;  3KVB A;  4QWN B;  4QX7 B;  2XUE A;  2CEA A;  5LA6 E;  3ZN0 B;  2LHN A;  2VAS A;  4X20 E;  4TN7 B;  3F2E A;  4ANJ A;  3MKD A;  2CXF A;  4BAY B;  3C4Z A;  4PFO A;  5H6R B;  1HCI A;  2C5I T;  2EHO D;  5LCY A;  2X9W A;  2C5K T;  3PE0 A;  4GYR A;  4CXW A;  4EZ4 A;  2NW9 A;  2H7V C;  3M65 A;  4IDZ A;  3ANW B;  1OWA A;  3IF8 B;  5L3B B;  1LVF A;  3CPZ A;  2KIN B;  2ODU A;  3N9N A;  3TKL B;  5J2T E;  4IE4 A;  4ZI2 D;  3SOL A;  4UF0 B;  5LBQ B;  3DJB A;  4GK0 E;  4HN9 A;  5JDL A;  3WAK A;  4Z8X A;  2Y6X A;  4UEL A;  1ZKE A;  2DHR A;  1D0Y A;  4EB6 E;  1MIY A;  4EZH A;  3NRX A;  2VL8 A;  4UIG A;  3E22 E;  2BVL A;  2Q9Q A;  3LBX A;  2JPF A;  4I55 E;  1AJ3 A;  4UV8 B;  2N2N A;  3QK6 A;  5LP6 E;  4MBQ A;  3L09 A;  4AXP A;  3GN5 B;  2WBL A;  2L3L A;  3N2O A;  3PUA A;  4P09 A;  3G2M A;  4C91 A;  4O4I E;  5DQV A;  2YU1 A;  3KV6 A;  4PFP A;  5FXZ A;  4H9S E;  1FIO A;  3NBX X;  2JMH A;  5CB4 E;  2HPL A;  2XTL A;  1O3X A;  2LSK A;  4PJN A;  5M4Y A;  5JDN A;  5L3D B;  4YFS A;  2X67 A;  2XAH B;  2NOX A;  2X51 A;  3F57 A;  3F31 A;  3PUG A;  4UEM A;  2HPJ A;  2WAU A;  4AQF C;  5FXX A;  3N9L A;  4YJ2 E;  1D0X A;  2CE7 A;  3GMI A;  3LJC A;  1HFA A;  3HKD E;  4AQG A;  1ZEE A;  3ZCI A;  1WYB A;  4A56 A;  1E1H B;  4HSC X;  3HKC E;  4XZC A;  5JR9 A;  1FEW A;  1FMV A;  2MOZ A;  1SHZ C;  3H37 A;  3K3Q C;  3KV9 A;  2Q9Q B;  1IJ6 A;  3LBX B;  2BVM A;  3KDS E;  2VKH A;  3RYI E;  3IEE A;  3ZN1 B;  2PG8 A;  2E9X D;  2YU2 A;  4OYK A;  3MK7 C;  3HKB E;  1US7 B;  2PBI A;  3HI2 A;  3ONX A;  5F8P A;  4QXH B;  4H9P C;  1Z0P A;  3ZCJ A;  4PK4 A;  4P0B A;  1UCU A;  3C4X A;  2KND A;  3AVS A;  3I9Y A;  3N9P A;  3BQL A;  2XAJ B;  3NZP A;  5EZY E;  1IAP A;  5L3F B;  2LSI A;  4WNK A;  4BA9 A;  2W63 A;  2V26 A;  5GON E;  2KWI B;  3O4X E;  4K0U A;  4HE8 A;  5HWY A;  4ASK A;  5DJQ C;  3AAE B;  4H9N C;  4OHF A;  3MAC A;  3PUS A;  1D1B A;  1YKH B;  4EOZ B;  4PJJ A;  2DCF A;  2VWA A;  4I4T E;  5ETW A;  5EK2 A;  2KMF A;  2RP4 A;  2EHO C;  1CUN A;  1MND A;  2ZM8 A;  1BR1 A;  1IZN B;  3C50 A;  1MMN A;  4KUM B;  4AQF A;  2DWK A;  3ZYM A;  4H9O C;  4C90 A;  3ANW A;  2WWU A;  4CI1 B;  3G2P A;  2DWG A;  4TUY E;  4AKL A;  2IAK A;  4ADZ A;  3N2K E;  5JR9 B;  2MYS A;  4UVC B;  3V5S A;  1FMW A;  4ZI2 C;  3G2Q A;  4TX5 A;  5FMN A;  2XAS B;  3DP7 A;  4QXB B;  3N9M A;  1UX4 A;  2QA7 A;  3P7I A;  2CMR A;  4N78 D;  4H63 V;  5JRC A;  3J9X 1;  4O2A E;  3PU3 A;  5C8Y E;  2DNX A;  3JC6 D;  1HF8 A;  4PW8 A;  1Y64 B;  3SRZ A;  2WM9 A;  3AAI A;  3RX6 A;  5EK3 A;  1MIW A;  1BR0 A;  3AAA B;  1V9D A;  4EAH A;  1B7T A;  2NTX A;  5IYZ E;  3GN5 A;  4PK6 A;  4F6R C;  5KDM C;  2CM0 A;  4EYY R;  2V7K A;  4ZHQ E;  3OBV E;  5CA1 E;  4X1I E;  3U78 A;  2JRK A;  3K8P C;  5JH7 E;  2EHO A;  3RKO A;  2CXD A;  3B57 A;  2H3R A;  4TV8 E;  2L8K A;  3ZMS B;  1MMD A;  2ZLY A;  2YIN A;  3LK2 B;  2M67 A;  3R6N A;  4GOU A;  1ZHC A;  2ZM2 A;  3KV5 A;  4ILU A;  2VK9 A;  5E0O A;  5IHY A;  3PJV D;  5F3J A;  2IC6 A;  3NRY A;  5JQG E;  2QGS A;  1HS7 A;  5JR9 C;  2LHR A;  1ZV4 X;  2X66 A;  5HYA A;  3NZQ A;  3RC8 A;  5JRC B;  2L9Q A;  3ETV A;  4AI6 A;  1M3I A;  4I50 E;  2J1D G;  4HKA A;  3N9O A;  4JLE A;  5JDG A;  2NP9 A;  3MZK B;  4G2A A;  3E0Z A;  5AFU L;  4E7S A;  2GK9 A;  3KVA A;  4UV9 B;  5J1G A;  2CWO A;  2X0L B;  2BDE A;  3C51 A;  2MBG A;  2WSS V;  2BZB A;  3EUH A;  5FXV A;  4I43 B;  2LE8 A;  5J2U E;  2CLY C;  5FY7 A;  4QXC B;  3CQF A;  2DLR A;  2EHO B;  2VB6 A;  3N2G E;  1MNE A;  2MTQ A;  4WBO A;  1D0Z A;  2N1G A;  3C98 B;  2D2S A;  2LM9 A;  3UUX B;  1YW0 A;  4MAL A;  3MA9 A;  4NUV A;  3PTR B;  3UTK A;  5LOV E;  3GA8 A;  1VOM A;  3BQK A;  1WR6 A;  2LOS A;  5LG4 A;  3WI3 A;  4NUU A;  1NAF A;  5FYM A;  3ETU A;  3FXE B;  3GWH A;  1HX8 A;  5JDF A;  4CQI A;  3I1A A;  5HXR A;  2KLQ A;  2DI4 A;  3I0Q A;  3V5U A;  4O8S A;  4GYS A;  3AB3 B;  3FBZ A;  2XAG B;  3C64 A;  2Y48 B;  4DMV A;  5HXS A;  4V1A v;  3CX7 B;  3Q2M A;  2V7M A;  4HTE A;  2X9H A;  4XBF B;  2NTY A;  5KMG P;  2E9X A;  5CA0 E;  4AKI A;  4X1Y E;  4EYU A;  5L2L A;  2ODV A;  3U3I A;  4PAG A;  1M3J A;  3ZMT B;  3N5L A;  2A3D A;  5KX5 E;  2W0G A;  5ADX L;  2XHE B;  5HXC A;  4ERR A;  4ZS3 A;  3BK9 A;  1WRD A;  3WAJ A;  3H3A A;  3D0T A;  4ISS A;  3CX8 B;  1BR2 A;  2G0U A;  3DTO A;  4ZOL E;  3RPU A;  1YKE B;  2Y8D A;  2UXX B;  2LT3 A;  4YHJ A;  3N9Q A;  4O4L E;  1HG2 A;  2IC9 A;  2UXN B;  5LHH B;  1G73 A;  3KBU A;  5LYJ E;  4P0A A;  2N9D A;  4FJO A;  3ZMU B;  3FBL A;  2D0T A;  3J7Y q;  4B6X A;  2OA5 A;  3ZC1 A;  3QC9 A;  4EXT A;  2E8I A;  2B1E A;  4YLH A;  3MXZ A;  2LJL A;  2WMO A;  5LXT E;  4IE7 A;  3FXD B;  3HKE E;  3VHL A;  2KT9 A;  3AA6 B;  2LSJ A;  3IHR A;  4DBR A;  2ACX A;  2ES0 A;  5DAB A;  3FHN A;  1D1C A;  4G63 A;  1LKX A;  3LFM A;  4IE0 A;  3RYF E;  3KIN B;  2E9X B;  4BJN A;  3AA0 B;  3CVR A;  2PFV A;  3UUN A;  4XAX B;  3B13 A;  4HEA A;  3RC3 A;  1EZ3 A;  2CWY A;  3BQI A;  5TAO A;  3O9X A;  2HH7 A;  3ZEF B;  2W00 A;  2VKJ A;  3ZJ2 A;  3ZLI A;  5LGU B;  2CLY B;  1IJ5 A;  4CXY A;  4IE5 A;  2K9A A;  3ZYL A;  5JVD E;  4IGU A;  1OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...