3IF8B

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
237
Chain Sequence
LFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHRIFFTNMVTCSQVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 237
sequence length 252
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3if8B02
3.30.1040.30 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3if8B03
3IF8B
chains in the Genus database with same CATH superfamily
1OEDB 4HWCA 3EAMA 2CM0A 3C98B 3A5XA 4EXTA 2ODVA 3F2EA 1FEWA 4ERRA 3RIFA 5KX5E 3VR9A 2H7OA 5HXCA 4ZI2D 4X66T 3JAEA 3N9NA 3EVYA 2A72A 3CX8B 5J0ZA 3AAEB 4X64T 4WZXA 4Z90A 3PE0A 3R6NA 4YSZA 2VB6A 5JTGA 4I4TE 4NXNT 3QK6A 4DBQA 3CKDA 3BQKA 5J2UE 4HN9A 4V1Av 2M6BA 2V6YA 1MIWA 2UXCT 2LT3A 5HCMA 5L47A 5AQSB 4K0UA 1J5ET 5LJNA 4ZI7E 1ZHCA 4EIWA 4GK5E 1HNWT 2W4XA 5AQQB 2VURA 3Q5EA 1YKEB 2LSIA 5F8PA 2ZM6T 2RA1A 4LFBT 3HKDE 3S4UA 3RC3A 4EOZB 3C64A 3N2GE 5LGUB 4AQYT 3KDSE 1YQ4A 2BG9E 5BMVE 2JJ9A 1SHZC 3IF8B 3B13A 2CHOA 4QX7B 4QX8B 4HFHA 4G2AA 2M6IA 1YQ3A 4KP3C 3HVNA 5HEOA 3BQLA 2IAKA 3CQGB 4ZI2C 3TLUA 4LF5T 2NR4A 5LGTB 3C51A 2LE8A 4OHFA 4IE0A 2H7VC 5HWXA 3AVSA 4HFDA 4WNKA 3PJAA 3K3QC 3PU8A 3UQ4A 3AEDA 3CVRA 4UF0A 2BS3A 2CXFA 4MBQA 1YW0A 5AQMB 3CIRA 2D5UA 2OA5A 5CB4E 2UUBT 3EDVA 3MXZA 1HCIA 2XQAA 1UUSA 3K3NA 1MMAA 2LOSA 1J5WA 2FJAA 3JC6C 2K9AA 1S35A 3ZT5A 4CI3B 2VKHA 2WY2A 1IZNB 1UX4A 5AQJB 3UU3A 4DV0T 4ZXLA 2W2UA 2CLYC 5HYAA 1HNXT 1M3JA 2IW5B 2XAJB 2Q9QD 2XAFB 1D1AA 2YDQA 4QH5A 4CN6A 3AA7B 4LF6T 3J7Yq 1O3XA 4AKRB 2EHOA 3ONJA 3Q9DA 2XHEB 3FHNA 2BS4A 2V6YB 2X0YA 2BDEA 1WR0A 2JQ9A 2V6XA 4G63A 1XMQT 4OK0A 4DMWA 4LFAT 1S94A 3MJXA 3MK7C 3RKGA 4P0AA 2V7LA 2CCQA 4NPPA 4DUYT 2WZIA 2Q9QC 2C5KT 5FVLA 3LDQB 2WBLA 2NTYA 4IHJE 3IHRA 5TAOA 5AQHB 5ADXL 4NXMT 4NUUA 4EB6E 3E0ZA 2J4GA 5AQPB 2DNXA 3O4XE 3AVRA 3LK2B 4YSYA 4U2YA 4H63V 3LSVA 5FL0A 1OEDC 2YOEA 4JI8T 5ABEA 3G2PA 2PTFA 2W63A 2MYSA 4TNVA 1MNDA 1LKXA 3FXDB 3PU3A 4QXCB 3HKBE 4F6RC 4DR2T 4JI0T 2LKGA 5FL1A 2CRBA 1HG5A 2G0UA 2BBJA 4GOUA 1N32T 1VCTA 4X5TA 5LYJE 5FY7A 4JLEA 1WYBA 4I43B 1WYCA 5FKYA 5HEJA 4HTEA 2BZBA 4OYJA 4EEDA 2KWIB 5JR9A 1UGOA 2XQ5A 3P8CD 1OWAA 2X9HA 2MOZA 5L3EB 1YXRA 4L9IA 4YTPA 2I0MA 5BR8T 1Y64B 3N5LA 4ZHQE 3RRWA 4UEMA 4DR3T 3ETUA 4YJ3E 4ISTA 5L3BB 4MLKA 3X1DA 4JI7T 3N9QA 4GIWA 1WFDA 4JI5T 3PUVF 5LA6E 2V1DB 2F4VT 3NBXX 3E22E 4EAHA 2NTXA 2FJDA 1HX8A 4OFZA 1NENA 5JDGA 1EZ3A 1HG2A 4IE6A 3PUSA 4YFSA 2HPJA 3NRYA 2GK9A 2X0LB 5CA1E 3C50A 5LBQB 3AA6B 3Q5XA 5L3GB 4ILCA 1G73A 4QH1A 3PDYA 4DV2T 4JUYA 4FJOA 3ANWA 4BA9A 2K48A 3FB2A 3AE2A 1QUUA 4H9OC 3MACA 2LOPA 2XPKA 5IWAT 1IJ5A 4GKKT 3SFDA 1E1HB 3RIUA 3DJBA 1MIVA 4WBNE 3ZLIA 1SA0E 2YINA 1CUNA 3G2OA 3N9MA 3SRZA 5JDFA 5LXTE 3UUNA 2XUEA 5HEGA 5AQVB 4Z91A 3C4ZA 4JYAT 2WMOA 2LRLA 4NIQA 3FZFB 4B3ST 3LJCA 5ABFB 4GYRA 5IHYA 3ZC0A 4TWDA 2DL1A 1MIYA 2K3WA 5LP6E 3I9WA 3RF1A 3ZSSA 1D1CA 3ZJ1A 1ZKEA 2LM2A 4IGUA 1M62A 4QXHB 4QXBB 2UUAT 3JADA 3O9XA 4L5GA 2C5IT 3TLVA 3HI2A 2IC6A 5DQWA 5LHHB 2L3LA 2PBIA 4TZ4C 1KF6A 4PJJA 3ABVA 4WYVA 2CXLA 2PJQA 2NOXA 4Z8XA 2NW9A 3P4RA 4KHPT 2D0TA 3LK42 1V9DA 1Y01A 3QB5K 4N78D 3ZYKA 4AQFA 3EI0A 3ZMZB 4JEHB 5LJMA 2LHRA 3AXJB 4PW8A 5JRCA 4QH4A 4ADZA 3UTKA 1S3RA 4IL9A 5FY0A 2AE9A 4HSCX 4YJ2E 4JI1T 1NWMX 4DV5T 3K1SA 3QOFA 4X1YE 4EYYR 4DVDA 4YT0A 2BKOA 3RYFE 4PJNA 2XQ3A 2VWAA 3AEFA 2ACZA 2CA5A 3CPZA 4IDZA 1FMVA 4IDQA 4UVBB 2X9YA 3PUWF 3UU4A 5HXRA 2H3RA 3LBXA 3ANWB 2IIUA 3W15B 5IUXA 3H3MA 3JC6D 3VHLA 4PFPA 4KUMB 2L9QA 2VKOA 2CE7A 1US7B 2ZM0A 2A9UA 1KNZA 1HTJF 3EDUA 4XAXB 3C4XA 3VR8A 2XM2A 3UU5A 1YD8G 4C90A 4JI3T 2XJ7A 2ES0A 4UV9B 4BIKA 5JH7E 4O4HE 3A8YC 3N2OA 2P9BA 4K0KT 4TN7B 2WDVA 3B57A 3M65A 2W66A 4FI5A 5H6RB 2ACXA 4DR4T 3P7IA 3KVBA 3KV4A 4DUZT 4H9SE 3T8OA 2Y8DA 3CK6A 4X20E 2YDRA 1BR0A 4QHOA 3ZCJA 4O4IE 5EK4A 1VOMA 3K3OA 5FXWA 3CQCB 1MMNA 2XQ9A 4ZZCA 5HEHA 5HEUA 1W9RA 4BJNA 1FJGT 1JNRA 4EEBA 1U5PA 1YKHB 1SUMB 4KX6A 4DR6T 4AISA 2BBHA 3H37A 2WU5A 2SPCA 2VVNA 2BG9A 2FJEA 4ILUA 5JVDE 2V7JA 4PK4A 4KHZF 3E08A 5HCJA 5AQRB 1N34T 3UUXB 1D1BA 3FBZA 2B1EA 2WMNA 3PUAA 3NRXA 4AKHA 2DCFA 1U4QA 4O4JE 3ESLA 2V5CA 3A7MA 5JRCB 4IIJE 2H88A 3RYCE 3LG7A 2MAWA 2WCAA 4GK0E 4B3RT 3AEBA 4KI0F 5AQGB 3CX7B 3OVUA 4H63H 1Z0PA 2AXDS 3PUGA 2XASB 1HF8A 2WU2A 1AJ3A 1M3IA 3BQIA 3SS1A 2WDQA 1BR1A 2CMRA 4O4LE 4DV3T 2LHNA 2C0SA 3GA8A 4JBWF 4LF4T 3G06A 5J1GA 1XWMA 1ZV4X 3LBXB 4EZ4A 3ZT7A 2YK0A 3OYXA 2JIWA 4EV6A 2VASA 2ODUA 4IDOA 3RIAA 2WQYA 2J62A 3TLWA 3CQXC 5L4HA 4HFEA 4U31A 5LG4A 4TNWA 1H7CA 3ZCIA 5JDNA 4GKJT 4LF7T 4PK5A 4HWDA 4L0RA 1UX5A 3PJAJ 2DHRA 4H9NC 1T7SA 2RPAA 5HXEA 1KFYA 2N1GA 1DTDB 2FUPA 3I9YA 3N2KE 1D0YA 2LLYA 1HNZT 5JR9C 4B3TT 5L4EA 4YTMA 5C8YE 2X68A 3VKGA 5FMNA 3UULA 5CFBA 5AQNB 3IEEA 1OEDE 4PAGA 2XY8B 2WDRA 5HXHA 5F3JA 3P4QA 2XZEA 3TKLB 3QB5A 4UF0B 5FXZA 2K24A 2CWYA 1NAFA 3T1YT 1OXZA 1XDOA 2JQHA 5FXVA 3AAIA 2QA7A 3ZN1B 4LMLA 1N36T 3HKCE 4ASKA 1DTVA 2V5DA 1WLXA 2MPKA 2BG9B 5A1LA 4J2CA 2LSJA 5AQUB 1HFAA 1ZEEA 2XSBA 3OYZA 1UK5A 4O2AE 2KWHA 2LSKA 5JDHA 4UV8B 1FIOA 4KBMB 1GQEA 1QSDA 3ZMVB 2XAGB 2I59A 2EHOB 2V8SV 3RYHE 1JNZA 2C5JA 5LB7B 2LJLA 4NUVA 1T8BA 4E7SA 5HWYA 1T72A 3GN5A 1IJ6A 3AE8A 2VK9A 4YTNA 5KMGP 3CX6B 4AI6A 2KZ7B 3RIUC 5LMNT 3KBUA 4EZHA 2H89A 4IDNA 2KMFA 4MHCA 2IHR1 5AQOB 1LVKA 5ETWA 4DNDA 1IAPA 4UR9A 3UUBA 4CXWA 3PUXF 1N33T 2LKHA 4TV9E 3PUZF 2HN1A 3AE9A 2UU9T 4Q25A 3RH3A 4JI6T 3RX6A 2WS3A 4CXYA 2IUBA 2XM1A 2JMHA 4A98A 4ZEYA 1HX1B 4AQGA 3VU7H 4AIUA 4HE8A 4IREA 4UIGA 4ILBA 3TLSA 3U78A 3WAKA 5ABGA 4B6XA 2HPLA 1ZOYA 1KK7A 3PUYF 2CBIA 2V7KA 3RQUA 2W0GA 2JQQA 4U7YA 4X1IE 3KV6A 2WAUA 3MKDA 3ZN0B 4AKIA 1W09A 3D0TA 4A97A 4B3MT 2E5LT 4UELA 2I6HA 2XQYA 3AEAA 3AB3B 3P4WA 3L8RA 2UXNB 4AQFC 5DJQC 4A56A 4OX9T 5EK3A 2WP9A 4U33A 3OTOT 4U7IA 2KT9A 2E5VA 4WW0A 4X1KE 3RLFF 2UXDT 4YLHA 4HFCA 1E2AA 4IE4A 1HR0T 3ZMTB 4DBRA 4HFVA 3AECA 5JR9B 3JAFA 3FZLB 3QC9A 3KFWX 2MTQA 3AE3A 4DIDB 3HL6A 1BR4A 3KV9A 4U3CA 3NZPA 3OKQA 3ZYMA 1ZFLA 3RHWA 3ZMSB 3PURA 2QGSA 3ONLC 2IC9A 3PJVD 1CHUA 4HWFA 2VKJA 3GN5B 3V5SA 2LRKA 4ILAA 3KINB 2X0HA 3WAJA 4F8HA 5L3CB 5H6QB 3ZKRA 2YU2A 2A2FX 5HAXA 2UXXB 5L3FB 3L39A 4CI1B 5IYZE 1T98A 2DLRA 5DQVA 3L3PA 3HA4A 4O2BE 3KBTA 4BJMA 5KXJA 2W61A 3F31A 3O1IA 3FZKB 2EHOD 4CXXA 5J2TE 3AEGA 5AFUL 5AQTB 2BS2A 4AKGA 5L3DB 2E9XA 2KSRA 2DWGA 4DV4T 3GWHA 3ZSTA 2XQ7A 2WZHA 3OJAA 3OPCA 2OLTA 3KVAA 4DMVA 3G2MA 3G2QA 2RP4A 4OYKA 2W67A 4HKAA 5AQLB 4YSXA 1WRDA 4TUYE 4LFCT 1XMOT 2WB5A 2HHHT 5FYMA 3ZT6A 3FZHB 4PJMA 2BG9C 3AEEA 1WR6A 1L0VA 1XNQT 2XTLA 2VL0A 4ANJA 1NEKA 4HWHA 4YHHT 4P0BA 4IT4A 2VL8A 1ZP0A 2CBJA 4HFBA 2EHOC 3RRCA 1W0BA 3Q5DA 2CXDA 5LNKA 4PK6A 3Q2MA 4UVCB 2LSGA 1MMGA 2D9DA 4I0UA 5LOVE 2BVLA 3UFEA 3ZC1A 2W00A 5C3JA 3I1AA 3U3IA 3N9OA 5LHGB 3ZPOA 5KDMC 1LRZA 4YY3T 1I6ZA 2VVSA 4HWIB 3UQ7A 2Y6XA 4DV1T 3AE5A 1X9BA 2XQ8A 2ZLYA 3JCFA 2JPFA 4P1NA 2XSAA 3F57A 3QNUA 2V7MA 3NKZA 5LMUT 3MZKB 1D0XA 3RI5A 5LBMA 1IBMT 3V5UA 1UCUA 3N9PA 3M3ZB 1VRBA 2NW8A 3AE7A 3DTOA 5CJ5A 1I94T 1XDPA 4IE7A 2YEVC 2YN6A 1SE7A 3WI3A 4ZZBA 3H3AA 4PFOA 4PNIA 2M67A 5CGMA 2CHNA 4AKLA 2KINB 4XBFB 2QYWA 2ZMAA 1XNRT 3AA1B 1BR2A 4ZS3A 5E0OA 3EABA 2DWKA 4HFIA 4GYSA 3L09A 3ZMUB 2J47A 1MMDA 3UU6A 3B5MA 2E8IA 3RKOA 3FZMB 2E9XB 2XQ6A 2WWVA 2BKPA 3RC8A 3EHZA 5CA0E 2NWBA 5FY1A 2J1DG 1X79A 1PFOA 2N9DA 1QLBA 1FMWA 3P4PA 4X62T 2E2AA 4DR7T 5FXXA 2MBGA 3AE6A 3AE1A 4IL4A 3SWHA 4PJLA 1G8XA 5FVKA 1IBKT 3ETVA 4YXDA 3KV5A 3PTRB 4WBOA 3NWIA 1M7KA 3I0OA 2X67A 1WCRA 3IA3A 4AXPA 3AAAB 2PG8A 5AQIB 5AQKB 1LVFA 4A5XA 4P09A 2KNDA 2LM9A 3HR0A 4X65T 2QRXA 4H9RC 2X66A 3VRBA 2LEHA 4DV7T 3J9X1 5JDMA 2IDOB 1VCSA 5HXSA 4ISSA 4HEAA 4ZI3D 1UURA 3NZQA 2Q9QA 3CQFA 5ABFA 2CPTA 2FBWA 4EGWA 5L2LA 2JQKA 4DR5T 4UXNB 1R8IA 3P50A 1J1JA 3C4WA 3DP7A 2B76A 3RYIE 3RQWA 3VKHA 2VKDA 2VQET 3IBPA 2BKNA 3CMLA 2X9WA 2X9XA 2Y48B 2IMLA 4MFRA 5EZYE 4E7ZA 2X51A 2JMKA 4COFA 5LGNB 3Q5WA 4I50E 2OV9A 1XZYA 3N9LA 4XZCA 5ABHA 4DR1T 2YU1A 1OEDA 2ZM8A 4DO0A 4LF8T 4QWNB 5F5WA 5FP3A 5JDQA 2D2SA 3TLTA 2VQFT 2LSYA 3SOLA 4LMJA 3RPUA 4O8SA 3AA0B 3AE4A 4JEUB 5M4YA 3AXJA 1KNRA 4ZI3C 3T1HT 4EYUA 5LG3A 3ZYLA 2NW7A 4ZOLE 2ZM2A 2V7IA 2UUCT 3ZEFB 2WM9A 3P4SA 4UVAB 2R6GF 2W62A 5JDLA 2CLYB 3UFGA 4DV6T 3NVOA 3BK9A 5FNVE 2CEAA 3ONXA 2XAHB 3UU8A 4CQIA 5LCYA 4YHJA 1DU2A 1ZFIA 4CN4A 3VRAA 2DI4A 5GONE 2KLQA 2KXPB 4U74A 4CZZB 4ZS2A 4I55E 4TX5A 4U2ZA 3UT5E 2D0UA 3R84B 1HS7A 4CI2B 3OBVE 1Z8UA 2Z6EA 5EK2A 4JI4T 4CN1A 2E9XD 5C2TA 2FJBA 2XQ4A 3FXEB 3GMIA 4H9PC 2HH7A 2YDSA 3O1HA 4IDPA 3LFMA 2WSSV 5JREA 4M1PA 3LK3B 2JRKA 2V26A 4TWFA 4BAYB 4JV5T 1KEYA 4KMCA 2NP9A 2CWOA 3K8PC 4MALA 1MNEA 2PFVA 2UXBT 1KNPA 4C91A 1E7PA 2Q9QB 3CWZB 4U72A 5LHIB 5AQFB 3I0QA 2WWUA 3RGLA 4LF9T 2N2NA 2BVMA 4IE5A 2A3DA 3PV0F 4HGAA 3ZJ2A 2YKSA 2L8KA 4H9QC 2K5BB 3PUQA 2HN2A 4JI2T 3HKEE 3EUHA 2XAQB 3SFEA 3UUMA 3MA9A 5JQGE 2QVAA 4QKNA 2E9XC 2ABZC 3QUJA 3FBLA 1D0ZA 4TV8E 4TWHA 4LMKA 1B7TA 1IBLT 1W0AA 3O1JA 5DABA
chains in the Genus database with same CATH topology
4PK6A 3I9YA 3N2KE 1D0YA 4IE6A 3PUSA 3Q2MA 2HPJA 4UVCB 4YFSA 3NRYA 2LSGA 2CM0A 3C98B 3A5XA 2GK9A 2X0LB 1MMGA 5CA1E 5LOVE 3C50A 5JR9C 4EXTA 2BVLA 5LBQB 5C8YE 2ODVA 2X68A 1FEWA 3AA6B 3F2EA 4ERRA 3Q5XA 3VKGA 5FMNA 3UFEA 3UULA 3ZC1A 5KX5E 5L3GB 1G73A 2W00A 2H7OA 3IEEA 3I1AA 3U3IA 4PAGA 5HXCA 4ZI2D 3PDYA 3N9NA 3EVYA 3N9OA 5LHGB 2A72A 3CX8B 4JUYA 3ZPOA 5HXHA 3AAEB 5KDMC 1LRZA 4FJOA 5F3JA 3TKLB 3PE0A 3ANWA 3R6NA 4UF0B 5FXZA 2K24A 4BA9A 2VB6A 2K48A 3FB2A 4I4TE 2Y6XA 1QUUA 3QK6A 4DBQA 4H9OC 2ZLYA 3MACA 3CKDA 3BQKA 5J2UE 2JPFA 2CWYA 4HN9A 4V1Av 1NAFA 3F57A 2LOPA 1IJ5A 1MIWA 1OXZA 2V7MA 2LT3A 5FXVA 3AAIA 2QA7A 1E1HB 3ZN1B 3MZKB 1D0XA 3DJBA 4K0UA 5LBMA 1MIVA 4WBNE 3HKCE 3V5UA 1UCUA 3N9PA 3ZLIA 4ASKA 4ZI7E 1ZHCA 5LJNA 1SA0E 2YINA 1CUNA 1VRBA 2NW8A 3DTOA 3G2OA 4EIWA 4GK5E 3N9MA 1WLXA 2YEVC 4IE7A 1YKEB 2LSIA 3SRZA 3WI3A 5JDFA 5LXTE 5F8PA 5A1LA 3UUNA 2RA1A 2XUEA 3HKDE 3H3AA 4J2CA 2LSJA 4PFOA 3S4UA 3RC3A 4PNIA 4EOZB 3C4ZA 2WMOA 3C64A 2M67A 3N2GE 5LGUB 1HFAA 1ZEEA 4AKLA 2KINB 4XBFB 3OYZA 3KDSE 2ZMAA 4O2AE 2KWHA 2LSKA 5BMVE 5JDHA 2JJ9A 3AA1B 3LJCA 4UV8B 1FIOA 1SHZC 1BR2A 4GYRA 4KBMB 3IF8B 4ZS3A 3B13A 5IHYA 5E0OA 3ZC0A 2DWKA 4GYSA 1QSDA 1MIYA 3L09A 4QX7B 3ZMUB 4QX8B 3ZMVB 4G2AA 1MMDA 2XAGB 2I59A 4KP3C 3HVNA 5LP6E 3BQLA 2EHOB 3I9WA 2E8IA 3RKOA 3RYHE 2IAKA 2C5JA 3CQGB 2E9XB 1D1CA 4ZI2C 3ZJ1A 1ZKEA 2LJLA 4NUVA 4E7SA 3RC8A 4IGUA 5CA0E 4QXHB 5HWYA 2NWBA 4QXBB 5FY1A 2J1DG 3GN5A 5LGTB 1X79A 3C51A 3O9XA 2LE8A 1IJ6A 4L5GA 1PFOA 2C5IT 2N9DA 2VK9A 5KMGP 3CX6B 2IC6A 3HI2A 5DQWA 4OHFA 2KZ7B 1FMWA 4AI6A 4IE0A 5LHHB 3KBUA 4EZHA 2H7VC 2L3LA 5HWXA 2KMFA 4MHCA 3AVSA 5FXXA 2MBGA 2PBIA 4WNKA 5ETWA 1LVKA 3K3QC 4DNDA 1IAPA 4TZ4C 3SWHA 4PJLA 4CXWA 1G8XA 3PU8A 3ETVA 4PJJA 3CVRA 4UF0A 4TV9E 2CXLA 2CXFA 2PJQA 3KV5A 2NOXA 4MBQA 4Z8XA 1YW0A 3PTRB 2NW9A 4WBOA 2D0TA 2D5UA 3LK42 2OA5A 5CB4E 3I0OA 1V9DA 3EDVA 3RH3A 3MXZA 1HCIA 4N78D 3ZYKA 4AQFA 2X67A 3K3NA 3RX6A 3ZMZB 4AXPA 4JEHB 5LJMA 2LHRA 1MMAA 4CXYA 3AAAB 2PG8A 2LOSA 2JMHA 4PW8A 5JRCA 3JC6C 3UTKA 4ADZA 1S3RA 1LVFA 4P09A 5FY0A 2K9AA 2KNDA 4HSCX 4AQGA 1S35A 2LM9A 4YJ2E 4CI3B 2VKHA 3HR0A 3VU7H 1IZNB 1NWMX 1UX4A 4H9RC 4X1YE 4EYYR 4HE8A 2X66A 4DVDA 2CLYC 4UIGA 3RYFE 2LEHA 5HYAA 1M3JA 2IW5B 2XAJB 2Q9QD 3J9X1 5JDMA 2XAFB 3U78A 5HXSA 4PJNA 1D1AA 4ISSA 3WAKA 4HEAA 4ZI3D 4B6XA 3NZQA 2HPLA 2Q9QA 3CQFA 1KK7A 2VWAA 2V7KA 3AA7B 2W0GA 2JQQA 4X1IE 3KV6A 2CA5A 2WAUA 5L2LA 3CPZA 3MKDA 4IDZA 3J7Yq 3ZN0B 1FMVA 4AKIA 4UXNB 4UVBB 2X9YA 1O3XA 3D0TA 4AKRB 3C4WA 2EHOA 3DP7A 5HXRA 2H3RA 3LBXA 3RYIE 3ANWB 3VKHA 3W15B 2VKDA 4UELA 2XQYA 3JC6D 3VHLA 3IBPA 4PFPA 3Q9DA 4KUMB 2XHEB 3AB3B 2L9QA 3CMLA 2X9WA 2X9XA 2Y48B 3FHNA 2VKOA 2UXNB 4MFRA 4AQFC 5EZYE 2CE7A 5DJQC 4E7ZA 1US7B 2ZM0A 4A56A 2X51A 2JMKA 2BDEA 5EK3A 1KNZA 1HTJF 5LGNB 3Q5WA 4I50E 2KT9A 3N9LA 3EDUA 4WW0A 4XAXB 4XZCA 3C4XA 4G63A 4X1KE 4OK0A 4DMWA 2YU1A 1YD8G 4C90A 4YLHA 1S94A 2ES0A 4UV9B 4BIKA 2ZM8A 5JH7E 3MJXA 4IE4A 4DO0A 4O4HE 3ZMTB 3N2OA 4DBRA 2P9BA 4HFVA 3MK7C 4QWNB 5FP3A 5JDQA 4TN7B 4P0AA 2V7LA 5JR9B 2D2SA 3B57A 2CCQA 3M65A 4FI5A 2LSYA 3SOLA 3RPUA 4O8SA 2Q9QC 2C5KT 3QC9A 3AA0B 5H6RB 2ACXA 2WBLA 3P7IA 3KVBA 3KFWX 4JEUB 3KV4A 2NTYA 5M4YA 4H9SE 4IHJE 3IHRA 4ZI3C 3T8OA 2Y8DA 2MTQA 5TAOA 4EYUA 4X20E 3HL6A 3ZYLA 1BR4A 1BR0A 3KV9A 4QHOA 3ZCJA 3NZPA 2NW7A 3OKQA 5ADXL 4O4IE 5EK4A 1VOMA 4ZOLE 3K3OA 5FXWA 3CQCB 1MMNA 2ZM2A 2V7IA 3ZYMA 3ZEFB 2WM9A 4UVAB 3ZMSB 2W62A 3PURA 2CLYB 2QGSA 5JDLA 4BJNA 2IC9A 3PJVD 4NUUA 2VKJA 3GN5B 4EB6E 3E0ZA 3V5SA 1U5PA 3KINB 3BK9A 3WAJA 1YKHB 5FNVE 2CEAA 3ONXA 2XAHB 5L3CB 4CQIA 2DNXA 5H6QB 3O4XE 3H37A 3AVRA 5LCYA 2YU2A 4YHJA 2A2FX 5HAXA 2SPCA 3LK2B 2UXXB 5L3FB 4ILUA 2DI4A 5GONE 5JVDE 4H63V 2V7JA 2KLQA 2KXPB 5IYZE 4CI1B 1T98A 4PK4A 2DLRA 4U74A 5DQVA 3L3PA 4CZZB 4ZS2A 4I55E 4TX5A 3HA4A 4O2BE 3E08A 3UT5E 3G2PA 2D0UA 3KBTA 3R84B 4BJMA 1HS7A 2W63A 4CI2B 3OBVE 2MYSA 2Z6EA 5EK2A 1MNDA 1LKXA 2W61A 3F31A 3FXDB 3O1IA 3PU3A 4QXCB 3HKBE 2EHOD 3UUXB 1D1BA 4CXXA 3FBZA 4F6RC 2B1EA 2WMNA 2E9XD 3PUAA 5J2TE 1HG5A 3FXEB 2G0UA 3NRXA 3GMIA 5AFUL 4AKHA 2DCFA 1U4QA 4GOUA 4O4JE 3ESLA 4AKGA 4H9PC 5JRCB 5L3DB 2HH7A 2E9XA 2DWGA 4IIJE 5LYJE 5FY7A 4JLEA 3O1HA 3RYCE 1WYBA 3GWHA 3LFMA 2WSSV 3LG7A 5JREA 4I43B 1WYCA 4GK0E 3OJAA 4HTEA 4M1PA 3LK3B 2BZBA 2JRKA 3KVAA 4DMVA 2V26A 4BAYB 3G2MA 3CX7B 4H63H 4OYJA 3G2QA 2RP4A 4OYKA 4HKAA 4KMCA 2NP9A 2CWOA 1WRDA 3K8PC 4TUYE 2KWIB 1Z0PA 4MALA 5JR9A 3PUGA 2XASB 1MNEA 1HF8A 1AJ3A 2PFVA 3P8CD 1OWAA 1M3IA 2X9HA 2MOZA 5FYMA 5L3EB 4C91A 3BQIA 3CWZB 2Q9QB 4U72A 3SS1A 5LHIB 1BR1A 4L9IA 2CMRA 4O4LE 1Y64B 4PJMA 3N5LA 3I0QA 4ZHQE 2LHNA 2WWUA 3RRWA 2C0SA 1WR6A 3GA8A 4UEMA 2N2NA 2BVMA 3ETUA 4IE5A 2A3DA 4YJ3E 5J1GA 4HGAA 1ZV4X 4ISTA 3LBXB 3ZJ2A 2L8KA 2XTLA 4EZ4A 5L3BB 2YK0A 4H9QC 3OYXA 2K5BB 4MLKA 3PUQA 3N9QA 4ANJA 4GIWA 2VASA 2ODUA 3HKEE 5LA6E 2V1DB 3EUHA 3CQXC 2XAQB 4P0BA 3UUMA 5LG4A 3NBXX 2VL8A 3E22E 1H7CA 4EAHA 3MA9A 2NTXA 3ZCIA 5JQGE 2EHOC 5JDNA 4QKNA 2E9XC 1HX8A 4OFZA 4PK5A 3QUJA 3FBLA 4L0RA 1D0ZA 4TV8E 1UX5A 3RRCA 2DHRA 4H9NC 1B7TA 5JDGA 2CXDA 3O1JA 5HXEA 5LNKA 5DABA 1EZ3A 2N1GA 1HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 B; 
#chains in the Genus database with same CATH topology
 1OED B;  4HWC A;  3EAM A;  2CM0 A;  3C98 B;  3A5X A;  4EXT A;  2ODV A;  3F2E A;  1FEW A;  4ERR A;  3RIF A;  5KX5 E;  3VR9 A;  2H7O A;  5HXC A;  4ZI2 D;  4X66 T;  3JAE A;  3N9N A;  3EVY A;  2A72 A;  3CX8 B;  5J0Z A;  3AAE B;  4X64 T;  4WZX A;  4Z90 A;  3PE0 A;  3R6N A;  4YSZ A;  2VB6 A;  5JTG A;  4I4T E;  4NXN T;  3QK6 A;  4DBQ A;  3CKD A;  3BQK A;  5J2U E;  4HN9 A;  4V1A v;  2M6B A;  2V6Y A;  1MIW A;  2UXC T;  2LT3 A;  5HCM A;  5L47 A;  5AQS B;  4K0U A;  1J5E T;  5LJN A;  4ZI7 E;  1ZHC A;  4EIW A;  4GK5 E;  1HNW T;  2W4X A;  5AQQ B;  2VUR A;  3Q5E A;  1YKE B;  2LSI A;  5F8P A;  2ZM6 T;  2RA1 A;  4LFB T;  3HKD E;  3S4U A;  3RC3 A;  4EOZ B;  3C64 A;  3N2G E;  5LGU B;  4AQY T;  3KDS E;  1YQ4 A;  2BG9 E;  5BMV E;  2JJ9 A;  1SHZ C;  3IF8 B;  3B13 A;  2CHO A;  4QX7 B;  4QX8 B;  4HFH A;  4G2A A;  2M6I A;  1YQ3 A;  4KP3 C;  3HVN A;  5HEO A;  3BQL A;  2IAK A;  3CQG B;  4ZI2 C;  3TLU A;  4LF5 T;  2NR4 A;  5LGT B;  3C51 A;  2LE8 A;  4OHF A;  4IE0 A;  2H7V C;  5HWX A;  3AVS A;  4HFD A;  4WNK A;  3PJA A;  3K3Q C;  3PU8 A;  3UQ4 A;  3AED A;  3CVR A;  4UF0 A;  2BS3 A;  2CXF A;  4MBQ A;  1YW0 A;  5AQM B;  3CIR A;  2D5U A;  2OA5 A;  5CB4 E;  2UUB T;  3EDV A;  3MXZ A;  1HCI A;  2XQA A;  1UUS A;  3K3N A;  1MMA A;  2LOS A;  1J5W A;  2FJA A;  3JC6 C;  2K9A A;  1S35 A;  3ZT5 A;  4CI3 B;  2VKH A;  2WY2 A;  1IZN B;  1UX4 A;  5AQJ B;  3UU3 A;  4DV0 T;  4ZXL A;  2W2U A;  2CLY C;  5HYA A;  1HNX T;  1M3J A;  2IW5 B;  2XAJ B;  2Q9Q D;  2XAF B;  1D1A A;  2YDQ A;  4QH5 A;  4CN6 A;  3AA7 B;  4LF6 T;  3J7Y q;  1O3X A;  4AKR B;  2EHO A;  3ONJ A;  3Q9D A;  2XHE B;  3FHN A;  2BS4 A;  2V6Y B;  2X0Y A;  2BDE A;  1WR0 A;  2JQ9 A;  2V6X A;  4G63 A;  1XMQ T;  4OK0 A;  4DMW A;  4LFA T;  1S94 A;  3MJX A;  3MK7 C;  3RKG A;  4P0A A;  2V7L A;  2CCQ A;  4NPP A;  4DUY T;  2WZI A;  2Q9Q C;  2C5K T;  5FVL A;  3LDQ B;  2WBL A;  2NTY A;  4IHJ E;  3IHR A;  5TAO A;  5AQH B;  5ADX L;  4NXM T;  4NUU A;  4EB6 E;  3E0Z A;  2J4G A;  5AQP B;  2DNX A;  3O4X E;  3AVR A;  3LK2 B;  4YSY A;  4U2Y A;  4H63 V;  3LSV A;  5FL0 A;  1OED C;  2YOE A;  4JI8 T;  5ABE A;  3G2P A;  2PTF A;  2W63 A;  2MYS A;  4TNV A;  1MND A;  1LKX A;  3FXD B;  3PU3 A;  4QXC B;  3HKB E;  4F6R C;  4DR2 T;  4JI0 T;  2LKG A;  5FL1 A;  2CRB A;  1HG5 A;  2G0U A;  2BBJ A;  4GOU A;  1N32 T;  1VCT A;  4X5T A;  5LYJ E;  5FY7 A;  4JLE A;  1WYB A;  4I43 B;  1WYC A;  5FKY A;  5HEJ A;  4HTE A;  2BZB A;  4OYJ A;  4EED A;  2KWI B;  5JR9 A;  1UGO A;  2XQ5 A;  3P8C D;  1OWA A;  2X9H A;  2MOZ A;  5L3E B;  1YXR A;  4L9I A;  4YTP A;  2I0M A;  5BR8 T;  1Y64 B;  3N5L A;  4ZHQ E;  3RRW A;  4UEM A;  4DR3 T;  3ETU A;  4YJ3 E;  4IST A;  5L3B B;  4MLK A;  3X1D A;  4JI7 T;  3N9Q A;  4GIW A;  1WFD A;  4JI5 T;  3PUV F;  5LA6 E;  2V1D B;  2F4V T;  3NBX X;  3E22 E;  4EAH A;  2NTX A;  2FJD A;  1HX8 A;  4OFZ A;  1NEN A;  5JDG A;  1EZ3 A;  1HG2 A;  4IE6 A;  3PUS A;  4YFS A;  2HPJ A;  3NRY A;  2GK9 A;  2X0L B;  5CA1 E;  3C50 A;  5LBQ B;  3AA6 B;  3Q5X A;  5L3G B;  4ILC A;  1G73 A;  4QH1 A;  3PDY A;  4DV2 T;  4JUY A;  4FJO A;  3ANW A;  4BA9 A;  2K48 A;  3FB2 A;  3AE2 A;  1QUU A;  4H9O C;  3MAC A;  2LOP A;  2XPK A;  5IWA T;  1IJ5 A;  4GKK T;  3SFD A;  1E1H B;  3RIU A;  3DJB A;  1MIV A;  4WBN E;  3ZLI A;  1SA0 E;  2YIN A;  1CUN A;  3G2O A;  3N9M A;  3SRZ A;  5JDF A;  5LXT E;  3UUN A;  2XUE A;  5HEG A;  5AQV B;  4Z91 A;  3C4Z A;  4JYA T;  2WMO A;  2LRL A;  4NIQ A;  3FZF B;  4B3S T;  3LJC A;  5ABF B;  4GYR A;  5IHY A;  3ZC0 A;  4TWD A;  2DL1 A;  1MIY A;  2K3W A;  5LP6 E;  3I9W A;  3RF1 A;  3ZSS A;  1D1C A;  3ZJ1 A;  1ZKE A;  2LM2 A;  4IGU A;  1M62 A;  4QXH B;  4QXB B;  2UUA T;  3JAD A;  3O9X A;  4L5G A;  2C5I T;  3TLV A;  3HI2 A;  2IC6 A;  5DQW A;  5LHH B;  2L3L A;  2PBI A;  4TZ4 C;  1KF6 A;  4PJJ A;  3ABV A;  4WYV A;  2CXL A;  2PJQ A;  2NOX A;  4Z8X A;  2NW9 A;  3P4R A;  4KHP T;  2D0T A;  3LK4 2;  1V9D A;  1Y01 A;  3QB5 K;  4N78 D;  3ZYK A;  4AQF A;  3EI0 A;  3ZMZ B;  4JEH B;  5LJM A;  2LHR A;  3AXJ B;  4PW8 A;  5JRC A;  4QH4 A;  4ADZ A;  3UTK A;  1S3R A;  4IL9 A;  5FY0 A;  2AE9 A;  4HSC X;  4YJ2 E;  4JI1 T;  1NWM X;  4DV5 T;  3K1S A;  3QOF A;  4X1Y E;  4EYY R;  4DVD A;  4YT0 A;  2BKO A;  3RYF E;  4PJN A;  2XQ3 A;  2VWA A;  3AEF A;  2ACZ A;  2CA5 A;  3CPZ A;  4IDZ A;  1FMV A;  4IDQ A;  4UVB B;  2X9Y A;  3PUW F;  3UU4 A;  5HXR A;  2H3R A;  3LBX A;  3ANW B;  2IIU A;  3W15 B;  5IUX A;  3H3M A;  3JC6 D;  3VHL A;  4PFP A;  4KUM B;  2L9Q A;  2VKO A;  2CE7 A;  1US7 B;  2ZM0 A;  2A9U A;  1KNZ A;  1HTJ F;  3EDU A;  4XAX B;  3C4X A;  3VR8 A;  2XM2 A;  3UU5 A;  1YD8 G;  4C90 A;  4JI3 T;  2XJ7 A;  2ES0 A;  4UV9 B;  4BIK A;  5JH7 E;  4O4H E;  3A8Y C;  3N2O A;  2P9B A;  4K0K T;  4TN7 B;  2WDV A;  3B57 A;  3M65 A;  2W66 A;  4FI5 A;  5H6R B;  2ACX A;  4DR4 T;  3P7I A;  3KVB A;  3KV4 A;  4DUZ T;  4H9S E;  3T8O A;  2Y8D A;  3CK6 A;  4X20 E;  2YDR A;  1BR0 A;  4QHO A;  3ZCJ A;  4O4I E;  5EK4 A;  1VOM A;  3K3O A;  5FXW A;  3CQC B;  1MMN A;  2XQ9 A;  4ZZC A;  5HEH A;  5HEU A;  1W9R A;  4BJN A;  1FJG T;  1JNR A;  4EEB A;  1U5P A;  1YKH B;  1SUM B;  4KX6 A;  4DR6 T;  4AIS A;  2BBH A;  3H37 A;  2WU5 A;  2SPC A;  2VVN A;  2BG9 A;  2FJE A;  4ILU A;  5JVD E;  2V7J A;  4PK4 A;  4KHZ F;  3E08 A;  5HCJ A;  5AQR B;  1N34 T;  3UUX B;  1D1B A;  3FBZ A;  2B1E A;  2WMN A;  3PUA A;  3NRX A;  4AKH A;  2DCF A;  1U4Q A;  4O4J E;  3ESL A;  2V5C A;  3A7M A;  5JRC B;  4IIJ E;  2H88 A;  3RYC E;  3LG7 A;  2MAW A;  2WCA A;  4GK0 E;  4B3R T;  3AEB A;  4KI0 F;  5AQG B;  3CX7 B;  3OVU A;  4H63 H;  1Z0P A;  2AXD S;  3PUG A;  2XAS B;  1HF8 A;  2WU2 A;  1AJ3 A;  1M3I A;  3BQI A;  3SS1 A;  2WDQ A;  1BR1 A;  2CMR A;  4O4L E;  4DV3 T;  2LHN A;  2C0S A;  3GA8 A;  4JBW F;  4LF4 T;  3G06 A;  5J1G A;  1XWM A;  1ZV4 X;  3LBX B;  4EZ4 A;  3ZT7 A;  2YK0 A;  3OYX A;  2JIW A;  4EV6 A;  2VAS A;  2ODU A;  4IDO A;  3RIA A;  2WQY A;  2J62 A;  3TLW A;  3CQX C;  5L4H A;  4HFE A;  4U31 A;  5LG4 A;  4TNW A;  1H7C A;  3ZCI A;  5JDN A;  4GKJ T;  4LF7 T;  4PK5 A;  4HWD A;  4L0R A;  1UX5 A;  3PJA J;  2DHR A;  4H9N C;  1T7S A;  2RPA A;  5HXE A;  1KFY A;  2N1G A;  1DTD B;  2FUP A;  3I9Y A;  3N2K E;  1D0Y A;  2LLY A;  1HNZ T;  5JR9 C;  4B3T T;  5L4E A;  4YTM A;  5C8Y E;  2X68 A;  3VKG A;  5FMN A;  3UUL A;  5CFB A;  5AQN B;  3IEE A;  1OED E;  4PAG A;  2XY8 B;  2WDR A;  5HXH A;  5F3J A;  3P4Q A;  2XZE A;  3TKL B;  3QB5 A;  4UF0 B;  5FXZ A;  2K24 A;  2CWY A;  1NAF A;  3T1Y T;  1OXZ A;  1XDO A;  2JQH A;  5FXV A;  3AAI A;  2QA7 A;  3ZN1 B;  4LML A;  1N36 T;  3HKC E;  4ASK A;  1DTV A;  2V5D A;  1WLX A;  2MPK A;  2BG9 B;  5A1L A;  4J2C A;  2LSJ A;  5AQU B;  1HFA A;  1ZEE A;  2XSB A;  3OYZ A;  1UK5 A;  4O2A E;  2KWH A;  2LSK A;  5JDH A;  4UV8 B;  1FIO A;  4KBM B;  1GQE A;  1QSD A;  3ZMV B;  2XAG B;  2I59 A;  2EHO B;  2V8S V;  3RYH E;  1JNZ A;  2C5J A;  5LB7 B;  2LJL A;  4NUV A;  1T8B A;  4E7S A;  5HWY A;  1T72 A;  3GN5 A;  1IJ6 A;  3AE8 A;  2VK9 A;  4YTN A;  5KMG P;  3CX6 B;  4AI6 A;  2KZ7 B;  3RIU C;  5LMN T;  3KBU A;  4EZH A;  2H89 A;  4IDN A;  2KMF A;  4MHC A;  2IHR 1;  5AQO B;  1LVK A;  5ETW A;  4DND A;  1IAP A;  4UR9 A;  3UUB A;  4CXW A;  3PUX F;  1N33 T;  2LKH A;  4TV9 E;  3PUZ F;  2HN1 A;  3AE9 A;  2UU9 T;  4Q25 A;  3RH3 A;  4JI6 T;  3RX6 A;  2WS3 A;  4CXY A;  2IUB A;  2XM1 A;  2JMH A;  4A98 A;  4ZEY A;  1HX1 B;  4AQG A;  3VU7 H;  4AIU A;  4HE8 A;  4IRE A;  4UIG A;  4ILB A;  3TLS A;  3U78 A;  3WAK A;  5ABG A;  4B6X A;  2HPL A;  1ZOY A;  1KK7 A;  3PUY F;  2CBI A;  2V7K A;  3RQU A;  2W0G A;  2JQQ A;  4U7Y A;  4X1I E;  3KV6 A;  2WAU A;  3MKD A;  3ZN0 B;  4AKI A;  1W09 A;  3D0T A;  4A97 A;  4B3M T;  2E5L T;  4UEL A;  2I6H A;  2XQY A;  3AEA A;  3AB3 B;  3P4W A;  3L8R A;  2UXN B;  4AQF C;  5DJQ C;  4A56 A;  4OX9 T;  5EK3 A;  2WP9 A;  4U33 A;  3OTO T;  4U7I A;  2KT9 A;  2E5V A;  4WW0 A;  4X1K E;  3RLF F;  2UXD T;  4YLH A;  4HFC A;  1E2A A;  4IE4 A;  1HR0 T;  3ZMT B;  4DBR A;  4HFV A;  3AEC A;  5JR9 B;  3JAF A;  3FZL B;  3QC9 A;  3KFW X;  2MTQ A;  3AE3 A;  4DID B;  3HL6 A;  1BR4 A;  3KV9 A;  4U3C A;  3NZP A;  3OKQ A;  3ZYM A;  1ZFL A;  3RHW A;  3ZMS B;  3PUR A;  2QGS A;  3ONL C;  2IC9 A;  3PJV D;  1CHU A;  4HWF A;  2VKJ A;  3GN5 B;  3V5S A;  2LRK A;  4ILA A;  3KIN B;  2X0H A;  3WAJ A;  4F8H A;  5L3C B;  5H6Q B;  3ZKR A;  2YU2 A;  2A2F X;  5HAX A;  2UXX B;  5L3F B;  3L39 A;  4CI1 B;  5IYZ E;  1T98 A;  2DLR A;  5DQV A;  3L3P A;  3HA4 A;  4O2B E;  3KBT A;  4BJM A;  5KXJ A;  2W61 A;  3F31 A;  3O1I A;  3FZK B;  2EHO D;  4CXX A;  5J2T E;  3AEG A;  5AFU L;  5AQT B;  2BS2 A;  4AKG A;  5L3D B;  2E9X A;  2KSR A;  2DWG A;  4DV4 T;  3GWH A;  3ZST A;  2XQ7 A;  2WZH A;  3OJA A;  3OPC A;  2OLT A;  3KVA A;  4DMV A;  3G2M A;  3G2Q A;  2RP4 A;  4OYK A;  2W67 A;  4HKA A;  5AQL B;  4YSX A;  1WRD A;  4TUY E;  4LFC T;  1XMO T;  2WB5 A;  2HHH T;  5FYM A;  3ZT6 A;  3FZH B;  4PJM A;  2BG9 C;  3AEE A;  1WR6 A;  1L0V A;  1XNQ T;  2XTL A;  2VL0 A;  4ANJ A;  1NEK A;  4HWH A;  4YHH T;  4P0B A;  4IT4 A;  2VL8 A;  1ZP0 A;  2CBJ A;  4HFB A;  2EHO C;  3RRC A;  1W0B A;  3Q5D A;  2CXD A;  5LNK A;  4PK6 A;  3Q2M A;  4UVC B;  2LSG A;  1MMG A;  2D9D A;  4I0U A;  5LOV E;  2BVL A;  3UFE A;  3ZC1 A;  2W00 A;  5C3J A;  3I1A A;  3U3I A;  3N9O A;  5LHG B;  3ZPO A;  5KDM C;  1LRZ A;  4YY3 T;  1I6Z A;  2VVS A;  4HWI B;  3UQ7 A;  2Y6X A;  4DV1 T;  3AE5 A;  1X9B A;  2XQ8 A;  2ZLY A;  3JCF A;  2JPF A;  4P1N A;  2XSA A;  3F57 A;  3QNU A;  2V7M A;  3NKZ A;  5LMU T;  3MZK B;  1D0X A;  3RI5 A;  5LBM A;  1IBM T;  3V5U A;  1UCU A;  3N9P A;  3M3Z B;  1VRB A;  2NW8 A;  3AE7 A;  3DTO A;  5CJ5 A;  1I94 T;  1XDP A;  4IE7 A;  2YEV C;  2YN6 A;  1SE7 A;  3WI3 A;  4ZZB A;  3H3A A;  4PFO A;  4PNI A;  2M67 A;  5CGM A;  2CHN A;  4AKL A;  2KIN B;  4XBF B;  2QYW A;  2ZMA A;  1XNR T;  3AA1 B;  1BR2 A;  4ZS3 A;  5E0O A;  3EAB A;  2DWK A;  4HFI A;  4GYS A;  3L09 A;  3ZMU B;  2J47 A;  1MMD A;  3UU6 A;  3B5M A;  2E8I A;  3RKO A;  3FZM B;  2E9X B;  2XQ6 A;  2WWV A;  2BKP A;  3RC8 A;  3EHZ A;  5CA0 E;  2NWB A;  5FY1 A;  2J1D G;  1X79 A;  1PFO A;  2N9D A;  1QLB A;  1FMW A;  3P4P A;  4X62 T;  2E2A A;  4DR7 T;  5FXX A;  2MBG A;  3AE6 A;  3AE1 A;  4IL4 A;  3SWH A;  4PJL A;  1G8X A;  5FVK A;  1IBK T;  3ETV A;  4YXD A;  3KV5 A;  3PTR B;  4WBO A;  3NWI A;  1M7K A;  3I0O A;  2X67 A;  1WCR A;  3IA3 A;  4AXP A;  3AAA B;  2PG8 A;  5AQI B;  5AQK B;  1LVF A;  4A5X A;  4P09 A;  2KND A;  2LM9 A;  3HR0 A;  4X65 T;  2QRX A;  4H9R C;  2X66 A;  3VRB A;  2LEH A;  4DV7 T;  3J9X 1;  5JDM A;  2IDO B;  1VCS A;  5HXS A;  4ISS A;  4HEA A;  4ZI3 D;  1UUR A;  3NZQ A;  2Q9Q A;  3CQF A;  5ABF A;  2CPT A;  2FBW A;  4EGW A;  5L2L A;  2JQK A;  4DR5 T;  4UXN B;  1R8I A;  3P50 A;  1J1J A;  3C4W A;  3DP7 A;  2B76 A;  3RYI E;  3RQW A;  3VKH A;  2VKD A;  2VQE T;  3IBP A;  2BKN A;  3CML A;  2X9W A;  2X9X A;  2Y48 B;  2IML A;  4MFR A;  5EZY E;  4E7Z A;  2X51 A;  2JMK A;  4COF A;  5LGN B;  3Q5W A;  4I50 E;  2OV9 A;  1XZY A;  3N9L A;  4XZC A;  5ABH A;  4DR1 T;  2YU1 A;  1OED A;  2ZM8 A;  4DO0 A;  4LF8 T;  4QWN B;  5F5W A;  5FP3 A;  5JDQ A;  2D2S A;  3TLT A;  2VQF T;  2LSY A;  3SOL A;  4LMJ A;  3RPU A;  4O8S A;  3AA0 B;  3AE4 A;  4JEU B;  5M4Y A;  3AXJ A;  1KNR A;  4ZI3 C;  3T1H T;  4EYU A;  5LG3 A;  3ZYL A;  2NW7 A;  4ZOL E;  2ZM2 A;  2V7I A;  2UUC T;  3ZEF B;  2WM9 A;  3P4S A;  4UVA B;  2R6G F;  2W62 A;  5JDL A;  2CLY B;  3UFG A;  4DV6 T;  3NVO A;  3BK9 A;  5FNV E;  2CEA A;  3ONX A;  2XAH B;  3UU8 A;  4CQI A;  5LCY A;  4YHJ A;  1DU2 A;  1ZFI A;  4CN4 A;  3VRA A;  2DI4 A;  5GON E;  2KLQ A;  2KXP B;  4U74 A;  4CZZ B;  4ZS2 A;  4I55 E;  4TX5 A;  4U2Z A;  3UT5 E;  2D0U A;  3R84 B;  1HS7 A;  4CI2 B;  3OBV E;  1Z8U A;  2Z6E A;  5EK2 A;  4JI4 T;  4CN1 A;  2E9X D;  5C2T A;  2FJB A;  2XQ4 A;  3FXE B;  3GMI A;  4H9P C;  2HH7 A;  2YDS A;  3O1H A;  4IDP A;  3LFM A;  2WSS V;  5JRE A;  4M1P A;  3LK3 B;  2JRK A;  2V26 A;  4TWF A;  4BAY B;  4JV5 T;  1KEY A;  4KMC A;  2NP9 A;  2CWO A;  3K8P C;  4MAL A;  1MNE A;  2PFV A;  2UXB T;  1KNP A;  4C91 A;  1E7P A;  2Q9Q B;  3CWZ B;  4U72 A;  5LHI B;  5AQF B;  3I0Q A;  2WWU A;  3RGL A;  4LF9 T;  2N2N A;  2BVM A;  4IE5 A;  2A3D A;  3PV0 F;  4HGA A;  3ZJ2 A;  2YKS A;  2L8K A;  4H9Q C;  2K5B B;  3PUQ A;  2HN2 A;  4JI2 T;  3HKE E;  3EUH A;  2XAQ B;  3SFE A;  3UUM A;  3MA9 A;  5JQG E;  2QVA A;  4QKN A;  2E9X C;  2ABZ C;  3QUJ A;  3FBL A;  1D0Z A;  4TV8 E;  4TWH A;  4LMK A;  1B7T A;  1IBL T;  1W0A A;  3O1J A;  5DAB A; 
#chains in the Genus database with same CATH homology
 4PK6 A;  3I9Y A;  3N2K E;  1D0Y A;  4IE6 A;  3PUS A;  3Q2M A;  2HPJ A;  4UVC B;  4YFS A;  3NRY A;  2LSG A;  2CM0 A;  3C98 B;  3A5X A;  2GK9 A;  2X0L B;  1MMG A;  5CA1 E;  5LOV E;  3C50 A;  5JR9 C;  4EXT A;  2BVL A;  5LBQ B;  5C8Y E;  2ODV A;  2X68 A;  1FEW A;  3AA6 B;  3F2E A;  4ERR A;  3Q5X A;  3VKG A;  5FMN A;  3UFE A;  3UUL A;  3ZC1 A;  5KX5 E;  5L3G B;  1G73 A;  2W00 A;  2H7O A;  3IEE A;  3I1A A;  3U3I A;  4PAG A;  5HXC A;  4ZI2 D;  3PDY A;  3N9N A;  3EVY A;  3N9O A;  5LHG B;  2A72 A;  3CX8 B;  4JUY A;  3ZPO A;  5HXH A;  3AAE B;  5KDM C;  1LRZ A;  4FJO A;  5F3J A;  3TKL B;  3PE0 A;  3ANW A;  3R6N A;  4UF0 B;  5FXZ A;  2K24 A;  4BA9 A;  2VB6 A;  2K48 A;  3FB2 A;  4I4T E;  2Y6X A;  1QUU A;  3QK6 A;  4DBQ A;  4H9O C;  2ZLY A;  3MAC A;  3CKD A;  3BQK A;  5J2U E;  2JPF A;  2CWY A;  4HN9 A;  4V1A v;  1NAF A;  3F57 A;  2LOP A;  1IJ5 A;  1MIW A;  1OXZ A;  2V7M A;  2LT3 A;  5FXV A;  3AAI A;  2QA7 A;  1E1H B;  3ZN1 B;  3MZK B;  1D0X A;  3DJB A;  4K0U A;  5LBM A;  1MIV A;  4WBN E;  3HKC E;  3V5U A;  1UCU A;  3N9P A;  3ZLI A;  4ASK A;  4ZI7 E;  1ZHC A;  5LJN A;  1SA0 E;  2YIN A;  1CUN A;  1VRB A;  2NW8 A;  3DTO A;  3G2O A;  4EIW A;  4GK5 E;  3N9M A;  1WLX A;  2YEV C;  4IE7 A;  1YKE B;  2LSI A;  3SRZ A;  3WI3 A;  5JDF A;  5LXT E;  5F8P A;  5A1L A;  3UUN A;  2RA1 A;  2XUE A;  3HKD E;  3H3A A;  4J2C A;  2LSJ A;  4PFO A;  3S4U A;  3RC3 A;  4PNI A;  4EOZ B;  3C4Z A;  2WMO A;  3C64 A;  2M67 A;  3N2G E;  5LGU B;  1HFA A;  1ZEE A;  4AKL A;  2KIN B;  4XBF B;  3OYZ A;  3KDS E;  2ZMA A;  4O2A E;  2KWH A;  2LSK A;  5BMV E;  5JDH A;  2JJ9 A;  3AA1 B;  3LJC A;  4UV8 B;  1FIO A;  1SHZ C;  1BR2 A;  4GYR A;  4KBM B;  3IF8 B;  4ZS3 A;  3B13 A;  5IHY A;  5E0O A;  3ZC0 A;  2DWK A;  4GYS A;  1QSD A;  1MIY A;  3L09 A;  4QX7 B;  3ZMU B;  4QX8 B;  3ZMV B;  4G2A A;  1MMD A;  2XAG B;  2I59 A;  4KP3 C;  3HVN A;  5LP6 E;  3BQL A;  2EHO B;  3I9W A;  2E8I A;  3RKO A;  3RYH E;  2IAK A;  2C5J A;  3CQG B;  2E9X B;  1D1C A;  4ZI2 C;  3ZJ1 A;  1ZKE A;  2LJL A;  4NUV A;  4E7S A;  3RC8 A;  4IGU A;  5CA0 E;  4QXH B;  5HWY A;  2NWB A;  4QXB B;  5FY1 A;  2J1D G;  3GN5 A;  5LGT B;  1X79 A;  3C51 A;  3O9X A;  2LE8 A;  1IJ6 A;  4L5G A;  1PFO A;  2C5I T;  2N9D A;  2VK9 A;  5KMG P;  3CX6 B;  2IC6 A;  3HI2 A;  5DQW A;  4OHF A;  2KZ7 B;  1FMW A;  4AI6 A;  4IE0 A;  5LHH B;  3KBU A;  4EZH A;  2H7V C;  2L3L A;  5HWX A;  2KMF A;  4MHC A;  3AVS A;  5FXX A;  2MBG A;  2PBI A;  4WNK A;  5ETW A;  1LVK A;  3K3Q C;  4DND A;  1IAP A;  4TZ4 C;  3SWH A;  4PJL A;  4CXW A;  1G8X A;  3PU8 A;  3ETV A;  4PJJ A;  3CVR A;  4UF0 A;  4TV9 E;  2CXL A;  2CXF A;  2PJQ A;  3KV5 A;  2NOX A;  4MBQ A;  4Z8X A;  1YW0 A;  3PTR B;  2NW9 A;  4WBO A;  2D0T A;  2D5U A;  3LK4 2;  2OA5 A;  5CB4 E;  3I0O A;  1V9D A;  3EDV A;  3RH3 A;  3MXZ A;  1HCI A;  4N78 D;  3ZYK A;  4AQF A;  2X67 A;  3K3N A;  3RX6 A;  3ZMZ B;  4AXP A;  4JEH B;  5LJM A;  2LHR A;  1MMA A;  4CXY A;  3AAA B;  2PG8 A;  2LOS A;  2JMH A;  4PW8 A;  5JRC A;  3JC6 C;  3UTK A;  4ADZ A;  1S3R A;  1LVF A;  4P09 A;  5FY0 A;  2K9A A;  2KND A;  4HSC X;  4AQG A;  1S35 A;  2LM9 A;  4YJ2 E;  4CI3 B;  2VKH A;  3HR0 A;  3VU7 H;  1IZN B;  1NWM X;  1UX4 A;  4H9R C;  4X1Y E;  4EYY R;  4HE8 A;  2X66 A;  4DVD A;  2CLY C;  4UIG A;  3RYF E;  2LEH A;  5HYA A;  1M3J A;  2IW5 B;  2XAJ B;  2Q9Q D;  3J9X 1;  5JDM A;  2XAF B;  3U78 A;  5HXS A;  4PJN A;  1D1A A;  4ISS A;  3WAK A;  4HEA A;  4ZI3 D;  4B6X A;  3NZQ A;  2HPL A;  2Q9Q A;  3CQF A;  1KK7 A;  2VWA A;  2V7K A;  3AA7 B;  2W0G A;  2JQQ A;  4X1I E;  3KV6 A;  2CA5 A;  2WAU A;  5L2L A;  3CPZ A;  3MKD A;  4IDZ A;  3J7Y q;  3ZN0 B;  1FMV A;  4AKI A;  4UXN B;  4UVB B;  2X9Y A;  1O3X A;  3D0T A;  4AKR B;  3C4W A;  2EHO A;  3DP7 A;  5HXR A;  2H3R A;  3LBX A;  3RYI E;  3ANW B;  3VKH A;  3W15 B;  2VKD A;  4UEL A;  2XQY A;  3JC6 D;  3VHL A;  3IBP A;  4PFP A;  3Q9D A;  4KUM B;  2XHE B;  3AB3 B;  2L9Q A;  3CML A;  2X9W A;  2X9X A;  2Y48 B;  3FHN A;  2VKO A;  2UXN B;  4MFR A;  4AQF C;  5EZY E;  2CE7 A;  5DJQ C;  4E7Z A;  1US7 B;  2ZM0 A;  4A56 A;  2X51 A;  2JMK A;  2BDE A;  5EK3 A;  1KNZ A;  1HTJ F;  5LGN B;  3Q5W A;  4I50 E;  2KT9 A;  3N9L A;  3EDU A;  4WW0 A;  4XAX B;  4XZC A;  3C4X A;  4G63 A;  4X1K E;  4OK0 A;  4DMW A;  2YU1 A;  1YD8 G;  4C90 A;  4YLH A;  1S94 A;  2ES0 A;  4UV9 B;  4BIK A;  2ZM8 A;  5JH7 E;  3MJX A;  4IE4 A;  4DO0 A;  4O4H E;  3ZMT B;  3N2O A;  4DBR A;  2P9B A;  4HFV A;  3MK7 C;  4QWN B;  5FP3 A;  5JDQ A;  4TN7 B;  4P0A A;  2V7L A;  5JR9 B;  2D2S A;  3B57 A;  2CCQ A;  3M65 A;  4FI5 A;  2LSY A;  3SOL A;  3RPU A;  4O8S A;  2Q9Q C;  2C5K T;  3QC9 A;  3AA0 B;  5H6R B;  2ACX A;  2WBL A;  3P7I A;  3KVB A;  3KFW X;  4JEU B;  3KV4 A;  2NTY A;  5M4Y A;  4H9S E;  4IHJ E;  3IHR A;  4ZI3 C;  3T8O A;  2Y8D A;  2MTQ A;  5TAO A;  4EYU A;  4X20 E;  3HL6 A;  3ZYL A;  1BR4 A;  1BR0 A;  3KV9 A;  4QHO A;  3ZCJ A;  3NZP A;  2NW7 A;  3OKQ A;  5ADX L;  4O4I E;  5EK4 A;  1VOM A;  4ZOL E;  3K3O A;  5FXW A;  3CQC B;  1MMN A;  2ZM2 A;  2V7I A;  3ZYM A;  3ZEF B;  2WM9 A;  4UVA B;  3ZMS B;  2W62 A;  3PUR A;  2CLY B;  2QGS A;  5JDL A;  4BJN A;  2IC9 A;  3PJV D;  4NUU A;  2VKJ A;  3GN5 B;  4EB6 E;  3E0Z A;  3V5S A;  1U5P A;  3KIN B;  3BK9 A;  3WAJ A;  1YKH B;  5FNV E;  2CEA A;  3ONX A;  2XAH B;  5L3C B;  4CQI A;  2DNX A;  5H6Q B;  3O4X E;  3H37 A;  3AVR A;  5LCY A;  2YU2 A;  4YHJ A;  2A2F X;  5HAX A;  2SPC A;  3LK2 B;  2UXX B;  5L3F B;  4ILU A;  2DI4 A;  5GON E;  5JVD E;  4H63 V;  2V7J A;  2KLQ A;  2KXP B;  5IYZ E;  4CI1 B;  1T98 A;  4PK4 A;  2DLR A;  4U74 A;  5DQV A;  3L3P A;  4CZZ B;  4ZS2 A;  4I55 E;  4TX5 A;  3HA4 A;  4O2B E;  3E08 A;  3UT5 E;  3G2P A;  2D0U A;  3KBT A;  3R84 B;  4BJM A;  1HS7 A;  2W63 A;  4CI2 B;  3OBV E;  2MYS A;  2Z6E A;  5EK2 A;  1MND A;  1LKX A;  2W61 A;  3F31 A;  3FXD B;  3O1I A;  3PU3 A;  4QXC B;  3HKB E;  2EHO D;  3UUX B;  1D1B A;  4CXX A;  3FBZ A;  4F6R C;  2B1E A;  2WMN A;  2E9X D;  3PUA A;  5J2T E;  1HG5 A;  3FXE B;  2G0U A;  3NRX A;  3GMI A;  5AFU L;  4AKH A;  2DCF A;  1U4Q A;  4GOU A;  4O4J E;  3ESL A;  4AKG A;  4H9P C;  5JRC B;  5L3D B;  2HH7 A;  2E9X A;  2DWG A;  4IIJ E;  5LYJ E;  5FY7 A;  4JLE A;  3O1H A;  3RYC E;  1WYB A;  3GWH A;  3LFM A;  2WSS V;  3LG7 A;  5JRE A;  4I43 B;  1WYC A;  4GK0 E;  3OJA A;  4HTE A;  4M1P A;  3LK3 B;  2BZB A;  2JRK A;  3KVA A;  4DMV A;  2V26 A;  4BAY B;  3G2M A;  3CX7 B;  4H63 H;  4OYJ A;  3G2Q A;  2RP4 A;  4OYK A;  4HKA A;  4KMC A;  2NP9 A;  2CWO A;  1WRD A;  3K8P C;  4TUY E;  2KWI B;  1Z0P A;  4MAL A;  5JR9 A;  3PUG A;  2XAS B;  1MNE A;  1HF8 A;  1AJ3 A;  2PFV A;  3P8C D;  1OWA A;  1M3I A;  2X9H A;  2MOZ A;  5FYM A;  5L3E B;  4C91 A;  3BQI A;  3CWZ B;  2Q9Q B;  4U72 A;  3SS1 A;  5LHI B;  1BR1 A;  4L9I A;  2CMR A;  4O4L E;  1Y64 B;  4PJM A;  3N5L A;  3I0Q A;  4ZHQ E;  2LHN A;  2WWU A;  3RRW A;  2C0S A;  1WR6 A;  3GA8 A;  4UEM A;  2N2N A;  2BVM A;  3ETU A;  4IE5 A;  2A3D A;  4YJ3 E;  5J1G A;  4HGA A;  1ZV4 X;  4IST A;  3LBX B;  3ZJ2 A;  2L8K A;  2XTL A;  4EZ4 A;  5L3B B;  2YK0 A;  4H9Q C;  3OYX A;  2K5B B;  4MLK A;  3PUQ A;  3N9Q A;  4ANJ A;  4GIW A;  2VAS A;  2ODU A;  3HKE E;  5LA6 E;  2V1D B;  3EUH A;  3CQX C;  2XAQ B;  4P0B A;  3UUM A;  5LG4 A;  3NBX X;  2VL8 A;  3E22 E;  1H7C A;  4EAH A;  3MA9 A;  2NTX A;  3ZCI A;  5JQG E;  2EHO C;  5JDN A;  4QKN A;  2E9X C;  1HX8 A;  4OFZ A;  4PK5 A;  3QUJ A;  3FBL A;  4L0R A;  1D0Z A;  4TV8 E;  1UX5 A;  3RRC A;  2DHR A;  4H9N C;  1B7T A;  5JDG A;  2CXD A;  3O1J A;  5HXE A;  5LNK A;  5DAB A;  1EZ3 A;  2N1G A;  1HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...