3IF8B

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
237
Chain Sequence
LFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHRIFFTNMVTCSQVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 71
structure length 237
sequence length 252
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3if8B02
3.30.1040.30 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3if8B03
3IF8B
chains in the Genus database with same CATH superfamily
3BQKA 1HG2A 2EHOD 3RGLA 4FI5A 1D0ZA 2DL1A 3JAFA 2ACZA 4YTMA 3RYFE 4H9PC 2MPKA 4JI3T 2KNDA 1N33T 1NEKA 2UUCT 2BKNA 3ZN1B 1XMQT 3SS1A 5HXHA 1XWMA 2LSIA 2G0UA 2KMFA 4HFCA 4JI1T 3NBXX 3SFDA 3AA0B 1D1BA 3FZHB 4NUUA 1IBLT 2ZM8A 5CA0E 2Y6XA 2PTFA 4TN7B 2BS2A 4H9RC 4X5TA 3FB2A 4IGUA 2BVLA 5AQSB 3QUJA 5CGMA 2HH7A 4ILUA 3PURA 3SWHA 5L4HA 4ISTA 4AKRB 2PBIA 4LMKA 2D5UA 4IDQA 3P4SA 4ANJA 4UXNB 1J1JA 3E22E 3ZMSB 1MNDA 2K48A 3LDQB 2X0YA 3GA8A 2FBWA 3NZPA 3RYCE 2LKGA 4P09A 3PUAA 3RHWA 4HFEA 3F31A 4PJJA 2X0LB 4QX8B 5LP6E 4BJNA 3PUVF 1LVKA 1HFAA 4LF8T 3WAJA 1JNZA 3KFWX 4ASKA 5HEHA 2D9DA 2H7OA 3K3NA 2KT9A 2QRXA 2BG9A 1UCUA 4PK4A 4LFAT 2I0MA 3UUNA 1M3JA 5LCYA 4DV1T 3CVRA 5EK2A 2KSRA 2V7KA 2V1DB 4QXCB 2NW9A 2YINA 4GKJT 4A98A 3HKDE 2ZM2A 4EAHA 1MMNA 3HL6A 3A8YC 3ZT5A 3S4UA 4ZI7E 4BIKA 4DV6T 1S94A 5HXSA 2XQYA 1X9BA 4L5GA 5LHHB 4LF5T 3RIAA 2V5CA 2V5DA 2BS3A 3VHLA 1YW0A 4IT4A 2L8KA 3L3PA 2UXCT 3RRWA 2XM1A 3UU4A 4KP3C 1KNRA 5KDMC 4U74A 1L0VA 3CWZB 5BR8T 1KF6A 3UU5A 2UXDT 4JI4T 1VCSA 4IDZA 2IW5B 3LK42 5JH7E 1WLXA 4OX9T 4U31A 3MXZA 1IBMT 2WSSV 1QSDA 5DJQC 4QKNA 3ANWB 5HYAA 4PW8A 4DBQA 3U78A 4G2AA 4HFDA 4HWIB 2EHOA 3P8CD 3T1HT 3P4WA 2ACXA 5L3BB 2IC9A 3PUQA 3ZMZB 2H89A 4U3CA 5LHIB 2V8SV 2W61A 1BR2A 4HKAA 2LRKA 1XNQT 2XUEA 3J9X1 3EABA 2X9XA 3EVYA 2WU5A 5FY0A 2WZHA 1HCIA 3NRYA 4HWCA 3ONXA 2HN2A 4KUMB 2A9UA 2EHOC 4UR9A 4ADZA 1I6ZA 1IJ5A 3LJCA 2VQFT 5L2LA 5L47A 4PNIA 2YDRA 4JUYA 3LBXA 4DV7T 3PUYF 4DV4T 1MMGA 2XQ6A 1JNRA 2FJBA 3QOFA 3U3IA 3AEDA 3ZYKA 2H3RA 3Q9DA 4XBFB 3JC6C 4UVCB 1XMOT 2QA7A 3W15B 3AEFA 2RPAA 5DABA 4ZOLE 5FXXA 5H6RB 4TV9E 2BZBA 4O4JE 3KBTA 5AQUB 4K0UA 2HPJA 1CUNA 4YFSA 4YY3T 4NXNT 3OBVE 1FEWA 4ILAA 2XQ7A 5A1LA 1YKEB 3CMLA 3HKEE 4CI3B 4XAXB 4CXXA 2WMNA 2CWOA 2YDQA 2XAGB 3VU7H 2CWYA 4TNVA 3G06A 4O4IE 3ZC0A 4DMVA 5IWAT 4BJMA 1B7TA 5F5WA 4TWHA 3H37A 2W2UA 3L8RA 2XQ4A 1DTVA 4QH5A 4AKIA 2XASB 2WWVA 3NVOA 2I59A 3P7IA 4DUZT 1LRZA 1T7SA 2SPCA 2V6XA 2VL8A 3LG7A 4PFOA 1BR0A 2ES0A 2BKPA 3V5UA 1S3RA 2K24A 3AECA 3ZCJA 4UVBB 2ODUA 2N9DA 3R84B 1BR1A 1MMAA 2XQ8A 3P4RA 3RQUA 3AVSA 4U2ZA 3K1SA 4YHJA 1OEDA 2MAWA 3NKZA 5BMVE 5JDGA 4IE4A 3MA9A 4ZZBA 3Q5DA 5JDHA 4I43B 1X79A 2R6GF 3SOLA 4U72A 2QYWA 5J1GA 4UVAB 5JREA 1NENA 2L9QA 3UQ4A 4ZHQE 4L0RA 1HR0T 5J2UE 3ZT6A 1IAPA 2XAFB 3BQIA 2VKDA 3TLSA 2P9BA 3T1YT 1M62A 1E1HB 5FP3A 4QXHB 2Q9QD 3RYHE 2YN6A 2FUPA 5GONE 3JAEA 4JI6T 3X1DA 2NOXA 1UGOA 4AQGA 4EEBA 3Q5XA 5LBMA 3QB5K 3ZJ1A 2J1DG 5JDLA 3K8PC 3ZT7A 5AQLB 5LG3A 5JR9A 5AQHB 5JR9B 1FIOA 5J2TE 3B5MA 4J2CA 3OYXA 1T98A 4CZZB 4FJOA 3N9MA 3EDVA 5CB4E 3AE4A 4O8SA 4KMCA 4PK6A 5C8YE 2IMLA 2V6YB 3PJVD 1ZFLA 5LOVE 5JR9C 5AQPB 4DV0T 1E2AA 2E5LT 2E9XB 3CK6A 1D0XA 3KVAA 4X62T 3N2OA 4TNWA 2LJLA 4A97A 4CXWA 1ZV4X 2YEVC 4BAYB 3RX6A 2F4VT 1MNEA 1E7PA 4X1IE 5EK3A 4CN4A 3TLWA 4E7ZA 4LMLA 4IDOA 5ABGA 2MOZA 2YU1A 1N34T 3ZYLA 5AQOB 2E9XC 4DMWA 2JQ9A 5AQVB 3UFGA 5LMNT 3IBPA 4IDNA 4PJLA 4YHHT 3WAKA 4JBWF 2BDEA 1XZYA 2WQYA 4LFCT 3N9QA 4HWFA 2CXLA 4EXTA 2A3DA 4JLEA 2J47A 1G8XA 2DNXA 2V7LA 4I0UA 5FY1A 1D1AA 3P50A 2JJ9A 3AB3B 2JQKA 4UEMA 3F57A 1LKXA 3AE2A 3G2QA 3GN5A 4IIJE 2C5JA 2ZM0A 3AA1B 3H3AA 3BK9A 2XM2A 1W0AA 4ZI3D 2X67A 4KX6A 1W09A 5IYZE 4JEUB 5LGNB 1HNXT 1FMVA 1MIWA 5CJ5A 4DV5T 2DWGA 5FL0A 1MIYA 4AXPA 1WYBA 2X66A 5HXRA 4O4HE 3RI5A 4F6RC 3B57A 4X66T 2WP9A 3AEBA 2LEHA 3RRCA 3VRBA 2VVSA 2WB5A 4MFRA 2KLQA 2XAHB 4O2BE 3AAAB 4ERRA 2BG9B 2Q9QA 4CI1B 2CMRA 1U5PA 1SHZC 2XPKA 2KWHA 1T8BA 4AKLA 5IHYA 3SRZA 2AE9A 5JTGA 3C4WA 4YLHA 1N32T 2I6HA 3SFEA 1U4QA 5HAXA 3HVNA 4OYKA 3C4XA 2PJQA 3JCFA 2LLYA 1Y64B 1Z0PA 1CHUA 4JI8T 4QX7B 2BG9C 4JYAT 2Q9QC 1YQ4A 2LHRA 4GK0E 1KK7A 3C64A 3B13A 3ETVA 2PFVA 2RP4A 5AFUL 5FXWA 1I94T 5AQMB 2RA1A 2NTYA 3ESLA 3ZMVB 3AE1A 2W00A 3MKDA 2H88A 1GQEA 5C2TA 2GK9A 4IE6A 4UIGA 5JDNA 2C0SA 2XQ5A 1VRBA 1WYCA 2UU9T 5ADXL 4K0KT 4B3TT 4H9OC 4LF7T 4DR3T 3VRAA 5HCMA 2WDVA 5C3JA 2V7JA 4F8HA 4NIQA 4TWFA 3EAMA 4YT0A 2OA5A 2LSGA 2EHOB 3K3QC 2CEAA 3AXJA 1YD8G 1D0YA 4AI6A 5EK4A 2BKOA 5ABEA 1SE7A 2W67A 4O2AE 2LOSA 4OK0A 4H9SE 3IF8B 5LJMA 4U2YA 2WBLA 5HCJA 4YJ3E 3UU8A 2NWBA 2IUBA 3UUXB 4ISSA 4EGWA 3C50A 2LSYA 5AQQB 4MHCA 4GKKT 3LBXB 2BBJA 2MYSA 3BQLA 2DLRA 1HX8A 2Y48B 1H7CA 2CHNA 4YSXA 3CIRA 3WI3A 3Q2MA 3FXEB 2WMOA 4B3RT 4ZI2D 3N9LA 4TZ4C 2JMKA 2CXDA 3FZLB 3EHZA 2LKHA 5AQIB 2BS4A 4HSCX 2KXPB 4OYJA 3VKHA 2UXNB 3PUZF 2ABZC 3PUSA 2W63A 3I0QA 5DQVA 1ZKEA 2LM2A 3FXDB 4YSYA 4TX5A 3FBZA 4AQFA 2YKSA 3OPCA 4YJ2E 3UFEA 4WBOA 4X1KE 1W0BA 5AQNB 3G2OA 4QH1A 5DQWA 3C98B 3AAIA 3E0ZA 1HG5A 4EB6E 2JIWA 2XY8B 4H9QC 2QVAA 3V5SA 2WWUA 2HPLA 2E5VA 3DP7A 2E8IA 2NTXA 1NAFA 3KBUA 3AA6B 4WNKA 4P0BA 3HI2A 2W62A 4MLKA 2YU2A 2VL0A 1W9RA 2LHNA 3N2GE 5LJNA 3O9XA 2V7IA 3CX7B 1OEDB 3AEAA 3E08A 4NXMT 5JVDE 3MK7C 2WU2A 3KV9A 3KDSE 2HN1A 3ABVA 2IAKA 3MZKB 1XNRT 2XSBA 3ONJA 3N9NA 4DR2T 2Z6EA 1OXZA 3P4QA 3KV4A 2W66A 3C51A 5FVKA 3CQGB 4HEAA 3ZSSA 4EOZB 4KHPT 4ZXLA 1OEDC 1VOMA 2ZMAA 1WFDA 2XQ9A 1ZP0A 4HWHA 5HEJA 3IHRA 4WBNE 3DJBA 3LK2B 3HA4A 4ZEYA 2C5IT 3PUGA 2YOEA 2BBHA 5EZYE 3ZC1A 2WDQA 5JDFA 4EEDA 3RIUA 2K5BB 4N78D 4LFBT 4I4TE 3I9WA 2VWAA 2VURA 3Q5EA 3PUWF 5AQRB 2CPTA 1MIVA 3FZMB 1Z8UA 3N9OA 2ZM6T 2XAQB 3L09A 3AE9A 4YXDA 3RF1A 5J0ZA 1UX4A 4L9IA 2VKJA 2VVNA 2WS3A 5AQGB 4DV3T 3NWIA 2A2FX 3H3MA 2UXBT 5L3CB 5KXJA 4C91A 1UUSA 4AKGA 5ETWA 3EI0A 5ABFA 2MBGA 3AE6A 3AVRA 3NRXA 5L4EA 4OHFA 3CKDA 4EZ4A 3GMIA 3T8OA 4GK5E 1WR0A 4WZXA 4XZCA 2XZEA 5LA6E 4EYUA 4UV9B 2J4GA 4GYSA 4U7YA 4PJMA 4WW0A 2IDOB 4IL4A 1M3IA 1XDPA 4TUYE 1ZEEA 2M6BA 3L39A 4O4LE 4UF0A 5FNVE 1QLBA 2XQ3A 4CN1A 5LGUB 3QB5A 2CM0A 4YTPA 3GWHA 1N36T 3PJAJ 2X9WA 1KNZA 2LE8A 1QUUA 2NR4A 3RYIE 3PTRB 4EZHA 2FJDA 4H63V 2KINB 2VB6A 2UUAT 4OFZA 4TV8E 4HFHA 2N1GA 1AJ3A 4AKHA 5LBQB 3O1IA 3AE3A 4E7SA 3J7Yq 1FMWA 3MJXA 3O4XE 4JI7T 2WY2A 3DTOA 4X64T 1UX5A 2AXDS 3UUBA 4CI2B 4H9NC 4ZZCA 1IZNB 3JC6D 2CLYB 3OTOT 3PU8A 2DHRA 2D0TA 3RPUA 3GN5B 1HTJF 4HGAA 2UXXB 4NPPA 3ZMUB 3AAEB 2K3WA 4DR7T 2CBJA 5HWYA 4AIUA 2E2AA 3UU3A 2HHHT 2X68A 2FJEA 1D1CA 5L3EB 2X0HA 3VKGA 2Y8DA 2WCAA 5M4YA 1YXRA 2CLYC 5AQTB 4HFIA 4GYRA 4EYYR 4ILBA 2YK0A 4UELA 1T72A 4KBMB 2YDSA 4CQIA 4JI2T 1US7B 4A5XA 2Q9QB 2CHOA 3CQFA 2BG9E 1SUMB 2X9YA 3AE7A 4X20E 1O3XA 2XSAA 4BA9A 1UURA 4HE8A 5KMGP 4PAGA 3KINB 5FY7A 2CE7A 4CN6A 4MALA 5FYMA 5LNKA 1PFOA 3ZSTA 3Q5WA 2KWIB 2JPFA 4JEHB 3FBLA 1ZHCA 3CQXC 5L3DB 2ODVA 2M6IA 4EIWA 2X9HA 4Z90A 3EDUA 2B1EA 2WM9A 4AQYT 4DUYT 3HKCE 3JADA 5FXVA 1HNWT 3FHNA 5JQGE 1V9DA 4EV6A 4UV8B 5HEUA 2XHEB 5LB7B 4DR1T 3CX8B 1BR4A 4QH4A 4X1YE 4B3MT 2D2SA 3QC9A 3RIFA 2OV9A 1WR6A 2PG8A 2H7VC 2LSKA 3R6NA 4QHOA 1LVFA 4KI0F 2XJ7A 3UTKA 1S35A 3FZKB 3UUMA 3AXJB 4M1PA 2UUBT 4IE0A 3ANWA 2XQAA 5LHGB 5AQFB 3ZPOA 2QGSA 4LMJA 3G2PA 3PDYA 4V1Av 4HWDA 4PK5A 3PE0A 5E0OA 5F8PA 1DTDB 3KV5A 3M65A 4AISA 5FXZA 1KEYA 2M67A 5FL1A 1G73A 1YQ3A 2DCFA 3M3ZB 3KVBA 5IUXA 5L3FB 1DU2A 5L3GB 3HKBE 1WRDA 5FVLA 2D0UA 4ZS2A 2CCQA 2IIUA 4HTEA 2XTLA 2JQHA 4PJNA 1SA0E 2IHR1 3PV0F 3QNUA 5LXTE 3TLVA 3AA7B 2NP9A 1KFYA 2W0GA 4U33A 5JRCA 5JRCB 1OWAA 3N5LA 3ETUA 4G63A 4IE7A 5CFBA 2WZIA 3TLUA 2VKHA 3RQWA 5TAOA 2VQET 2L3LA 4I55E 4WYVA 4DR5T 2E9XD 3CQCB 2LM9A 3F2EA 3HR0A 5CA1E 4MBQA 4HFVA 2NW8A 3EUHA 4QWNB 4ZI3C 3UULA 2JMHA 4NUVA 5F3JA 5JDMA 3RKOA 4Q25A 4PFPA 4H63H 3PU3A 2BVMA 4QXBB 3PUXF 4C90A 2A72A 3ZMTB 4DNDA 2K9AA 1ZFIA 3IEEA 4B3ST 4IHJE 2VASA 4CXYA 3OVUA 1ZOYA 3TLTA 1XDOA 4B6XA 2DWKA 4DBRA 3QK6A 3N2KE 2MTQA 5HEOA 2NW7A 4JV5T 2VKOA 3A7MA 2CBIA 3ZYMA 1IBKT 3NZQA 4IL9A 2CXFA 2LSJA 4IREA 3UQ7A 4DV2T 4AQFC 3ZJ2A 3RH3A 1YKHB 2N2NA 3O1HA 3PJAA 3ZKRA 4ILCA 2LOPA 2DI4A 1OEDE 2VK9A 2KZ7B 3RKGA 1J5ET 4LF6T 4COFA 5FKYA 1WCRA 3ZEFB 2X51A 2B76A 4LF4T 2JRKA 3A5XA 3AEGA 5HXCA 4YTNA 5LYJE 1VCTA 4IE5A 3LFMA 1J5WA 2CRBA 4HN9A 1HF8A 3ZCIA 5LMUT 1HNZT 4DVDA 3I1AA 3UT5E 4P0AA 5KX5E 2FJAA 1IJ6A 1KNPA 3OKQA 5FMNA 4U7IA 3D0TA 3RLFF 2ZLYA 3FZFB 4I50E 1HX1B 3N9PA 3KV6A 5LG4A 3I9YA 4GOUA 4X65T 2CA5A 1R8IA 3VR8A 2WAUA 2IC6A 3AE8A 4LF9T 4P1NA 1Y01A 3TKLB 3OJAA 1UK5A 3MACA 2WDRA 1EZ3A 3ZLIA 2J62A 2C5KT 5ABHA 2LRLA 3AEEA 5H6QB 3LSVA 3ZN0B 3RIUC 5HXEA 4TWDA 3G2MA 4KHZF 2V26A 1FJGT 2LT3A 5ABFB 5JDQA 4IDPA 4HFBA 4JI5T 3OYZA 3C4ZA 2V7MA 3P4PA 4DO0A 2V6YA 4YSZA 1NWMX 3CPZA 4A56A 5AQJB 1MMDA 3O1JA 5HWXA 5LGTB 4DIDB 2E9XA 3AE5A 4UF0B 4DR6T 3K3OA 3ONLC 3LK3B 2JQQA 1HS7A 3RC8A 2W4XA 5AQKB 2XAJB 4JI0T 3I0OA 4ZS3A 3RC3A 4Z8XA 1M7KA 3CX6B 4DR4T 4Z91A 3IA3A 4GIWA 3VR9A 3UU6A 2OLTA 5HEGA 4ZI2C
chains in the Genus database with same CATH topology
3BQLA 3Q5WA 3BQKA 2KWIB 1HG2A 2DLRA 2EHOD 2JPFA 4FI5A 1HX8A 2Y48B 1D0ZA 4JEHB 5J2UE 3FBLA 1ZHCA 1H7CA 3CQXC 3RYFE 1IAPA 5L3DB 2ODVA 2XAFB 4EIWA 3BQIA 4H9PC 2VKDA 2X9HA 2KNDA 3WI3A 3EDUA 3Q2MA 3FXEB 2P9BA 2B1EA 2WM9A 3HKCE 2WMOA 3ZN1B 1E1HB 3SS1A 5FP3A 5HXHA 2LSIA 4ZI2D 3N9LA 2G0UA 4QXHB 2KMFA 4TZ4C 5FXVA 3FHNA 5JQGE 2JMKA 2CXDA 2Q9QD 1V9DA 3NBXX 4UV8B 3RYHE 3AA0B 1D1BA 4NUUA 5GONE 2XHEB 4HSCX 2KXPB 2ZM8A 3CX8B 2NOXA 4OYJA 3VKHA 2UXNB 4AQGA 5CA0E 2Y6XA 3Q5XA 3PUSA 4TN7B 5LBMA 1BR4A 3ZJ1A 2W63A 3I0QA 5DQVA 1ZKEA 3FXDB 4X1YE 2J1DG 4TX5A 2D2SA 3FBZA 4H9RC 4AQFA 5JDLA 3FB2A 4IGUA 3K8PC 2BVLA 4YJ2E 3QUJA 3UFEA 5JR9A 4WBOA 3QC9A 4X1KE 5JR9B 1FIOA 3G2OA 2HH7A 1WR6A 2PG8A 4ILUA 3PURA 3SWHA 5J2TE 2H7VC 5DQWA 3C98B 3AAIA 3E0ZA 4ISTA 4AKRB 2LSKA 3R6NA 1HG5A 2PBIA 4QHOA 2D5UA 1LVFA 4EB6E 3UTKA 4ANJA 4J2CA 4UXNB 3OYXA 4H9QC 1T98A 4CZZB 1S35A 4FJOA 3E22E 3N9MA 3V5SA 3UUMA 3ZMSB 2WWUA 4M1PA 1MNDA 3EDVA 4IE0A 5CB4E 3ANWA 2HPLA 2K48A 4O8SA 4KMCA 5LHGB 3DP7A 4PK6A 2E8IA 2NTXA 2QGSA 3ZPOA 5C8YE 3GA8A 1NAFA 3NZPA 3RYCE 3G2PA 3KBUA 3PDYA 4V1Av 4PK5A 3PJVD 4P09A 3PUAA 3PE0A 5E0OA 3AA6B 4WNKA 5F8PA 4P0BA 5LOVE 3F31A 4PJJA 3KV5A 5JR9C 3M65A 2X0LB 3HI2A 2W62A 4MLKA 2YU2A 5FXZA 4QX8B 5LP6E 2E9XB 4BJNA 2M67A 2LHNA 3N2GE 5LJNA 1G73A 3O9XA 2V7IA 1LVKA 2DCFA 3CX7B 1HFAA 1D0XA 3KVBA 3WAJA 3KFWX 4ASKA 5L3FB 3KVAA 3E08A 5JVDE 3HKBE 5L3GB 1WRDA 2H7OA 3K3NA 3MK7C 2D0UA 2KT9A 3N2OA 4ZS2A 3KV9A 2CCQA 2LJLA 4HTEA 2XTLA 3KDSE 4CXWA 2IAKA 1ZV4X 3MZKB 1SA0E 1UCUA 4PJNA 4PK4A 2YEVC 4BAYB 3N9NA 3RX6A 3UUNA 2Z6EA 1MNEA 4X1IE 3AA7B 5LXTE 2NP9A 5EK3A 1M3JA 1OXZA 5LCYA 2W0GA 4E7ZA 3KV4A 5JRCA 3C51A 5JRCB 2MOZA 2YU1A 3CVRA 3ZYLA 5EK2A 1OWAA 3N5LA 3ETUA 3CQGB 4HEAA 2E9XC 2V7KA 4DMWA 2V1DB 4EOZB 4G63A 4QXCB 2NW9A 4IE7A 1VOMA 2YINA 3HKDE 2VKHA 2ZMAA 3IBPA 2ZM2A 4PJLA 5TAOA 3WAKA 4EAHA 1MMNA 3IHRA 2L3LA 3HL6A 2BDEA 3DJBA 3LK2B 4I55E 4WBNE 3HA4A 3S4UA 2C5IT 3PUGA 4ZI7E 4BIKA 3N9QA 1S94A 2CXLA 5HXSA 4EXTA 2XQYA 2A3DA 4L5GA 4JLEA 5EZYE 2E9XD 5LHHB 1G8XA 3ZC1A 2DNXA 5JDFA 3CQCB 2LM9A 2V7LA 3F2EA 3HR0A 2K5BB 4N78D 5CA1E 5FY1A 1D1AA 3VHLA 1YW0A 2JJ9A 4HFVA 3I9WA 4I4TE 4MBQA 2NW8A 2L8KA 2VWAA 3EUHA 3L3PA 4QWNB 4ZI3C 3UULA 2JMHA 3RRWA 3AB3B 1MIVA 4KP3C 4NUVA 5F3JA 5JDMA 3RKOA 3N9OA 5KDMC 4PFPA 4U74A 2XAQB 4H63H 3CWZB 3L09A 3PU3A 4UEMA 3F57A 1LKXA 2BVMA 4QXBB 4IDZA 1UX4A 4L9IA 4C90A 2A72A 2VKJA 3ZMTB 4DNDA 2IW5B 2K9AA 3G2QA 3IEEA 4IHJE 3LK42 5JH7E 2VASA 3GN5A 2A2FX 4IIJE 1WLXA 4CXYA 2C5JA 3MXZA 2ZM0A 3AA1B 3H3AA 5L3CB 3BK9A 4C91A 2WSSV 4B6XA 1QSDA 2DWKA 4DBRA 5DJQC 4ZI3D 3QK6A 4QKNA 4AKGA 3N2KE 5ETWA 2MTQA 2NW7A 2X67A 2VKOA 3ANWB 5HYAA 4PW8A 5IYZE 4DBQA 4JEUB 2MBGA 3U78A 3ZYMA 3AVRA 5LGNB 1FMVA 1MIWA 3NZQA 4G2AA 2CXFA 2DWGA 2LSJA 1MIYA 3NRXA 1WYBA 2X66A 4OHFA 5HXRA 4AXPA 4AQFC 2EHOA 4O4HE 3RH3A 3ZJ2A 4F6RC 3CKDA 4EZ4A 3B57A 3GMIA 3P8CD 3T8OA 4GK5E 2ACXA 4XZCA 1YKHB 2LEHA 3RRCA 5LA6E 5L3BB 4EYUA 2IC9A 3PUQA 4UV9B 3ZMZB 2N2NA 3O1HA 4GYSA 5LHIB 2W61A 4PJMA 4WW0A 1BR2A 4HKAA 2LOPA 4MFRA 2DI4A 2XUEA 3J9X1 2KLQA 2VK9A 2XAHB 2X9XA 2KZ7B 3EVYA 4O2BE 3AAAB 5FY0A 4ERRA 1M3IA 2Q9QA 3ZEFB 2X51A 4CI1B 4TUYE 1HCIA 1ZEEA 4O4LE 2CMRA 3NRYA 1U5PA 4UF0A 2JRKA 1SHZC 3ONXA 5FNVE 3A5XA 4KUMB 5HXCA 5LYJE 5LGUB 4IE5A 2KWHA 3LFMA 2EHOC 4AKLA 4ADZA 4HN9A 1HF8A 1IJ5A 5IHYA 3ZCIA 3LJCA 3SRZA 2CM0A 5L2LA 3C4WA 4PNIA 4YLHA 1U4QA 5HAXA 3HVNA 4OYKA 3GWHA 4DVDA 4JUYA 3C4XA 2PJQA 3LBXA 3I1AA 3UT5E 4P0AA 1Y64B 2X9WA 1KNZA 2LE8A 1QUUA 5KX5E 1MMGA 3PTRB 3RYIE 4EZHA 1Z0PA 4H63V 4QX7B 1IJ6A 2Q9QC 3OKQA 5FMNA 3D0TA 2LHRA 3U3IA 2ZLYA 4GK0E 1KK7A 2KINB 3C64A 3B13A 3ZYKA 3ETVA 2H3RA 2VB6A 3Q9DA 4I50E 4OFZA 2PFVA 2RP4A 4TV8E 3N9PA 3KV6A 5LG4A 3I9YA 5AFUL 4XBFB 2N1GA 4GOUA 3JC6C 4UVCB 5FXWA 2CA5A 1AJ3A 2QA7A 4AKHA 5LBQB 2RA1A 3O1IA 2NTYA 3J7Yq 3ESLA 3W15B 1FMWA 4E7SA 3MJXA 3O4XE 5DABA 3ZMVB 4ZOLE 5FXXA 3DTOA 5H6RB 4TV9E 2W00A 3MKDA 2WAUA 2BZBA 1UX5A 2IC6A 4O4JE 2GK9A 3KBTA 4IE6A 4K0UA 4UIGA 2HPJA 4CI2B 1CUNA 5JDNA 4YFSA 2C0SA 4ZHQE 4H9NC 3TKLB 3OJAA 3OBVE 1FEWA 1IZNB 1VRBA 3MACA 1EZ3A 1WYCA 3JC6D 3ZLIA 2CLYB 5ADXL 3PU8A 2DHRA 2D0TA 5A1LA 1YKEB 3RPUA 2C5KT 3GN5B 3CMLA 4H9OC 3HKEE 1HTJF 4CI3B 4HGAA 4XAXB 4CXXA 2WMNA 2CWOA 5H6QB 2UXXB 3ZN0B 3ZMUB 2XAGB 5HXEA 3AAEB 3G2MA 2V7JA 2V26A 3VU7H 2CWYA 2LT3A 4O4IE 5HWYA 3ZC0A 4DMVA 5JDQA 2X68A 2OA5A 4BJMA 1D1CA 2LSGA 1B7TA 2EHOB 3OYZA 5L3EB 3VKGA 3H37A 3K3QC 2Y8DA 2CEAA 1YD8G 5M4YA 2CLYC 3C4ZA 4AKIA 2XASB 1D0YA 2V7MA 4AI6A 4GYRA 4EYYR 4DO0A 5EK4A 2I59A 3P7IA 1LRZA 3LG7A 1NWMX 2SPCA 2VL8A 3CPZA 4PFOA 4O2AE 2LOSA 2YK0A 4UELA 4A56A 2ES0A 1BR0A 4KBMB 3V5UA 4CQIA 1MMDA 1S3RA 2K24A 3ZCJA 4OK0A 1US7B 2Q9QB 4H9SE 4UVBB 3O1JA 2ODUA 5HWXA 5LGTB 3CQFA 2N9DA 3IF8B 3R84B 1BR1A 2E9XA 1MMAA 4UF0B 5LJMA 3K3OA 2X9YA 2WBLA 3AVSA 4YHJA 4YJ3E 3LK3B 4X20E 1O3XA 2JQQA 5BMVE 1HS7A 3RC8A 2NWBA 3UUXB 2XAJB 4ISSA 3I0OA 5JDGA 4IE4A 4BA9A 3MA9A 3C50A 4HE8A 5KMGP 4ZS3A 5JDHA 4PAGA 2LSYA 4Z8XA 3RC3A 3CX6B 3KINB 4I43B 1X79A 5FY7A 2CE7A 4MHCA 4GIWA 3LBXB 4MALA 5FYMA 3SOLA 4U72A 5J1GA 5LNKA 4UVAB 5JREA 2L9QA 2MYSA 4ZI2C 1PFOA 4L0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 B; 
#chains in the Genus database with same CATH topology
 3BQK A;  1HG2 A;  2EHO D;  3RGL A;  4FI5 A;  1D0Z A;  2DL1 A;  3JAF A;  2ACZ A;  4YTM A;  3RYF E;  4H9P C;  2MPK A;  4JI3 T;  2KND A;  1N33 T;  1NEK A;  2UUC T;  2BKN A;  3ZN1 B;  1XMQ T;  3SS1 A;  5HXH A;  1XWM A;  2LSI A;  2G0U A;  2KMF A;  4HFC A;  4JI1 T;  3NBX X;  3SFD A;  3AA0 B;  1D1B A;  3FZH B;  4NUU A;  1IBL T;  2ZM8 A;  5CA0 E;  2Y6X A;  2PTF A;  4TN7 B;  2BS2 A;  4H9R C;  4X5T A;  3FB2 A;  4IGU A;  2BVL A;  5AQS B;  3QUJ A;  5CGM A;  2HH7 A;  4ILU A;  3PUR A;  3SWH A;  5L4H A;  4IST A;  4AKR B;  2PBI A;  4LMK A;  2D5U A;  4IDQ A;  3P4S A;  4ANJ A;  4UXN B;  1J1J A;  3E22 E;  3ZMS B;  1MND A;  2K48 A;  3LDQ B;  2X0Y A;  3GA8 A;  2FBW A;  3NZP A;  3RYC E;  2LKG A;  4P09 A;  3PUA A;  3RHW A;  4HFE A;  3F31 A;  4PJJ A;  2X0L B;  4QX8 B;  5LP6 E;  4BJN A;  3PUV F;  1LVK A;  1HFA A;  4LF8 T;  3WAJ A;  1JNZ A;  3KFW X;  4ASK A;  5HEH A;  2D9D A;  2H7O A;  3K3N A;  2KT9 A;  2QRX A;  2BG9 A;  1UCU A;  4PK4 A;  4LFA T;  2I0M A;  3UUN A;  1M3J A;  5LCY A;  4DV1 T;  3CVR A;  5EK2 A;  2KSR A;  2V7K A;  2V1D B;  4QXC B;  2NW9 A;  2YIN A;  4GKJ T;  4A98 A;  3HKD E;  2ZM2 A;  4EAH A;  1MMN A;  3HL6 A;  3A8Y C;  3ZT5 A;  3S4U A;  4ZI7 E;  4BIK A;  4DV6 T;  1S94 A;  5HXS A;  2XQY A;  1X9B A;  4L5G A;  5LHH B;  4LF5 T;  3RIA A;  2V5C A;  2V5D A;  2BS3 A;  3VHL A;  1YW0 A;  4IT4 A;  2L8K A;  3L3P A;  2UXC T;  3RRW A;  2XM1 A;  3UU4 A;  4KP3 C;  1KNR A;  5KDM C;  4U74 A;  1L0V A;  3CWZ B;  5BR8 T;  1KF6 A;  3UU5 A;  2UXD T;  4JI4 T;  1VCS A;  4IDZ A;  2IW5 B;  3LK4 2;  5JH7 E;  1WLX A;  4OX9 T;  4U31 A;  3MXZ A;  1IBM T;  2WSS V;  1QSD A;  5DJQ C;  4QKN A;  3ANW B;  5HYA A;  4PW8 A;  4DBQ A;  3U78 A;  4G2A A;  4HFD A;  4HWI B;  2EHO A;  3P8C D;  3T1H T;  3P4W A;  2ACX A;  5L3B B;  2IC9 A;  3PUQ A;  3ZMZ B;  2H89 A;  4U3C A;  5LHI B;  2V8S V;  2W61 A;  1BR2 A;  4HKA A;  2LRK A;  1XNQ T;  2XUE A;  3J9X 1;  3EAB A;  2X9X A;  3EVY A;  2WU5 A;  5FY0 A;  2WZH A;  1HCI A;  3NRY A;  4HWC A;  3ONX A;  2HN2 A;  4KUM B;  2A9U A;  2EHO C;  4UR9 A;  4ADZ A;  1I6Z A;  1IJ5 A;  3LJC A;  2VQF T;  5L2L A;  5L47 A;  4PNI A;  2YDR A;  4JUY A;  3LBX A;  4DV7 T;  3PUY F;  4DV4 T;  1MMG A;  2XQ6 A;  1JNR A;  2FJB A;  3QOF A;  3U3I A;  3AED A;  3ZYK A;  2H3R A;  3Q9D A;  4XBF B;  3JC6 C;  4UVC B;  1XMO T;  2QA7 A;  3W15 B;  3AEF A;  2RPA A;  5DAB A;  4ZOL E;  5FXX A;  5H6R B;  4TV9 E;  2BZB A;  4O4J E;  3KBT A;  5AQU B;  4K0U A;  2HPJ A;  1CUN A;  4YFS A;  4YY3 T;  4NXN T;  3OBV E;  1FEW A;  4ILA A;  2XQ7 A;  5A1L A;  1YKE B;  3CML A;  3HKE E;  4CI3 B;  4XAX B;  4CXX A;  2WMN A;  2CWO A;  2YDQ A;  2XAG B;  3VU7 H;  2CWY A;  4TNV A;  3G06 A;  4O4I E;  3ZC0 A;  4DMV A;  5IWA T;  4BJM A;  1B7T A;  5F5W A;  4TWH A;  3H37 A;  2W2U A;  3L8R A;  2XQ4 A;  1DTV A;  4QH5 A;  4AKI A;  2XAS B;  2WWV A;  3NVO A;  2I59 A;  3P7I A;  4DUZ T;  1LRZ A;  1T7S A;  2SPC A;  2V6X A;  2VL8 A;  3LG7 A;  4PFO A;  1BR0 A;  2ES0 A;  2BKP A;  3V5U A;  1S3R A;  2K24 A;  3AEC A;  3ZCJ A;  4UVB B;  2ODU A;  2N9D A;  3R84 B;  1BR1 A;  1MMA A;  2XQ8 A;  3P4R A;  3RQU A;  3AVS A;  4U2Z A;  3K1S A;  4YHJ A;  1OED A;  2MAW A;  3NKZ A;  5BMV E;  5JDG A;  4IE4 A;  3MA9 A;  4ZZB A;  3Q5D A;  5JDH A;  4I43 B;  1X79 A;  2R6G F;  3SOL A;  4U72 A;  2QYW A;  5J1G A;  4UVA B;  5JRE A;  1NEN A;  2L9Q A;  3UQ4 A;  4ZHQ E;  4L0R A;  1HR0 T;  5J2U E;  3ZT6 A;  1IAP A;  2XAF B;  3BQI A;  2VKD A;  3TLS A;  2P9B A;  3T1Y T;  1M62 A;  1E1H B;  5FP3 A;  4QXH B;  2Q9Q D;  3RYH E;  2YN6 A;  2FUP A;  5GON E;  3JAE A;  4JI6 T;  3X1D A;  2NOX A;  1UGO A;  4AQG A;  4EEB A;  3Q5X A;  5LBM A;  3QB5 K;  3ZJ1 A;  2J1D G;  5JDL A;  3K8P C;  3ZT7 A;  5AQL B;  5LG3 A;  5JR9 A;  5AQH B;  5JR9 B;  1FIO A;  5J2T E;  3B5M A;  4J2C A;  3OYX A;  1T98 A;  4CZZ B;  4FJO A;  3N9M A;  3EDV A;  5CB4 E;  3AE4 A;  4O8S A;  4KMC A;  4PK6 A;  5C8Y E;  2IML A;  2V6Y B;  3PJV D;  1ZFL A;  5LOV E;  5JR9 C;  5AQP B;  4DV0 T;  1E2A A;  2E5L T;  2E9X B;  3CK6 A;  1D0X A;  3KVA A;  4X62 T;  3N2O A;  4TNW A;  2LJL A;  4A97 A;  4CXW A;  1ZV4 X;  2YEV C;  4BAY B;  3RX6 A;  2F4V T;  1MNE A;  1E7P A;  4X1I E;  5EK3 A;  4CN4 A;  3TLW A;  4E7Z A;  4LML A;  4IDO A;  5ABG A;  2MOZ A;  2YU1 A;  1N34 T;  3ZYL A;  5AQO B;  2E9X C;  4DMW A;  2JQ9 A;  5AQV B;  3UFG A;  5LMN T;  3IBP A;  4IDN A;  4PJL A;  4YHH T;  3WAK A;  4JBW F;  2BDE A;  1XZY A;  2WQY A;  4LFC T;  3N9Q A;  4HWF A;  2CXL A;  4EXT A;  2A3D A;  4JLE A;  2J47 A;  1G8X A;  2DNX A;  2V7L A;  4I0U A;  5FY1 A;  1D1A A;  3P50 A;  2JJ9 A;  3AB3 B;  2JQK A;  4UEM A;  3F57 A;  1LKX A;  3AE2 A;  3G2Q A;  3GN5 A;  4IIJ E;  2C5J A;  2ZM0 A;  3AA1 B;  3H3A A;  3BK9 A;  2XM2 A;  1W0A A;  4ZI3 D;  2X67 A;  4KX6 A;  1W09 A;  5IYZ E;  4JEU B;  5LGN B;  1HNX T;  1FMV A;  1MIW A;  5CJ5 A;  4DV5 T;  2DWG A;  5FL0 A;  1MIY A;  4AXP A;  1WYB A;  2X66 A;  5HXR A;  4O4H E;  3RI5 A;  4F6R C;  3B57 A;  4X66 T;  2WP9 A;  3AEB A;  2LEH A;  3RRC A;  3VRB A;  2VVS A;  2WB5 A;  4MFR A;  2KLQ A;  2XAH B;  4O2B E;  3AAA B;  4ERR A;  2BG9 B;  2Q9Q A;  4CI1 B;  2CMR A;  1U5P A;  1SHZ C;  2XPK A;  2KWH A;  1T8B A;  4AKL A;  5IHY A;  3SRZ A;  2AE9 A;  5JTG A;  3C4W A;  4YLH A;  1N32 T;  2I6H A;  3SFE A;  1U4Q A;  5HAX A;  3HVN A;  4OYK A;  3C4X A;  2PJQ A;  3JCF A;  2LLY A;  1Y64 B;  1Z0P A;  1CHU A;  4JI8 T;  4QX7 B;  2BG9 C;  4JYA T;  2Q9Q C;  1YQ4 A;  2LHR A;  4GK0 E;  1KK7 A;  3C64 A;  3B13 A;  3ETV A;  2PFV A;  2RP4 A;  5AFU L;  5FXW A;  1I94 T;  5AQM B;  2RA1 A;  2NTY A;  3ESL A;  3ZMV B;  3AE1 A;  2W00 A;  3MKD A;  2H88 A;  1GQE A;  5C2T A;  2GK9 A;  4IE6 A;  4UIG A;  5JDN A;  2C0S A;  2XQ5 A;  1VRB A;  1WYC A;  2UU9 T;  5ADX L;  4K0K T;  4B3T T;  4H9O C;  4LF7 T;  4DR3 T;  3VRA A;  5HCM A;  2WDV A;  5C3J A;  2V7J A;  4F8H A;  4NIQ A;  4TWF A;  3EAM A;  4YT0 A;  2OA5 A;  2LSG A;  2EHO B;  3K3Q C;  2CEA A;  3AXJ A;  1YD8 G;  1D0Y A;  4AI6 A;  5EK4 A;  2BKO A;  5ABE A;  1SE7 A;  2W67 A;  4O2A E;  2LOS A;  4OK0 A;  4H9S E;  3IF8 B;  5LJM A;  4U2Y A;  2WBL A;  5HCJ A;  4YJ3 E;  3UU8 A;  2NWB A;  2IUB A;  3UUX B;  4ISS A;  4EGW A;  3C50 A;  2LSY A;  5AQQ B;  4MHC A;  4GKK T;  3LBX B;  2BBJ A;  2MYS A;  3BQL A;  2DLR A;  1HX8 A;  2Y48 B;  1H7C A;  2CHN A;  4YSX A;  3CIR A;  3WI3 A;  3Q2M A;  3FXE B;  2WMO A;  4B3R T;  4ZI2 D;  3N9L A;  4TZ4 C;  2JMK A;  2CXD A;  3FZL B;  3EHZ A;  2LKH A;  5AQI B;  2BS4 A;  4HSC X;  2KXP B;  4OYJ A;  3VKH A;  2UXN B;  3PUZ F;  2ABZ C;  3PUS A;  2W63 A;  3I0Q A;  5DQV A;  1ZKE A;  2LM2 A;  3FXD B;  4YSY A;  4TX5 A;  3FBZ A;  4AQF A;  2YKS A;  3OPC A;  4YJ2 E;  3UFE A;  4WBO A;  4X1K E;  1W0B A;  5AQN B;  3G2O A;  4QH1 A;  5DQW A;  3C98 B;  3AAI A;  3E0Z A;  1HG5 A;  4EB6 E;  2JIW A;  2XY8 B;  4H9Q C;  2QVA A;  3V5S A;  2WWU A;  2HPL A;  2E5V A;  3DP7 A;  2E8I A;  2NTX A;  1NAF A;  3KBU A;  3AA6 B;  4WNK A;  4P0B A;  3HI2 A;  2W62 A;  4MLK A;  2YU2 A;  2VL0 A;  1W9R A;  2LHN A;  3N2G E;  5LJN A;  3O9X A;  2V7I A;  3CX7 B;  1OED B;  3AEA A;  3E08 A;  4NXM T;  5JVD E;  3MK7 C;  2WU2 A;  3KV9 A;  3KDS E;  2HN1 A;  3ABV A;  2IAK A;  3MZK B;  1XNR T;  2XSB A;  3ONJ A;  3N9N A;  4DR2 T;  2Z6E A;  1OXZ A;  3P4Q A;  3KV4 A;  2W66 A;  3C51 A;  5FVK A;  3CQG B;  4HEA A;  3ZSS A;  4EOZ B;  4KHP T;  4ZXL A;  1OED C;  1VOM A;  2ZMA A;  1WFD A;  2XQ9 A;  1ZP0 A;  4HWH A;  5HEJ A;  3IHR A;  4WBN E;  3DJB A;  3LK2 B;  3HA4 A;  4ZEY A;  2C5I T;  3PUG A;  2YOE A;  2BBH A;  5EZY E;  3ZC1 A;  2WDQ A;  5JDF A;  4EED A;  3RIU A;  2K5B B;  4N78 D;  4LFB T;  4I4T E;  3I9W A;  2VWA A;  2VUR A;  3Q5E A;  3PUW F;  5AQR B;  2CPT A;  1MIV A;  3FZM B;  1Z8U A;  3N9O A;  2ZM6 T;  2XAQ B;  3L09 A;  3AE9 A;  4YXD A;  3RF1 A;  5J0Z A;  1UX4 A;  4L9I A;  2VKJ A;  2VVN A;  2WS3 A;  5AQG B;  4DV3 T;  3NWI A;  2A2F X;  3H3M A;  2UXB T;  5L3C B;  5KXJ A;  4C91 A;  1UUS A;  4AKG A;  5ETW A;  3EI0 A;  5ABF A;  2MBG A;  3AE6 A;  3AVR A;  3NRX A;  5L4E A;  4OHF A;  3CKD A;  4EZ4 A;  3GMI A;  3T8O A;  4GK5 E;  1WR0 A;  4WZX A;  4XZC A;  2XZE A;  5LA6 E;  4EYU A;  4UV9 B;  2J4G A;  4GYS A;  4U7Y A;  4PJM A;  4WW0 A;  2IDO B;  4IL4 A;  1M3I A;  1XDP A;  4TUY E;  1ZEE A;  2M6B A;  3L39 A;  4O4L E;  4UF0 A;  5FNV E;  1QLB A;  2XQ3 A;  4CN1 A;  5LGU B;  3QB5 A;  2CM0 A;  4YTP A;  3GWH A;  1N36 T;  3PJA J;  2X9W A;  1KNZ A;  2LE8 A;  1QUU A;  2NR4 A;  3RYI E;  3PTR B;  4EZH A;  2FJD A;  4H63 V;  2KIN B;  2VB6 A;  2UUA T;  4OFZ A;  4TV8 E;  4HFH A;  2N1G A;  1AJ3 A;  4AKH A;  5LBQ B;  3O1I A;  3AE3 A;  4E7S A;  3J7Y q;  1FMW A;  3MJX A;  3O4X E;  4JI7 T;  2WY2 A;  3DTO A;  4X64 T;  1UX5 A;  2AXD S;  3UUB A;  4CI2 B;  4H9N C;  4ZZC A;  1IZN B;  3JC6 D;  2CLY B;  3OTO T;  3PU8 A;  2DHR A;  2D0T A;  3RPU A;  3GN5 B;  1HTJ F;  4HGA A;  2UXX B;  4NPP A;  3ZMU B;  3AAE B;  2K3W A;  4DR7 T;  2CBJ A;  5HWY A;  4AIU A;  2E2A A;  3UU3 A;  2HHH T;  2X68 A;  2FJE A;  1D1C A;  5L3E B;  2X0H A;  3VKG A;  2Y8D A;  2WCA A;  5M4Y A;  1YXR A;  2CLY C;  5AQT B;  4HFI A;  4GYR A;  4EYY R;  4ILB A;  2YK0 A;  4UEL A;  1T72 A;  4KBM B;  2YDS A;  4CQI A;  4JI2 T;  1US7 B;  4A5X A;  2Q9Q B;  2CHO A;  3CQF A;  2BG9 E;  1SUM B;  2X9Y A;  3AE7 A;  4X20 E;  1O3X A;  2XSA A;  4BA9 A;  1UUR A;  4HE8 A;  5KMG P;  4PAG A;  3KIN B;  5FY7 A;  2CE7 A;  4CN6 A;  4MAL A;  5FYM A;  5LNK A;  1PFO A;  3ZST A;  3Q5W A;  2KWI B;  2JPF A;  4JEH B;  3FBL A;  1ZHC A;  3CQX C;  5L3D B;  2ODV A;  2M6I A;  4EIW A;  2X9H A;  4Z90 A;  3EDU A;  2B1E A;  2WM9 A;  4AQY T;  4DUY T;  3HKC E;  3JAD A;  5FXV A;  1HNW T;  3FHN A;  5JQG E;  1V9D A;  4EV6 A;  4UV8 B;  5HEU A;  2XHE B;  5LB7 B;  4DR1 T;  3CX8 B;  1BR4 A;  4QH4 A;  4X1Y E;  4B3M T;  2D2S A;  3QC9 A;  3RIF A;  2OV9 A;  1WR6 A;  2PG8 A;  2H7V C;  2LSK A;  3R6N A;  4QHO A;  1LVF A;  4KI0 F;  2XJ7 A;  3UTK A;  1S35 A;  3FZK B;  3UUM A;  3AXJ B;  4M1P A;  2UUB T;  4IE0 A;  3ANW A;  2XQA A;  5LHG B;  5AQF B;  3ZPO A;  2QGS A;  4LMJ A;  3G2P A;  3PDY A;  4V1A v;  4HWD A;  4PK5 A;  3PE0 A;  5E0O A;  5F8P A;  1DTD B;  3KV5 A;  3M65 A;  4AIS A;  5FXZ A;  1KEY A;  2M67 A;  5FL1 A;  1G73 A;  1YQ3 A;  2DCF A;  3M3Z B;  3KVB A;  5IUX A;  5L3F B;  1DU2 A;  5L3G B;  3HKB E;  1WRD A;  5FVL A;  2D0U A;  4ZS2 A;  2CCQ A;  2IIU A;  4HTE A;  2XTL A;  2JQH A;  4PJN A;  1SA0 E;  2IHR 1;  3PV0 F;  3QNU A;  5LXT E;  3TLV A;  3AA7 B;  2NP9 A;  1KFY A;  2W0G A;  4U33 A;  5JRC A;  5JRC B;  1OWA A;  3N5L A;  3ETU A;  4G63 A;  4IE7 A;  5CFB A;  2WZI A;  3TLU A;  2VKH A;  3RQW A;  5TAO A;  2VQE T;  2L3L A;  4I55 E;  4WYV A;  4DR5 T;  2E9X D;  3CQC B;  2LM9 A;  3F2E A;  3HR0 A;  5CA1 E;  4MBQ A;  4HFV A;  2NW8 A;  3EUH A;  4QWN B;  4ZI3 C;  3UUL A;  2JMH A;  4NUV A;  5F3J A;  5JDM A;  3RKO A;  4Q25 A;  4PFP A;  4H63 H;  3PU3 A;  2BVM A;  4QXB B;  3PUX F;  4C90 A;  2A72 A;  3ZMT B;  4DND A;  2K9A A;  1ZFI A;  3IEE A;  4B3S T;  4IHJ E;  2VAS A;  4CXY A;  3OVU A;  1ZOY A;  3TLT A;  1XDO A;  4B6X A;  2DWK A;  4DBR A;  3QK6 A;  3N2K E;  2MTQ A;  5HEO A;  2NW7 A;  4JV5 T;  2VKO A;  3A7M A;  2CBI A;  3ZYM A;  1IBK T;  3NZQ A;  4IL9 A;  2CXF A;  2LSJ A;  4IRE A;  3UQ7 A;  4DV2 T;  4AQF C;  3ZJ2 A;  3RH3 A;  1YKH B;  2N2N A;  3O1H A;  3PJA A;  3ZKR A;  4ILC A;  2LOP A;  2DI4 A;  1OED E;  2VK9 A;  2KZ7 B;  3RKG A;  1J5E T;  4LF6 T;  4COF A;  5FKY A;  1WCR A;  3ZEF B;  2X51 A;  2B76 A;  4LF4 T;  2JRK A;  3A5X A;  3AEG A;  5HXC A;  4YTN A;  5LYJ E;  1VCT A;  4IE5 A;  3LFM A;  1J5W A;  2CRB A;  4HN9 A;  1HF8 A;  3ZCI A;  5LMU T;  1HNZ T;  4DVD A;  3I1A A;  3UT5 E;  4P0A A;  5KX5 E;  2FJA A;  1IJ6 A;  1KNP A;  3OKQ A;  5FMN A;  4U7I A;  3D0T A;  3RLF F;  2ZLY A;  3FZF B;  4I50 E;  1HX1 B;  3N9P A;  3KV6 A;  5LG4 A;  3I9Y A;  4GOU A;  4X65 T;  2CA5 A;  1R8I A;  3VR8 A;  2WAU A;  2IC6 A;  3AE8 A;  4LF9 T;  4P1N A;  1Y01 A;  3TKL B;  3OJA A;  1UK5 A;  3MAC A;  2WDR A;  1EZ3 A;  3ZLI A;  2J62 A;  2C5K T;  5ABH A;  2LRL A;  3AEE A;  5H6Q B;  3LSV A;  3ZN0 B;  3RIU C;  5HXE A;  4TWD A;  3G2M A;  4KHZ F;  2V26 A;  1FJG T;  2LT3 A;  5ABF B;  5JDQ A;  4IDP A;  4HFB A;  4JI5 T;  3OYZ A;  3C4Z A;  2V7M A;  3P4P A;  4DO0 A;  2V6Y A;  4YSZ A;  1NWM X;  3CPZ A;  4A56 A;  5AQJ B;  1MMD A;  3O1J A;  5HWX A;  5LGT B;  4DID B;  2E9X A;  3AE5 A;  4UF0 B;  4DR6 T;  3K3O A;  3ONL C;  3LK3 B;  2JQQ A;  1HS7 A;  3RC8 A;  2W4X A;  5AQK B;  2XAJ B;  4JI0 T;  3I0O A;  4ZS3 A;  3RC3 A;  4Z8X A;  1M7K A;  3CX6 B;  4DR4 T;  4Z91 A;  3IA3 A;  4GIW A;  3VR9 A;  3UU6 A;  2OLT A;  5HEG A;  4ZI2 C; 
#chains in the Genus database with same CATH homology
 3BQL A;  3Q5W A;  3BQK A;  2KWI B;  1HG2 A;  2DLR A;  2EHO D;  2JPF A;  4FI5 A;  1HX8 A;  2Y48 B;  1D0Z A;  4JEH B;  5J2U E;  3FBL A;  1ZHC A;  1H7C A;  3CQX C;  3RYF E;  1IAP A;  5L3D B;  2ODV A;  2XAF B;  4EIW A;  3BQI A;  4H9P C;  2VKD A;  2X9H A;  2KND A;  3WI3 A;  3EDU A;  3Q2M A;  3FXE B;  2P9B A;  2B1E A;  2WM9 A;  3HKC E;  2WMO A;  3ZN1 B;  1E1H B;  3SS1 A;  5FP3 A;  5HXH A;  2LSI A;  4ZI2 D;  3N9L A;  2G0U A;  4QXH B;  2KMF A;  4TZ4 C;  5FXV A;  3FHN A;  5JQG E;  2JMK A;  2CXD A;  2Q9Q D;  1V9D A;  3NBX X;  4UV8 B;  3RYH E;  3AA0 B;  1D1B A;  4NUU A;  5GON E;  2XHE B;  4HSC X;  2KXP B;  2ZM8 A;  3CX8 B;  2NOX A;  4OYJ A;  3VKH A;  2UXN B;  4AQG A;  5CA0 E;  2Y6X A;  3Q5X A;  3PUS A;  4TN7 B;  5LBM A;  1BR4 A;  3ZJ1 A;  2W63 A;  3I0Q A;  5DQV A;  1ZKE A;  3FXD B;  4X1Y E;  2J1D G;  4TX5 A;  2D2S A;  3FBZ A;  4H9R C;  4AQF A;  5JDL A;  3FB2 A;  4IGU A;  3K8P C;  2BVL A;  4YJ2 E;  3QUJ A;  3UFE A;  5JR9 A;  4WBO A;  3QC9 A;  4X1K E;  5JR9 B;  1FIO A;  3G2O A;  2HH7 A;  1WR6 A;  2PG8 A;  4ILU A;  3PUR A;  3SWH A;  5J2T E;  2H7V C;  5DQW A;  3C98 B;  3AAI A;  3E0Z A;  4IST A;  4AKR B;  2LSK A;  3R6N A;  1HG5 A;  2PBI A;  4QHO A;  2D5U A;  1LVF A;  4EB6 E;  3UTK A;  4ANJ A;  4J2C A;  4UXN B;  3OYX A;  4H9Q C;  1T98 A;  4CZZ B;  1S35 A;  4FJO A;  3E22 E;  3N9M A;  3V5S A;  3UUM A;  3ZMS B;  2WWU A;  4M1P A;  1MND A;  3EDV A;  4IE0 A;  5CB4 E;  3ANW A;  2HPL A;  2K48 A;  4O8S A;  4KMC A;  5LHG B;  3DP7 A;  4PK6 A;  2E8I A;  2NTX A;  2QGS A;  3ZPO A;  5C8Y E;  3GA8 A;  1NAF A;  3NZP A;  3RYC E;  3G2P A;  3KBU A;  3PDY A;  4V1A v;  4PK5 A;  3PJV D;  4P09 A;  3PUA A;  3PE0 A;  5E0O A;  3AA6 B;  4WNK A;  5F8P A;  4P0B A;  5LOV E;  3F31 A;  4PJJ A;  3KV5 A;  5JR9 C;  3M65 A;  2X0L B;  3HI2 A;  2W62 A;  4MLK A;  2YU2 A;  5FXZ A;  4QX8 B;  5LP6 E;  2E9X B;  4BJN A;  2M67 A;  2LHN A;  3N2G E;  5LJN A;  1G73 A;  3O9X A;  2V7I A;  1LVK A;  2DCF A;  3CX7 B;  1HFA A;  1D0X A;  3KVB A;  3WAJ A;  3KFW X;  4ASK A;  5L3F B;  3KVA A;  3E08 A;  5JVD E;  3HKB E;  5L3G B;  1WRD A;  2H7O A;  3K3N A;  3MK7 C;  2D0U A;  2KT9 A;  3N2O A;  4ZS2 A;  3KV9 A;  2CCQ A;  2LJL A;  4HTE A;  2XTL A;  3KDS E;  4CXW A;  2IAK A;  1ZV4 X;  3MZK B;  1SA0 E;  1UCU A;  4PJN A;  4PK4 A;  2YEV C;  4BAY B;  3N9N A;  3RX6 A;  3UUN A;  2Z6E A;  1MNE A;  4X1I E;  3AA7 B;  5LXT E;  2NP9 A;  5EK3 A;  1M3J A;  1OXZ A;  5LCY A;  2W0G A;  4E7Z A;  3KV4 A;  5JRC A;  3C51 A;  5JRC B;  2MOZ A;  2YU1 A;  3CVR A;  3ZYL A;  5EK2 A;  1OWA A;  3N5L A;  3ETU A;  3CQG B;  4HEA A;  2E9X C;  2V7K A;  4DMW A;  2V1D B;  4EOZ B;  4G63 A;  4QXC B;  2NW9 A;  4IE7 A;  1VOM A;  2YIN A;  3HKD E;  2VKH A;  2ZMA A;  3IBP A;  2ZM2 A;  4PJL A;  5TAO A;  3WAK A;  4EAH A;  1MMN A;  3IHR A;  2L3L A;  3HL6 A;  2BDE A;  3DJB A;  3LK2 B;  4I55 E;  4WBN E;  3HA4 A;  3S4U A;  2C5I T;  3PUG A;  4ZI7 E;  4BIK A;  3N9Q A;  1S94 A;  2CXL A;  5HXS A;  4EXT A;  2XQY A;  2A3D A;  4L5G A;  4JLE A;  5EZY E;  2E9X D;  5LHH B;  1G8X A;  3ZC1 A;  2DNX A;  5JDF A;  3CQC B;  2LM9 A;  2V7L A;  3F2E A;  3HR0 A;  2K5B B;  4N78 D;  5CA1 E;  5FY1 A;  1D1A A;  3VHL A;  1YW0 A;  2JJ9 A;  4HFV A;  3I9W A;  4I4T E;  4MBQ A;  2NW8 A;  2L8K A;  2VWA A;  3EUH A;  3L3P A;  4QWN B;  4ZI3 C;  3UUL A;  2JMH A;  3RRW A;  3AB3 B;  1MIV A;  4KP3 C;  4NUV A;  5F3J A;  5JDM A;  3RKO A;  3N9O A;  5KDM C;  4PFP A;  4U74 A;  2XAQ B;  4H63 H;  3CWZ B;  3L09 A;  3PU3 A;  4UEM A;  3F57 A;  1LKX A;  2BVM A;  4QXB B;  4IDZ A;  1UX4 A;  4L9I A;  4C90 A;  2A72 A;  2VKJ A;  3ZMT B;  4DND A;  2IW5 B;  2K9A A;  3G2Q A;  3IEE A;  4IHJ E;  3LK4 2;  5JH7 E;  2VAS A;  3GN5 A;  2A2F X;  4IIJ E;  1WLX A;  4CXY A;  2C5J A;  3MXZ A;  2ZM0 A;  3AA1 B;  3H3A A;  5L3C B;  3BK9 A;  4C91 A;  2WSS V;  4B6X A;  1QSD A;  2DWK A;  4DBR A;  5DJQ C;  4ZI3 D;  3QK6 A;  4QKN A;  4AKG A;  3N2K E;  5ETW A;  2MTQ A;  2NW7 A;  2X67 A;  2VKO A;  3ANW B;  5HYA A;  4PW8 A;  5IYZ E;  4DBQ A;  4JEU B;  2MBG A;  3U78 A;  3ZYM A;  3AVR A;  5LGN B;  1FMV A;  1MIW A;  3NZQ A;  4G2A A;  2CXF A;  2DWG A;  2LSJ A;  1MIY A;  3NRX A;  1WYB A;  2X66 A;  4OHF A;  5HXR A;  4AXP A;  4AQF C;  2EHO A;  4O4H E;  3RH3 A;  3ZJ2 A;  4F6R C;  3CKD A;  4EZ4 A;  3B57 A;  3GMI A;  3P8C D;  3T8O A;  4GK5 E;  2ACX A;  4XZC A;  1YKH B;  2LEH A;  3RRC A;  5LA6 E;  5L3B B;  4EYU A;  2IC9 A;  3PUQ A;  4UV9 B;  3ZMZ B;  2N2N A;  3O1H A;  4GYS A;  5LHI B;  2W61 A;  4PJM A;  4WW0 A;  1BR2 A;  4HKA A;  2LOP A;  4MFR A;  2DI4 A;  2XUE A;  3J9X 1;  2KLQ A;  2VK9 A;  2XAH B;  2X9X A;  2KZ7 B;  3EVY A;  4O2B E;  3AAA B;  5FY0 A;  4ERR A;  1M3I A;  2Q9Q A;  3ZEF B;  2X51 A;  4CI1 B;  4TUY E;  1HCI A;  1ZEE A;  4O4L E;  2CMR A;  3NRY A;  1U5P A;  4UF0 A;  2JRK A;  1SHZ C;  3ONX A;  5FNV E;  3A5X A;  4KUM B;  5HXC A;  5LYJ E;  5LGU B;  4IE5 A;  2KWH A;  3LFM A;  2EHO C;  4AKL A;  4ADZ A;  4HN9 A;  1HF8 A;  1IJ5 A;  5IHY A;  3ZCI A;  3LJC A;  3SRZ A;  2CM0 A;  5L2L A;  3C4W A;  4PNI A;  4YLH A;  1U4Q A;  5HAX A;  3HVN A;  4OYK A;  3GWH A;  4DVD A;  4JUY A;  3C4X A;  2PJQ A;  3LBX A;  3I1A A;  3UT5 E;  4P0A A;  1Y64 B;  2X9W A;  1KNZ A;  2LE8 A;  1QUU A;  5KX5 E;  1MMG A;  3PTR B;  3RYI E;  4EZH A;  1Z0P A;  4H63 V;  4QX7 B;  1IJ6 A;  2Q9Q C;  3OKQ A;  5FMN A;  3D0T A;  2LHR A;  3U3I A;  2ZLY A;  4GK0 E;  1KK7 A;  2KIN B;  3C64 A;  3B13 A;  3ZYK A;  3ETV A;  2H3R A;  2VB6 A;  3Q9D A;  4I50 E;  4OFZ A;  2PFV A;  2RP4 A;  4TV8 E;  3N9P A;  3KV6 A;  5LG4 A;  3I9Y A;  5AFU L;  4XBF B;  2N1G A;  4GOU A;  3JC6 C;  4UVC B;  5FXW A;  2CA5 A;  1AJ3 A;  2QA7 A;  4AKH A;  5LBQ B;  2RA1 A;  3O1I A;  2NTY A;  3J7Y q;  3ESL A;  3W15 B;  1FMW A;  4E7S A;  3MJX A;  3O4X E;  5DAB A;  3ZMV B;  4ZOL E;  5FXX A;  3DTO A;  5H6R B;  4TV9 E;  2W00 A;  3MKD A;  2WAU A;  2BZB A;  1UX5 A;  2IC6 A;  4O4J E;  2GK9 A;  3KBT A;  4IE6 A;  4K0U A;  4UIG A;  2HPJ A;  4CI2 B;  1CUN A;  5JDN A;  4YFS A;  2C0S A;  4ZHQ E;  4H9N C;  3TKL B;  3OJA A;  3OBV E;  1FEW A;  1IZN B;  1VRB A;  3MAC A;  1EZ3 A;  1WYC A;  3JC6 D;  3ZLI A;  2CLY B;  5ADX L;  3PU8 A;  2DHR A;  2D0T A;  5A1L A;  1YKE B;  3RPU A;  2C5K T;  3GN5 B;  3CML A;  4H9O C;  3HKE E;  1HTJ F;  4CI3 B;  4HGA A;  4XAX B;  4CXX A;  2WMN A;  2CWO A;  5H6Q B;  2UXX B;  3ZN0 B;  3ZMU B;  2XAG B;  5HXE A;  3AAE B;  3G2M A;  2V7J A;  2V26 A;  3VU7 H;  2CWY A;  2LT3 A;  4O4I E;  5HWY A;  3ZC0 A;  4DMV A;  5JDQ A;  2X68 A;  2OA5 A;  4BJM A;  1D1C A;  2LSG A;  1B7T A;  2EHO B;  3OYZ A;  5L3E B;  3VKG A;  3H37 A;  3K3Q C;  2Y8D A;  2CEA A;  1YD8 G;  5M4Y A;  2CLY C;  3C4Z A;  4AKI A;  2XAS B;  1D0Y A;  2V7M A;  4AI6 A;  4GYR A;  4EYY R;  4DO0 A;  5EK4 A;  2I59 A;  3P7I A;  1LRZ A;  3LG7 A;  1NWM X;  2SPC A;  2VL8 A;  3CPZ A;  4PFO A;  4O2A E;  2LOS A;  2YK0 A;  4UEL A;  4A56 A;  2ES0 A;  1BR0 A;  4KBM B;  3V5U A;  4CQI A;  1MMD A;  1S3R A;  2K24 A;  3ZCJ A;  4OK0 A;  1US7 B;  2Q9Q B;  4H9S E;  4UVB B;  3O1J A;  2ODU A;  5HWX A;  5LGT B;  3CQF A;  2N9D A;  3IF8 B;  3R84 B;  1BR1 A;  2E9X A;  1MMA A;  4UF0 B;  5LJM A;  3K3O A;  2X9Y A;  2WBL A;  3AVS A;  4YHJ A;  4YJ3 E;  3LK3 B;  4X20 E;  1O3X A;  2JQQ A;  5BMV E;  1HS7 A;  3RC8 A;  2NWB A;  3UUX B;  2XAJ B;  4ISS A;  3I0O A;  5JDG A;  4IE4 A;  4BA9 A;  3MA9 A;  3C50 A;  4HE8 A;  5KMG P;  4ZS3 A;  5JDH A;  4PAG A;  2LSY A;  4Z8X A;  3RC3 A;  3CX6 B;  3KIN B;  4I43 B;  1X79 A;  5FY7 A;  2CE7 A;  4MHC A;  4GIW A;  3LBX B;  4MAL A;  5FYM A;  3SOL A;  4U72 A;  5J1G A;  5LNK A;  4UVA B;  5JRE A;  2L9Q A;  2MYS A;  4ZI2 C;  1PFO A;  4L0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...