3IF8B

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
237
Chain Sequence
LFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHRIFFTNMVTCSQVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Protein zwilch homolog
total genus 71
structure length 237
sequence length 252
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3if8B02
3.30.1040.30 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3if8B03
3IF8B
chains in the Genus database with same CATH superfamily
2ACZA 2IHR1 3O4XE 4CN6A 2XQYA 4HWDA 5JRCB 2JPFA 1VRBA 1WYCA 2AE9A 2MPKA 2W00A 3N5LA 3BQKA 3QUJA 4ILBA 4AQFA 4EIWA 2E8IA 1O3XA 4QH1A 4WW0A 5AQGB 5CA1E 1ZKEA 2WZIA 5LBMA 4LFCT 5L3GB 4HSCX 3LBXB 1DTDB 3E22E 2G0UA 5CB4E 5AQMB 3K1SA 5L3DB 2V7IA 2X68A 2CLYC 3IEEA 2MYSA 3UTKA 3PJAA 5LJNA 2V7LA 3DP7A 3EABA 2CXDA 4CI1B 5AQQB 4EGWA 2WM9A 5JDMA 4U2ZA 1ZP0A 2NWBA 4KX6A 2MBGA 2LOSA 3PE0A 1LKXA 4TNWA 3RRCA 1I6ZA 3RPUA 5C3JA 3AE2A 5FY7A 5DQVA 1IAPA 3MZKB 4HE8A 4O2BE 4TV8E 4I4TE 2UUBT 2IIUA 4EXTA 5L47A 3GWHA 1ZHCA 5LP6E 2FBWA 3TLVA 1S3RA 3F31A 2JQQA 4F6RC 1MIVA 5JH7E 4AQYT 3VRBA 4NIQA 3L39A 3KV9A 4A5XA 3HKEE 3ZT5A 2XQ5A 2DL1A 3IF8B 4UV8B 3UQ7A 2PBIA 1HX1B 4B6XA 1YQ3A 2BVLA 3G2PA 5DQWA 3SRZA 1XMQT 2YDSA 2YOEA 4H9SE 3EUHA 4UF0A 3NVOA 5FY1A 5FL0A 3ZJ1A 1D0YA 2IDOB 2KSRA 4DBQA 4CXYA 4X66T 2UUCT 2Q9QB 4U3CA 2Q9QA 3QB5K 4HFEA 1MIWA 4YFSA 5AFUL 1IBKT 1H7CA 4GKKT 4KMCA 1W09A 3P8CD 1HNXT 4HN9A 3CVRA 3LBXA 4ISTA 3ANWA 1WR0A 2UXXB 4UF0B 4ZZCA 3RC3A 2W62A 4E7ZA 2W61A 1DU2A 3JAFA 5J2UE 5LHIB 2CBJA 4L9IA 3I1AA 2JMHA 4DUZT 1T98A 2E5LT 5GONE 2PTFA 3EI0A 2KZ7B 2E9XB 3RF1A 2QGSA 3PUSA 5LA6E 4BA9A 4UVAB 4CN4A 1LVFA 4IE4A 3AVRA 4GYRA 2BKPA 2IC9A 4L0RA 4ZOLE 5AQIB 3CQGB 3ZKRA 5LGNB 5AQPB 2JQ9A 4JEUB 4YY3T 2C5JA 2RPAA 3U78A 4YT0A 4LFBT 4DBRA 4PW8A 4HFIA 4GYSA 2XAJB 4ZZBA 4ZS3A 3P4RA 2VKJA 3PUAA 3KFWX 3LSVA 2EHOA 3EAMA 4OK0A 3RKGA 4X65T 4PJNA 2W0GA 3AEFA 4ZXLA 3ZMSB 5CJ5A 2X9HA 3C4XA 2BVMA 1N32T 2EHOB 4ZI2D 4ZS2A 4TV9E 5KMGP 5LOVE 3ZSSA 2J4GA 4DR6T 4OX9T 3OVUA 3B13A 2VB6A 1CUNA 1D1BA 2XSBA 4PJMA 5L2LA 4DV1T 2C5IT 3CQCB 4QXHB 5HWYA 4AQFC 4YTNA 4LF4T 1YKHB 3RRWA 2RP4A 3MKDA 2WDRA 5F5WA 3ZYLA 4EYYR 3A8YC 1OEDC 1HX8A 2CPTA 4JEHB 4DIDB 1FJGT 3BK9A 2WS3A 2E9XC 4GK5E 3ZYKA 1FMVA 2UXNB 1HR0T 3L8RA 1YD8G 4JI3T 1UCUA 1Y64B 2VKDA 2XQ3A 3CKDA 3CX8B 4YJ2E 1SE7A 3WAJA 3B57A 1YQ4A 3R84B 1WCRA 4HKAA 2HPJA 1E2AA 2IMLA 2CBIA 2LKGA 4ZI3D 4MBQA 5IYZE 4O8SA 3KV5A 4P09A 2KNDA 5J0ZA 1MNDA 2WMOA 4IDZA 3GA8A 3P50A 4PK6A 2KT9A 3ONLC 4QKNA 4TN7B 1J5ET 2OLTA 3VR8A 3ZLIA 2BKOA 1GQEA 3SFEA 3NRXA 4JI5T 4IT4A 4QWNB 2A3DA 3AXJB 3UU4A 3C51A 5L3CB 4HWFA 1ZFLA 4MHCA 2UU9T 4K0KT 1PFOA 3AA0B 4V1Av 2VL8A 4EAHA 4TWHA 2J62A 2X67A 2CCQA 5HCJA 1ZOYA 3AB3B 3AE6A 4GIWA 3ZN1B 4AKRB 5BMVE 1UX5A 3N2OA 3RIAA 2CLYB 3HL6A 2V5DA 4YHJA 2X0HA 3DJBA 3MK7C 2X9YA 2H88A 2XUEA 3NKZA 3ETUA 4DUYT 4LFAT 2CM0A 2NOXA 3Q5EA 4HGAA 5C2TA 1ZV4X 5HEJA 4P0BA 4HFBA 5ETWA 5JQGE 4UXNB 4K0UA 3UUMA 2FJDA 3UFGA 3P4QA 5CGMA 4EEBA 3AE3A 4IREA 4JUYA 4LMJA 2BS2A 4YHHT 1BR0A 3PJVD 3GMIA 1XWMA 3WI3A 3HI2A 3AEEA 3HR0A 5C8YE 2PFVA 3RX6A 1MMAA 2HN2A 4JYAT 3RKOA 1D1CA 3AE9A 3VHLA 3LG7A 2M67A 3O9XA 4L5GA 4GKJT 3OYZA 2DNXA 2DCFA 2Y6XA 3JADA 5FXZA 4EYUA 3OKQA 2BZBA 4H9RC 4WBNE 2YKSA 3V5UA 4ZI7E 5FY0A 4PAGA 2UUAT 1D0XA 4COFA 4WNKA 5LMUT 4LF9T 4H9QC 3NZQA 4F8HA 4ZI3C 2IAKA 3EVYA 4AKHA 4OHFA 2JQKA 3ONJA 3V5SA 2XQ6A 2RA1A 2A9UA 2XJ7A 4NUUA 1SHZC 4HWHA 4P1NA 1KNRA 4N78D 3SOLA 4ZEYA 3F2EA 3RIFA 2BBJA 3KV6A 1HTJF 4KHZF 3PUYF 4TWFA 2VURA 2KMFA 3RIUC 3ZSTA 3TKLB 5JDHA 3VKHA 3AAAB 3G2QA 2N1GA 4DR7T 3CX7B 5FXXA 3EDVA 4U31A 5AQUB 3CX6B 3FZFB 5AQOB 4DMVA 4PK5A 4YTPA 3AAIA 2H7VC 3LFMA 2ZM2A 3L3PA 1S35A 3ZC0A 5FMNA 3PU3A 5BR8T 2YDQA 2XAGB 3NZPA 4PJLA 3R6NA 5AQTB 2X51A 3I0OA 3AAEB 4JLEA 2LEHA 3FBLA 4WYVA 4LMLA 2V5CA 5JR9A 4DO0A 2EHOC 2BDEA 3RIUA 4MLKA 4ERRA 4KP3C 1KNPA 1MNEA 3OBVE 2VKOA 4IE0A 4QH4A 4X20E 4LF7T 4KHPT 2BG9C 4B3ST 2MTQA 4DV5T 3N2GE 4XBFB 4U33A 4IIJE 2VQET 5LXTE 1X9BA 2LKHA 2N2NA 4IE5A 3N9LA 3RYCE 4CN1A 1EZ3A 4YSYA 5LHHB 2V7MA 4O4JE 3ZMUB 3Q2MA 4LF5T 2HHHT 3SFDA 2W4XA 2E5VA 3FHNA 3FZHB 4HWCA 2WSSV 5AQRB 4DR2T 2J47A 2V6XA 4QHOA 4CI3B 2C5KT 4IE6A 1D0ZA 2YINA 1G8XA 2IC6A 2Y8DA 3A5XA 4I0UA 1MMNA 4UVBB 2D5UA 5JREA 3G06A 4YSZA 3T1HT 3QC9A 4AKLA 4B3MT 4Q25A 3QK6A 2V6YB 2FJEA 3UUXB 5KXJA 2V7JA 2XASB 2LT3A 1G73A 2GK9A 2WAUA 5JTGA 3PUWF 4ILAA 4C91A 3J9X1 2JIWA 4TUYE 5HXCA 3PUXF 4LF8T 2UXCT 5LYJE 1BR2A 3VU7H 3I9YA 2L9QA 5HEGA 5FL1A 5JDGA 4PNIA 2F4VT 2DHRA 2K48A 3HA4A 2YK0A 4ILUA 4U74A 2MAWA 5L3EB 2FUPA 4IGUA 4HFCA 2D0UA 2NW8A 3AEGA 3C98B 3OPCA 4EZHA 5J2TE 5KX5E 3K3NA 3AEDA 2WDVA 4YJ3E 3H3AA 4AXPA 5FNVE 3CMLA 3EHZA 1OEDB 2XQ9A 4KBMB 4A98A 4DV6T 2WB5A 3FZKB 5ABFA 2KWIB 1DTVA 1KFYA 4IDPA 3O1HA 1W9RA 3HKDE 1N34T 3NWIA 4QXBB 5H6QB 2ODVA 5LHGB 3UULA 3M65A 4HFHA 5AQSB 1BR4A 3W15B 2LSJA 1KEYA 5JVDE 4P0AA 5F3JA 5LJMA 2V6YA 2D0TA 2VWAA 2W63A 5AQHB 2XY8B 3ZT6A 3P4WA 3EDUA 3UU6A 5AQFB 4JI0T 4I50E 2X0LB 5FVKA 3LK3B 2WP9A 2XM2A 3C64A 2KWHA 3IA3A 3DTOA 1JNZA 1YXRA 5DABA 5JR9C 2V7KA 4DR5T 3I0QA 3QB5A 3UU5A 2NP9A 3VR9A 2LSGA 5HWXA 2P9BA 3AE4A 4OYJA 2K24A 2XPKA 3RYFE 5CA0E 3AE7A 4O2AE 1UK5A 3G2OA 1WFDA 5JDLA 5HEUA 3JCFA 3N9OA 1HFAA 1V9DA 3ESLA 3GN5B 2QRXA 4U7YA 1YKEB 4EEDA 2DWGA 3RQUA 4AKIA 2VVSA 2ABZC 4DNDA 3LJCA 4OYKA 4BIKA 2LLYA 4JI1T 4ADZA 4JBWF 2VQFT 3MXZA 5JDFA 2X9WA 2XQ7A 3ZN0B 1XNQT 1HNWT 4PK4A 4QX7B 4KUMB 2A2FX 4GOUA 4O4HE 3ZCIA 2LJLA 4QH5A 4X1YE 5KDMC 3PDYA 4JI2T 3D0TA 1AJ3A 2QVAA 5TAOA 4NXMT 4DV3T 2Z6EA 5AQLB 1ZFIA 2NW9A 1MMDA 2DWKA 2OV9A 2V1DB 2WQYA 4XAXB 2IW5B 4XZCA 4I43B 2CEAA 5FYMA 4Z91A 2LSIA 2WBLA 2LSKA 1OEDA 1VCSA 3HVNA 2W66A 3ZMTB 3MJXA 4EOZB 3ZMVB 4B3TT 4J2CA 3Q5DA 3KVBA 4DV0T 4H63V 1XDPA 1LRZA 1US7B 2LHNA 3CWZB 5HXRA 4TWDA 2HPLA 5EK2A 4UV9B 4ZHQE 2HN1A 4UELA 3T8OA 5ABHA 4ILCA 2BS3A 5IUXA 3UU8A 2W2UA 2CE7A 2J1DG 4A97A 2BKNA 5AQJB 1KNZA 3PTRB 4IHJE 2VVNA 2WU5A 4TZ4C 2BG9A 1IZNB 2B76A 2IUBA 4H9PC 3RI5A 4EZ4A 2ZMAA 2LE8A 3ABVA 3N2KE 2ZM6T 3OYXA 1SUMB 3AE5A 3HKBE 2NR4A 3UUBA 2NTXA 1E7PA 1XZYA 2YU2A 4IE7A 4TNVA 5CFBA 1IBMT 4AKGA 3CIRA 4X62T 4IDOA 3KVAA 2XQAA 3O1IA 2CMRA 2LRLA 5HYAA 5EK4A 1UGOA 2WU2A 4CI2B 5FXWA 4OFZA 2XSAA 3CPZA 1JNRA 1UURA 2ACXA 2BG9B 4MFRA 5ABFB 1WRDA 4M1PA 5L3BB 4EB6E 3AA6B 3FXDB 4DR1T 2H3RA 1T8BA 4X64T 1M7KA 1NAFA 3QNUA 5AQNB 5LG4A 3KBTA 3PUVF 3MACA 3VRAA 3AEAA 3KBUA 2I0MA 5F8PA 4NXNT 4Z8XA 2CWYA 2UXDT 4JI4T 1LVKA 4C90A 3PV0F 2JMKA 4H9OC 3O1JA 3ZCJA 1CHUA 2E2AA 3J7Yq 3IHRA 3T1YT 2LRKA 3QOFA 4IDNA 4PFPA 1OXZA 5FVLA 5H6RB 1KK7A 1YW0A 4CQIA 3S4UA 3H3MA 3AE1A 2XQ4A 3E08A 2PJQA 3I9WA 2FJBA 4FI5A 5LCYA 4BJMA 4LF6T 3AEBA 4X1KE 3SWHA 1XDOA 1M62A 4DV7T 3U3IA 4O4LE 3ZMZB 2ES0A 5L3FB 3CK6A 3RHWA 4DVDA 2VL0A 3CQXC 3LK42 1R8IA 4QXCB 5FXVA 3Q5WA 3JAEA 1I94T 5LB7B 4B3RT 5IHYA 2XM1A 5L4EA 2LM2A 4IL4A 2WCAA 1FEWA 5HEHA 1IJ5A 1T7SA 2WDQA 3PU8A 3AA7B 2DLRA 4UEMA 3TLSA 4Z90A 4CXXA 4IL9A 2H89A 2NTYA 2Q9QD 2M6BA 2ZM8A 3PUQA 3RYHE 1QSDA 3UUNA 2JRKA 3K3QC 5IWAT 1HS7A 5FP3A 2XAFB 2KLQA 3GN5A 4HWIB 1HCIA 3RC8A 1WLXA 4G63A 2BBHA 4YSXA 3JC6C 2KINB 5HXHA 5LMNT 3AVSA 2V26A 2VKHA 1IBLT 4QX8B 3ZC1A 3PUGA 3Q9DA 2AXDS 4EV6A 3ZPOA 4DR4T 3TLUA 3N9PA 4YXDA 3FZLB 1Y01A 2K5BB 2X66A 3N9NA 3OJAA 3PJAJ 1HNZT 2CHOA 5EK3A 3IBPA 1D1AA 4PFOA 3H37A 2EHOD 4PJJA 3BQIA 5L4HA 1W0BA 3K3OA 3HKCE 3NBXX 5LG3A 3AECA 4CXWA 2WWVA 1UUSA 4NUVA 4LMKA 1B7TA 2LM9A 2X9XA 2YEVC 4HFDA 3ZEFB 5ABEA 4DR3T 2YU1A 5DJQC 2V8SV 1XMOT 4HEAA 4O4IE 1WYBA 4AQGA 1NWMX 2LHRA 3LK2B 2QYWA 1HF8A 2XHEB 2KXPB 4AI6A 1HG2A 2QA7A 1Z8UA 2X0YA 5HXEA 4NPPA 1NEKA 2H7OA 5EZYE 1BR1A 2Y48B 4H63H 3AXJA 3UQ4A 2M6IA 2R6GF 2WWUA 4HTEA 2XAHB 3ANWB 3LDQB 1J1JA 2YDRA 4AIUA 1U4QA 3B5MA 2E9XD 3ZT7A 2CHNA 1M3IA 1VOMA 4H9NC 2XQ8A 4IDQA 3ONXA 4ISSA 3WAKA 3UFEA 2ZM0A 4DV4T 3N9MA 2N9DA 1U5PA 1QUUA 3E0ZA 3K8PC 1OEDE 3KDSE 4HFVA 4X5TA 5LBQB 5M4YA 4JI6T 4JV5T 1J5WA 3P7IA 2PG8A 3MA9A 1SA0E 2C0SA 3FB2A 4I55E 4YLHA 3JC6D 4JI7T 2CRBA 2ZLYA 2OA5A 4CZZB 2WMNA 1X79A 5HXSA 1HG5A 5LGUB 2K9AA 1W0AA 5HEOA 4GK0E 3F57A 3AA1B 3C50A 3A7MA 1MMGA 1QLBA 4TX5A 4X1IE 2W67A 5ADXL 3G2MA 2BS4A 3N9QA 3TLTA 2WY2A 4WBOA 1OWAA 4E7SA 5AQKB 1WR6A 2D9DA 2L3LA 5HAXA 3RH3A 1E1HB 2XZEA 3RLFF 2I6HA 5LNKA 2L8KA 2JQHA 1M3JA 1XNRT 4ZI2C 4U2YA 2CA5A 3PUZF 3C4WA 2VASA 2B1EA 2MOZA 4UIGA 3C4ZA 2XAQB 3ETVA 4FJOA 3RGLA 2NW7A 3KINB 2BG9E 1IJ6A 1ZEEA 3NRYA 1NENA 3P4PA 4YTMA 3L09A 1MIYA 3PURA 3RYIE 4BJNA 1Z0PA 2HH7A 5A1LA 3OTOT 2CWOA 2ODUA 3VKGA 2JJ9A 3BQLA 5ABGA 1KF6A 2CXLA 3AE8A 5FKYA 3RQWA 4BAYB 3FZMB 3X1DA 2SPCA 2DI4A 5HCMA 2FJAA 2VK9A 5JR9B 1T72A 5J1GA 2K3WA 4A56A 2LSYA 3UT5E 3FBZA 5LGTB 4ANJA 2Q9QC 2LOPA 4U7IA 5AQVB 3M3ZB 3KV4A 3TLWA 1FMWA 2A72A 2I59A 1N36T 4U72A 1S94A 4UVCB 5JDQA 1FIOA 2XTLA 3FXEB 4DMWA 2YN6A 4MALA 1VCTA 4UR9A 5JDNA 4DV2T 5JRCA 3ZYMA 1N33T 4KI0F 3SS1A 1L0VA 4G2AA 3UU3A 3ZJ2A 4WZXA 2CXFA 2WZHA 2D2SA 3P4SA 3Q5XA 1UX4A 3CQFA 2UXBT 2E9XA 4AISA 4ASKA 5E0OA 4JI8T
chains in the Genus database with same CATH topology
3O4XE 2XQYA 5JRCB 2JPFA 1VRBA 1WYCA 2W00A 3N5LA 3QUJA 3BQKA 4AQFA 4EIWA 2E8IA 1O3XA 4WW0A 5CA1E 1ZKEA 5LBMA 5L3GB 4HSCX 3LBXB 3E22E 2G0UA 5CB4E 5L3DB 2V7IA 2X68A 2CLYC 3IEEA 2MYSA 3UTKA 5LJNA 2V7LA 3DP7A 4CI1B 2CXDA 5JDMA 2WM9A 2MBGA 2NWBA 2LOSA 3PE0A 1LKXA 3RRCA 3RPUA 5FY7A 5DQVA 1IAPA 3MZKB 4HE8A 4O2BE 4TV8E 4I4TE 4EXTA 3GWHA 1ZHCA 5LP6E 1S3RA 3F31A 2JQQA 4F6RC 1MIVA 5JH7E 3KV9A 3HKEE 3IF8B 4UV8B 2PBIA 4B6XA 3G2PA 2BVLA 5DQWA 3SRZA 4H9SE 4UF0A 3EUHA 5FY1A 3ZJ1A 4DBQA 4CXYA 1D0YA 1HS7A 2Q9QB 2Q9QA 5AFUL 1MIWA 4YFSA 1H7CA 4KMCA 3P8CD 4HN9A 3CVRA 3LBXA 4ISTA 3ANWA 4UF0B 2UXXB 3RC3A 2W62A 4E7ZA 2W61A 5J2UE 5LHIB 4L9IA 3I1AA 2JMHA 1T98A 5GONE 2KZ7B 2E9XB 2QGSA 3PUSA 5LA6E 4BA9A 4UVAB 1LVFA 4IE4A 3AVRA 4GYRA 2IC9A 4L0RA 4ZOLE 5LGNB 3CQGB 4JEUB 2C5JA 4DBRA 4PW8A 4GYSA 2XAJB 4ZS3A 2VKJA 3PUAA 3KFWX 2EHOA 4OK0A 4PJNA 2W0GA 3ZMSB 2X9HA 3C4XA 2BVMA 2EHOB 4ZI2D 4ZS2A 4TV9E 5KMGP 5LOVE 3B13A 2VB6A 1CUNA 1D1BA 4PJMA 5L2LA 2C5IT 3CQCB 4QXHB 5HWYA 4AQFC 1YKHB 3RRWA 2RP4A 3MKDA 3ZYLA 4EYYR 1HX8A 4JEHB 3BK9A 2E9XC 4GK5E 3ZYKA 1FMVA 2UXNB 1YD8G 1UCUA 1Y64B 2VKDA 3WAJA 3CKDA 3CX8B 4YJ2E 3B57A 3R84B 4HKAA 2HPJA 4ZI3D 4MBQA 5IYZE 4O8SA 3KV5A 4P09A 2KNDA 1MNDA 2WMOA 4IDZA 3GA8A 4TN7B 4PK6A 2KT9A 4QKNA 3ZLIA 3NRXA 4QWNB 2A3DA 3C51A 5L3CB 4MHCA 1PFOA 3AA0B 4V1Av 2VL8A 4EAHA 2X67A 2CCQA 4GIWA 3AB3B 3ZN1B 4AKRB 5BMVE 1UX5A 3N2OA 2CLYB 3HL6A 4YHJA 3DJBA 3MK7C 2X9YA 2XUEA 3ETUA 2CM0A 2NOXA 4HGAA 1ZV4X 4P0BA 5ETWA 5JQGE 4UXNB 4K0UA 3UUMA 3PJVD 4JUYA 1BR0A 3GMIA 3WI3A 3HI2A 3HR0A 5C8YE 2PFVA 3RX6A 1MMAA 3RKOA 1D1CA 3VHLA 3LG7A 2M67A 3O9XA 4L5GA 3OYZA 2DNXA 2DCFA 2Y6XA 5FXZA 4EYUA 3OKQA 2BZBA 4H9RC 4WBNE 3V5UA 4ZI7E 5FY0A 4PAGA 1D0XA 4WNKA 4H9QC 3NZQA 4ZI3C 2IAKA 3EVYA 4AKHA 4OHFA 3V5SA 2RA1A 4NUUA 1SHZC 4N78D 3SOLA 3F2EA 3KV6A 1HTJF 5JDHA 3G2QA 2KMFA 3TKLB 3VKHA 3AAAB 2N1GA 3CX7B 5FXXA 3EDVA 3CX6B 4DMVA 4PK5A 3AAIA 2H7VC 3LFMA 2ZM2A 3L3PA 1S35A 3ZC0A 5FMNA 3PU3A 2XAGB 3NZPA 4PJLA 3R6NA 2X51A 3I0OA 3AAEB 4JLEA 2LEHA 3FBLA 5JR9A 4DO0A 2EHOC 2BDEA 4MLKA 4ERRA 4KP3C 1MNEA 3OBVE 4IE0A 2VKOA 4X20E 5L3FB 2MTQA 3N2GE 4XBFB 4IIJE 5LXTE 4IE5A 2N2NA 3RYCE 3N9LA 1EZ3A 5LHHB 2V7MA 4O4JE 3ZMUB 3Q2MA 3FHNA 2WSSV 4QHOA 4CI3B 2C5KT 4IE6A 1D0ZA 2YINA 1G8XA 2IC6A 2Y8DA 3A5XA 4UVBB 1MMNA 5JREA 2D5UA 3QC9A 4AKLA 3QK6A 3UUXB 2V7JA 2XASB 2LT3A 1G73A 2GK9A 2WAUA 4C91A 3J9X1 4TUYE 5HXCA 5LYJE 1BR2A 3VU7H 3I9YA 2L9QA 5JDGA 4PNIA 2DHRA 2K48A 3HA4A 2YK0A 4ILUA 4U74A 5L3EB 4IGUA 2D0UA 2NW8A 3C98B 4EZHA 5J2TE 5KX5E 3K3NA 4YJ3E 3H3AA 4AXPA 5FNVE 3CMLA 4KBMB 2KWIB 3O1HA 3HKDE 4QXBB 5H6QB 2ODVA 5LHGB 3UULA 3M65A 1BR4A 3W15B 2LSJA 5JVDE 4P0AA 5F3JA 5LJMA 2D0TA 2VWAA 2W63A 3EDUA 4I50E 2X0LB 3LK3B 3C64A 2KWHA 3DTOA 5DABA 5JR9C 2V7KA 3I0QA 2NP9A 2LSGA 5HWXA 2P9BA 4OYJA 2K24A 3RYFE 5CA0E 4O2AE 3G2OA 5JDLA 3N9OA 1HFAA 1V9DA 3ESLA 3GN5B 1YKEB 2DWGA 4AKIA 4DNDA 3LJCA 4OYKA 4BIKA 4ADZA 3MXZA 5JDFA 2X9WA 3ZN0B 4PK4A 4QX7B 4KUMB 2A2FX 4GOUA 4O4HE 3ZCIA 2LJLA 5KDMC 4X1YE 1AJ3A 3PDYA 3HVNA 3D0TA 5TAOA 2Z6EA 2NW9A 1MMDA 2DWKA 2V1DB 4XAXB 2IW5B 4XZCA 4I43B 2CEAA 5FYMA 2LSIA 2WBLA 2LSKA 3ZMTB 3MJXA 4EOZB 3ZMVB 4J2CA 3KVBA 4H63V 1LRZA 1US7B 2LHNA 3CWZB 5HXRA 5EK2A 2HPLA 4UV9B 4ZHQE 4UELA 3T8OA 2CE7A 2J1DG 1KNZA 3PTRB 4IHJE 4TZ4C 3U78A 4EZ4A 1IZNB 4H9PC 2ZMAA 2LE8A 3N2KE 3OYXA 3HKBE 2NTXA 2YU2A 4IE7A 4AKGA 3KVAA 3O1IA 2CMRA 5HYAA 5EK4A 4CI2B 5FXWA 4OFZA 4MFRA 3CPZA 2ACXA 1WRDA 4M1PA 5L3BB 4EB6E 3AA6B 3FXDB 2H3RA 1NAFA 5LG4A 3KBTA 3MACA 3KBUA 5F8PA 4Z8XA 2CWYA 1LVKA 4C90A 2JMKA 4H9OC 3O1JA 3ZCJA 3J7Yq 3IHRA 4PFPA 4CQIA 1OXZA 5H6RB 1KK7A 1YW0A 3S4UA 3I9WA 3E08A 4FI5A 2PJQA 4BJMA 5LCYA 4X1KE 3SWHA 3U3IA 4O4LE 3ZMZB 2ES0A 4DVDA 3CQXC 3LK42 5FXVA 4QXCB 3Q5WA 5IHYA 1FEWA 1IJ5A 3PU8A 4UEMA 3AA7B 2DLRA 4CXXA 2NTYA 2Q9QD 3RYHE 2ZM8A 3PUQA 3UUNA 1QSDA 2JRKA 3K3QC 5FP3A 2XAFB 2KLQA 3GN5A 3RC8A 1HCIA 1WLXA 4G63A 3JC6C 2KINB 5HXHA 3AVSA 2V26A 2VKHA 4QX8B 3ZC1A 3PUGA 3Q9DA 3ZPOA 3N9PA 2K5BB 2X66A 3N9NA 3OJAA 5EK3A 3IBPA 1D1AA 4PFOA 3H37A 2EHOD 4PJJA 3BQIA 3K3OA 3HKCE 3NBXX 4CXWA 4NUVA 1B7TA 2LM9A 2X9XA 2YEVC 3ZEFB 2YU1A 5DJQC 4HEAA 4O4IE 1WYBA 4AQGA 1NWMX 2LHRA 3LK2B 2XHEB 1HF8A 2KXPB 1HG2A 2QA7A 5HXEA 2H7OA 5EZYE 1BR1A 2Y48B 4H63H 2WWUA 4HTEA 2XAHB 3ANWB 1M3IA 1U4QA 2E9XD 1VOMA 4H9NC 3ONXA 4ISSA 3WAKA 3UFEA 2ZM0A 3N9MA 2N9DA 1U5PA 1QUUA 3E0ZA 3K8PC 3KDSE 4HFVA 5M4YA 3P7IA 2PG8A 3MA9A 1SA0E 2C0SA 3FB2A 4I55E 4YLHA 3JC6D 2ZLYA 2OA5A 4CZZB 2WMNA 1X79A 5HXSA 1HG5A 5LGUB 2K9AA 4GK0E 3F57A 3AA1B 3C50A 4X1IE 1MMGA 4TX5A 5ADXL 3G2MA 3N9QA 4E7SA 4WBOA 1OWAA 1WR6A 2L3LA 5HAXA 3RH3A 1E1HB 5LNKA 1M3JA 2L8KA 4ZI2C 2CA5A 3C4WA 2VASA 2B1EA 2MOZA 4UIGA 3C4ZA 2XAQB 3ETVA 4FJOA 2NW7A 3KINB 5LBQB 1IJ6A 1ZEEA 3NRYA 3RYIE 4AI6A 3L09A 1MIYA 3PURA 4BJNA 5A1LA 1Z0PA 2HH7A 2CWOA 2ODUA 3VKGA 2JJ9A 3BQLA 4BAYB 2CXLA 2SPCA 2DI4A 2VK9A 5JR9B 5J1GA 5LGTB 4A56A 2LSYA 3UT5E 3FBZA 4ANJA 2LOPA 2Q9QC 3KV4A 1FMWA 2A72A 2I59A 4U72A 1S94A 4UVCB 5JDQA 1FIOA 2XTLA 3FXEB 4DMWA 4MALA 5JDNA 5JRCA 3ZYMA 3SS1A 3ZJ2A 4G2AA 2CXFA 3Q5XA 2D2SA 1UX4A 3CQFA 2E9XA 4ASKA 5E0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 B; 
#chains in the Genus database with same CATH topology
 2ACZ A;  2IHR 1;  3O4X E;  4CN6 A;  2XQY A;  4HWD A;  5JRC B;  2JPF A;  1VRB A;  1WYC A;  2AE9 A;  2MPK A;  2W00 A;  3N5L A;  3BQK A;  3QUJ A;  4ILB A;  4AQF A;  4EIW A;  2E8I A;  1O3X A;  4QH1 A;  4WW0 A;  5AQG B;  5CA1 E;  1ZKE A;  2WZI A;  5LBM A;  4LFC T;  5L3G B;  4HSC X;  3LBX B;  1DTD B;  3E22 E;  2G0U A;  5CB4 E;  5AQM B;  3K1S A;  5L3D B;  2V7I A;  2X68 A;  2CLY C;  3IEE A;  2MYS A;  3UTK A;  3PJA A;  5LJN A;  2V7L A;  3DP7 A;  3EAB A;  2CXD A;  4CI1 B;  5AQQ B;  4EGW A;  2WM9 A;  5JDM A;  4U2Z A;  1ZP0 A;  2NWB A;  4KX6 A;  2MBG A;  2LOS A;  3PE0 A;  1LKX A;  4TNW A;  3RRC A;  1I6Z A;  3RPU A;  5C3J A;  3AE2 A;  5FY7 A;  5DQV A;  1IAP A;  3MZK B;  4HE8 A;  4O2B E;  4TV8 E;  4I4T E;  2UUB T;  2IIU A;  4EXT A;  5L47 A;  3GWH A;  1ZHC A;  5LP6 E;  2FBW A;  3TLV A;  1S3R A;  3F31 A;  2JQQ A;  4F6R C;  1MIV A;  5JH7 E;  4AQY T;  3VRB A;  4NIQ A;  3L39 A;  3KV9 A;  4A5X A;  3HKE E;  3ZT5 A;  2XQ5 A;  2DL1 A;  3IF8 B;  4UV8 B;  3UQ7 A;  2PBI A;  1HX1 B;  4B6X A;  1YQ3 A;  2BVL A;  3G2P A;  5DQW A;  3SRZ A;  1XMQ T;  2YDS A;  2YOE A;  4H9S E;  3EUH A;  4UF0 A;  3NVO A;  5FY1 A;  5FL0 A;  3ZJ1 A;  1D0Y A;  2IDO B;  2KSR A;  4DBQ A;  4CXY A;  4X66 T;  2UUC T;  2Q9Q B;  4U3C A;  2Q9Q A;  3QB5 K;  4HFE A;  1MIW A;  4YFS A;  5AFU L;  1IBK T;  1H7C A;  4GKK T;  4KMC A;  1W09 A;  3P8C D;  1HNX T;  4HN9 A;  3CVR A;  3LBX A;  4IST A;  3ANW A;  1WR0 A;  2UXX B;  4UF0 B;  4ZZC A;  3RC3 A;  2W62 A;  4E7Z A;  2W61 A;  1DU2 A;  3JAF A;  5J2U E;  5LHI B;  2CBJ A;  4L9I A;  3I1A A;  2JMH A;  4DUZ T;  1T98 A;  2E5L T;  5GON E;  2PTF A;  3EI0 A;  2KZ7 B;  2E9X B;  3RF1 A;  2QGS A;  3PUS A;  5LA6 E;  4BA9 A;  4UVA B;  4CN4 A;  1LVF A;  4IE4 A;  3AVR A;  4GYR A;  2BKP A;  2IC9 A;  4L0R A;  4ZOL E;  5AQI B;  3CQG B;  3ZKR A;  5LGN B;  5AQP B;  2JQ9 A;  4JEU B;  4YY3 T;  2C5J A;  2RPA A;  3U78 A;  4YT0 A;  4LFB T;  4DBR A;  4PW8 A;  4HFI A;  4GYS A;  2XAJ B;  4ZZB A;  4ZS3 A;  3P4R A;  2VKJ A;  3PUA A;  3KFW X;  3LSV A;  2EHO A;  3EAM A;  4OK0 A;  3RKG A;  4X65 T;  4PJN A;  2W0G A;  3AEF A;  4ZXL A;  3ZMS B;  5CJ5 A;  2X9H A;  3C4X A;  2BVM A;  1N32 T;  2EHO B;  4ZI2 D;  4ZS2 A;  4TV9 E;  5KMG P;  5LOV E;  3ZSS A;  2J4G A;  4DR6 T;  4OX9 T;  3OVU A;  3B13 A;  2VB6 A;  1CUN A;  1D1B A;  2XSB A;  4PJM A;  5L2L A;  4DV1 T;  2C5I T;  3CQC B;  4QXH B;  5HWY A;  4AQF C;  4YTN A;  4LF4 T;  1YKH B;  3RRW A;  2RP4 A;  3MKD A;  2WDR A;  5F5W A;  3ZYL A;  4EYY R;  3A8Y C;  1OED C;  1HX8 A;  2CPT A;  4JEH B;  4DID B;  1FJG T;  3BK9 A;  2WS3 A;  2E9X C;  4GK5 E;  3ZYK A;  1FMV A;  2UXN B;  1HR0 T;  3L8R A;  1YD8 G;  4JI3 T;  1UCU A;  1Y64 B;  2VKD A;  2XQ3 A;  3CKD A;  3CX8 B;  4YJ2 E;  1SE7 A;  3WAJ A;  3B57 A;  1YQ4 A;  3R84 B;  1WCR A;  4HKA A;  2HPJ A;  1E2A A;  2IML A;  2CBI A;  2LKG A;  4ZI3 D;  4MBQ A;  5IYZ E;  4O8S A;  3KV5 A;  4P09 A;  2KND A;  5J0Z A;  1MND A;  2WMO A;  4IDZ A;  3GA8 A;  3P50 A;  4PK6 A;  2KT9 A;  3ONL C;  4QKN A;  4TN7 B;  1J5E T;  2OLT A;  3VR8 A;  3ZLI A;  2BKO A;  1GQE A;  3SFE A;  3NRX A;  4JI5 T;  4IT4 A;  4QWN B;  2A3D A;  3AXJ B;  3UU4 A;  3C51 A;  5L3C B;  4HWF A;  1ZFL A;  4MHC A;  2UU9 T;  4K0K T;  1PFO A;  3AA0 B;  4V1A v;  2VL8 A;  4EAH A;  4TWH A;  2J62 A;  2X67 A;  2CCQ A;  5HCJ A;  1ZOY A;  3AB3 B;  3AE6 A;  4GIW A;  3ZN1 B;  4AKR B;  5BMV E;  1UX5 A;  3N2O A;  3RIA A;  2CLY B;  3HL6 A;  2V5D A;  4YHJ A;  2X0H A;  3DJB A;  3MK7 C;  2X9Y A;  2H88 A;  2XUE A;  3NKZ A;  3ETU A;  4DUY T;  4LFA T;  2CM0 A;  2NOX A;  3Q5E A;  4HGA A;  5C2T A;  1ZV4 X;  5HEJ A;  4P0B A;  4HFB A;  5ETW A;  5JQG E;  4UXN B;  4K0U A;  3UUM A;  2FJD A;  3UFG A;  3P4Q A;  5CGM A;  4EEB A;  3AE3 A;  4IRE A;  4JUY A;  4LMJ A;  2BS2 A;  4YHH T;  1BR0 A;  3PJV D;  3GMI A;  1XWM A;  3WI3 A;  3HI2 A;  3AEE A;  3HR0 A;  5C8Y E;  2PFV A;  3RX6 A;  1MMA A;  2HN2 A;  4JYA T;  3RKO A;  1D1C A;  3AE9 A;  3VHL A;  3LG7 A;  2M67 A;  3O9X A;  4L5G A;  4GKJ T;  3OYZ A;  2DNX A;  2DCF A;  2Y6X A;  3JAD A;  5FXZ A;  4EYU A;  3OKQ A;  2BZB A;  4H9R C;  4WBN E;  2YKS A;  3V5U A;  4ZI7 E;  5FY0 A;  4PAG A;  2UUA T;  1D0X A;  4COF A;  4WNK A;  5LMU T;  4LF9 T;  4H9Q C;  3NZQ A;  4F8H A;  4ZI3 C;  2IAK A;  3EVY A;  4AKH A;  4OHF A;  2JQK A;  3ONJ A;  3V5S A;  2XQ6 A;  2RA1 A;  2A9U A;  2XJ7 A;  4NUU A;  1SHZ C;  4HWH A;  4P1N A;  1KNR A;  4N78 D;  3SOL A;  4ZEY A;  3F2E A;  3RIF A;  2BBJ A;  3KV6 A;  1HTJ F;  4KHZ F;  3PUY F;  4TWF A;  2VUR A;  2KMF A;  3RIU C;  3ZST A;  3TKL B;  5JDH A;  3VKH A;  3AAA B;  3G2Q A;  2N1G A;  4DR7 T;  3CX7 B;  5FXX A;  3EDV A;  4U31 A;  5AQU B;  3CX6 B;  3FZF B;  5AQO B;  4DMV A;  4PK5 A;  4YTP A;  3AAI A;  2H7V C;  3LFM A;  2ZM2 A;  3L3P A;  1S35 A;  3ZC0 A;  5FMN A;  3PU3 A;  5BR8 T;  2YDQ A;  2XAG B;  3NZP A;  4PJL A;  3R6N A;  5AQT B;  2X51 A;  3I0O A;  3AAE B;  4JLE A;  2LEH A;  3FBL A;  4WYV A;  4LML A;  2V5C A;  5JR9 A;  4DO0 A;  2EHO C;  2BDE A;  3RIU A;  4MLK A;  4ERR A;  4KP3 C;  1KNP A;  1MNE A;  3OBV E;  2VKO A;  4IE0 A;  4QH4 A;  4X20 E;  4LF7 T;  4KHP T;  2BG9 C;  4B3S T;  2MTQ A;  4DV5 T;  3N2G E;  4XBF B;  4U33 A;  4IIJ E;  2VQE T;  5LXT E;  1X9B A;  2LKH A;  2N2N A;  4IE5 A;  3N9L A;  3RYC E;  4CN1 A;  1EZ3 A;  4YSY A;  5LHH B;  2V7M A;  4O4J E;  3ZMU B;  3Q2M A;  4LF5 T;  2HHH T;  3SFD A;  2W4X A;  2E5V A;  3FHN A;  3FZH B;  4HWC A;  2WSS V;  5AQR B;  4DR2 T;  2J47 A;  2V6X A;  4QHO A;  4CI3 B;  2C5K T;  4IE6 A;  1D0Z A;  2YIN A;  1G8X A;  2IC6 A;  2Y8D A;  3A5X A;  4I0U A;  1MMN A;  4UVB B;  2D5U A;  5JRE A;  3G06 A;  4YSZ A;  3T1H T;  3QC9 A;  4AKL A;  4B3M T;  4Q25 A;  3QK6 A;  2V6Y B;  2FJE A;  3UUX B;  5KXJ A;  2V7J A;  2XAS B;  2LT3 A;  1G73 A;  2GK9 A;  2WAU A;  5JTG A;  3PUW F;  4ILA A;  4C91 A;  3J9X 1;  2JIW A;  4TUY E;  5HXC A;  3PUX F;  4LF8 T;  2UXC T;  5LYJ E;  1BR2 A;  3VU7 H;  3I9Y A;  2L9Q A;  5HEG A;  5FL1 A;  5JDG A;  4PNI A;  2F4V T;  2DHR A;  2K48 A;  3HA4 A;  2YK0 A;  4ILU A;  4U74 A;  2MAW A;  5L3E B;  2FUP A;  4IGU A;  4HFC A;  2D0U A;  2NW8 A;  3AEG A;  3C98 B;  3OPC A;  4EZH A;  5J2T E;  5KX5 E;  3K3N A;  3AED A;  2WDV A;  4YJ3 E;  3H3A A;  4AXP A;  5FNV E;  3CML A;  3EHZ A;  1OED B;  2XQ9 A;  4KBM B;  4A98 A;  4DV6 T;  2WB5 A;  3FZK B;  5ABF A;  2KWI B;  1DTV A;  1KFY A;  4IDP A;  3O1H A;  1W9R A;  3HKD E;  1N34 T;  3NWI A;  4QXB B;  5H6Q B;  2ODV A;  5LHG B;  3UUL A;  3M65 A;  4HFH A;  5AQS B;  1BR4 A;  3W15 B;  2LSJ A;  1KEY A;  5JVD E;  4P0A A;  5F3J A;  5LJM A;  2V6Y A;  2D0T A;  2VWA A;  2W63 A;  5AQH B;  2XY8 B;  3ZT6 A;  3P4W A;  3EDU A;  3UU6 A;  5AQF B;  4JI0 T;  4I50 E;  2X0L B;  5FVK A;  3LK3 B;  2WP9 A;  2XM2 A;  3C64 A;  2KWH A;  3IA3 A;  3DTO A;  1JNZ A;  1YXR A;  5DAB A;  5JR9 C;  2V7K A;  4DR5 T;  3I0Q A;  3QB5 A;  3UU5 A;  2NP9 A;  3VR9 A;  2LSG A;  5HWX A;  2P9B A;  3AE4 A;  4OYJ A;  2K24 A;  2XPK A;  3RYF E;  5CA0 E;  3AE7 A;  4O2A E;  1UK5 A;  3G2O A;  1WFD A;  5JDL A;  5HEU A;  3JCF A;  3N9O A;  1HFA A;  1V9D A;  3ESL A;  3GN5 B;  2QRX A;  4U7Y A;  1YKE B;  4EED A;  2DWG A;  3RQU A;  4AKI A;  2VVS A;  2ABZ C;  4DND A;  3LJC A;  4OYK A;  4BIK A;  2LLY A;  4JI1 T;  4ADZ A;  4JBW F;  2VQF T;  3MXZ A;  5JDF A;  2X9W A;  2XQ7 A;  3ZN0 B;  1XNQ T;  1HNW T;  4PK4 A;  4QX7 B;  4KUM B;  2A2F X;  4GOU A;  4O4H E;  3ZCI A;  2LJL A;  4QH5 A;  4X1Y E;  5KDM C;  3PDY A;  4JI2 T;  3D0T A;  1AJ3 A;  2QVA A;  5TAO A;  4NXM T;  4DV3 T;  2Z6E A;  5AQL B;  1ZFI A;  2NW9 A;  1MMD A;  2DWK A;  2OV9 A;  2V1D B;  2WQY A;  4XAX B;  2IW5 B;  4XZC A;  4I43 B;  2CEA A;  5FYM A;  4Z91 A;  2LSI A;  2WBL A;  2LSK A;  1OED A;  1VCS A;  3HVN A;  2W66 A;  3ZMT B;  3MJX A;  4EOZ B;  3ZMV B;  4B3T T;  4J2C A;  3Q5D A;  3KVB A;  4DV0 T;  4H63 V;  1XDP A;  1LRZ A;  1US7 B;  2LHN A;  3CWZ B;  5HXR A;  4TWD A;  2HPL A;  5EK2 A;  4UV9 B;  4ZHQ E;  2HN1 A;  4UEL A;  3T8O A;  5ABH A;  4ILC A;  2BS3 A;  5IUX A;  3UU8 A;  2W2U A;  2CE7 A;  2J1D G;  4A97 A;  2BKN A;  5AQJ B;  1KNZ A;  3PTR B;  4IHJ E;  2VVN A;  2WU5 A;  4TZ4 C;  2BG9 A;  1IZN B;  2B76 A;  2IUB A;  4H9P C;  3RI5 A;  4EZ4 A;  2ZMA A;  2LE8 A;  3ABV A;  3N2K E;  2ZM6 T;  3OYX A;  1SUM B;  3AE5 A;  3HKB E;  2NR4 A;  3UUB A;  2NTX A;  1E7P A;  1XZY A;  2YU2 A;  4IE7 A;  4TNV A;  5CFB A;  1IBM T;  4AKG A;  3CIR A;  4X62 T;  4IDO A;  3KVA A;  2XQA A;  3O1I A;  2CMR A;  2LRL A;  5HYA A;  5EK4 A;  1UGO A;  2WU2 A;  4CI2 B;  5FXW A;  4OFZ A;  2XSA A;  3CPZ A;  1JNR A;  1UUR A;  2ACX A;  2BG9 B;  4MFR A;  5ABF B;  1WRD A;  4M1P A;  5L3B B;  4EB6 E;  3AA6 B;  3FXD B;  4DR1 T;  2H3R A;  1T8B A;  4X64 T;  1M7K A;  1NAF A;  3QNU A;  5AQN B;  5LG4 A;  3KBT A;  3PUV F;  3MAC A;  3VRA A;  3AEA A;  3KBU A;  2I0M A;  5F8P A;  4NXN T;  4Z8X A;  2CWY A;  2UXD T;  4JI4 T;  1LVK A;  4C90 A;  3PV0 F;  2JMK A;  4H9O C;  3O1J A;  3ZCJ A;  1CHU A;  2E2A A;  3J7Y q;  3IHR A;  3T1Y T;  2LRK A;  3QOF A;  4IDN A;  4PFP A;  1OXZ A;  5FVL A;  5H6R B;  1KK7 A;  1YW0 A;  4CQI A;  3S4U A;  3H3M A;  3AE1 A;  2XQ4 A;  3E08 A;  2PJQ A;  3I9W A;  2FJB A;  4FI5 A;  5LCY A;  4BJM A;  4LF6 T;  3AEB A;  4X1K E;  3SWH A;  1XDO A;  1M62 A;  4DV7 T;  3U3I A;  4O4L E;  3ZMZ B;  2ES0 A;  5L3F B;  3CK6 A;  3RHW A;  4DVD A;  2VL0 A;  3CQX C;  3LK4 2;  1R8I A;  4QXC B;  5FXV A;  3Q5W A;  3JAE A;  1I94 T;  5LB7 B;  4B3R T;  5IHY A;  2XM1 A;  5L4E A;  2LM2 A;  4IL4 A;  2WCA A;  1FEW A;  5HEH A;  1IJ5 A;  1T7S A;  2WDQ A;  3PU8 A;  3AA7 B;  2DLR A;  4UEM A;  3TLS A;  4Z90 A;  4CXX A;  4IL9 A;  2H89 A;  2NTY A;  2Q9Q D;  2M6B A;  2ZM8 A;  3PUQ A;  3RYH E;  1QSD A;  3UUN A;  2JRK A;  3K3Q C;  5IWA T;  1HS7 A;  5FP3 A;  2XAF B;  2KLQ A;  3GN5 A;  4HWI B;  1HCI A;  3RC8 A;  1WLX A;  4G63 A;  2BBH A;  4YSX A;  3JC6 C;  2KIN B;  5HXH A;  5LMN T;  3AVS A;  2V26 A;  2VKH A;  1IBL T;  4QX8 B;  3ZC1 A;  3PUG A;  3Q9D A;  2AXD S;  4EV6 A;  3ZPO A;  4DR4 T;  3TLU A;  3N9P A;  4YXD A;  3FZL B;  1Y01 A;  2K5B B;  2X66 A;  3N9N A;  3OJA A;  3PJA J;  1HNZ T;  2CHO A;  5EK3 A;  3IBP A;  1D1A A;  4PFO A;  3H37 A;  2EHO D;  4PJJ A;  3BQI A;  5L4H A;  1W0B A;  3K3O A;  3HKC E;  3NBX X;  5LG3 A;  3AEC A;  4CXW A;  2WWV A;  1UUS A;  4NUV A;  4LMK A;  1B7T A;  2LM9 A;  2X9X A;  2YEV C;  4HFD A;  3ZEF B;  5ABE A;  4DR3 T;  2YU1 A;  5DJQ C;  2V8S V;  1XMO T;  4HEA A;  4O4I E;  1WYB A;  4AQG A;  1NWM X;  2LHR A;  3LK2 B;  2QYW A;  1HF8 A;  2XHE B;  2KXP B;  4AI6 A;  1HG2 A;  2QA7 A;  1Z8U A;  2X0Y A;  5HXE A;  4NPP A;  1NEK A;  2H7O A;  5EZY E;  1BR1 A;  2Y48 B;  4H63 H;  3AXJ A;  3UQ4 A;  2M6I A;  2R6G F;  2WWU A;  4HTE A;  2XAH B;  3ANW B;  3LDQ B;  1J1J A;  2YDR A;  4AIU A;  1U4Q A;  3B5M A;  2E9X D;  3ZT7 A;  2CHN A;  1M3I A;  1VOM A;  4H9N C;  2XQ8 A;  4IDQ A;  3ONX A;  4ISS A;  3WAK A;  3UFE A;  2ZM0 A;  4DV4 T;  3N9M A;  2N9D A;  1U5P A;  1QUU A;  3E0Z A;  3K8P C;  1OED E;  3KDS E;  4HFV A;  4X5T A;  5LBQ B;  5M4Y A;  4JI6 T;  4JV5 T;  1J5W A;  3P7I A;  2PG8 A;  3MA9 A;  1SA0 E;  2C0S A;  3FB2 A;  4I55 E;  4YLH A;  3JC6 D;  4JI7 T;  2CRB A;  2ZLY A;  2OA5 A;  4CZZ B;  2WMN A;  1X79 A;  5HXS A;  1HG5 A;  5LGU B;  2K9A A;  1W0A A;  5HEO A;  4GK0 E;  3F57 A;  3AA1 B;  3C50 A;  3A7M A;  1MMG A;  1QLB A;  4TX5 A;  4X1I E;  2W67 A;  5ADX L;  3G2M A;  2BS4 A;  3N9Q A;  3TLT A;  2WY2 A;  4WBO A;  1OWA A;  4E7S A;  5AQK B;  1WR6 A;  2D9D A;  2L3L A;  5HAX A;  3RH3 A;  1E1H B;  2XZE A;  3RLF F;  2I6H A;  5LNK A;  2L8K A;  2JQH A;  1M3J A;  1XNR T;  4ZI2 C;  4U2Y A;  2CA5 A;  3PUZ F;  3C4W A;  2VAS A;  2B1E A;  2MOZ A;  4UIG A;  3C4Z A;  2XAQ B;  3ETV A;  4FJO A;  3RGL A;  2NW7 A;  3KIN B;  2BG9 E;  1IJ6 A;  1ZEE A;  3NRY A;  1NEN A;  3P4P A;  4YTM A;  3L09 A;  1MIY A;  3PUR A;  3RYI E;  4BJN A;  1Z0P A;  2HH7 A;  5A1L A;  3OTO T;  2CWO A;  2ODU A;  3VKG A;  2JJ9 A;  3BQL A;  5ABG A;  1KF6 A;  2CXL A;  3AE8 A;  5FKY A;  3RQW A;  4BAY B;  3FZM B;  3X1D A;  2SPC A;  2DI4 A;  5HCM A;  2FJA A;  2VK9 A;  5JR9 B;  1T72 A;  5J1G A;  2K3W A;  4A56 A;  2LSY A;  3UT5 E;  3FBZ A;  5LGT B;  4ANJ A;  2Q9Q C;  2LOP A;  4U7I A;  5AQV B;  3M3Z B;  3KV4 A;  3TLW A;  1FMW A;  2A72 A;  2I59 A;  1N36 T;  4U72 A;  1S94 A;  4UVC B;  5JDQ A;  1FIO A;  2XTL A;  3FXE B;  4DMW A;  2YN6 A;  4MAL A;  1VCT A;  4UR9 A;  5JDN A;  4DV2 T;  5JRC A;  3ZYM A;  1N33 T;  4KI0 F;  3SS1 A;  1L0V A;  4G2A A;  3UU3 A;  3ZJ2 A;  4WZX A;  2CXF A;  2WZH A;  2D2S A;  3P4S A;  3Q5X A;  1UX4 A;  3CQF A;  2UXB T;  2E9X A;  4AIS A;  4ASK A;  5E0O A;  4JI8 T; 
#chains in the Genus database with same CATH homology
 3O4X E;  2XQY A;  5JRC B;  2JPF A;  1VRB A;  1WYC A;  2W00 A;  3N5L A;  3QUJ A;  3BQK A;  4AQF A;  4EIW A;  2E8I A;  1O3X A;  4WW0 A;  5CA1 E;  1ZKE A;  5LBM A;  5L3G B;  4HSC X;  3LBX B;  3E22 E;  2G0U A;  5CB4 E;  5L3D B;  2V7I A;  2X68 A;  2CLY C;  3IEE A;  2MYS A;  3UTK A;  5LJN A;  2V7L A;  3DP7 A;  4CI1 B;  2CXD A;  5JDM A;  2WM9 A;  2MBG A;  2NWB A;  2LOS A;  3PE0 A;  1LKX A;  3RRC A;  3RPU A;  5FY7 A;  5DQV A;  1IAP A;  3MZK B;  4HE8 A;  4O2B E;  4TV8 E;  4I4T E;  4EXT A;  3GWH A;  1ZHC A;  5LP6 E;  1S3R A;  3F31 A;  2JQQ A;  4F6R C;  1MIV A;  5JH7 E;  3KV9 A;  3HKE E;  3IF8 B;  4UV8 B;  2PBI A;  4B6X A;  3G2P A;  2BVL A;  5DQW A;  3SRZ A;  4H9S E;  4UF0 A;  3EUH A;  5FY1 A;  3ZJ1 A;  4DBQ A;  4CXY A;  1D0Y A;  1HS7 A;  2Q9Q B;  2Q9Q A;  5AFU L;  1MIW A;  4YFS A;  1H7C A;  4KMC A;  3P8C D;  4HN9 A;  3CVR A;  3LBX A;  4IST A;  3ANW A;  4UF0 B;  2UXX B;  3RC3 A;  2W62 A;  4E7Z A;  2W61 A;  5J2U E;  5LHI B;  4L9I A;  3I1A A;  2JMH A;  1T98 A;  5GON E;  2KZ7 B;  2E9X B;  2QGS A;  3PUS A;  5LA6 E;  4BA9 A;  4UVA B;  1LVF A;  4IE4 A;  3AVR A;  4GYR A;  2IC9 A;  4L0R A;  4ZOL E;  5LGN B;  3CQG B;  4JEU B;  2C5J A;  4DBR A;  4PW8 A;  4GYS A;  2XAJ B;  4ZS3 A;  2VKJ A;  3PUA A;  3KFW X;  2EHO A;  4OK0 A;  4PJN A;  2W0G A;  3ZMS B;  2X9H A;  3C4X A;  2BVM A;  2EHO B;  4ZI2 D;  4ZS2 A;  4TV9 E;  5KMG P;  5LOV E;  3B13 A;  2VB6 A;  1CUN A;  1D1B A;  4PJM A;  5L2L A;  2C5I T;  3CQC B;  4QXH B;  5HWY A;  4AQF C;  1YKH B;  3RRW A;  2RP4 A;  3MKD A;  3ZYL A;  4EYY R;  1HX8 A;  4JEH B;  3BK9 A;  2E9X C;  4GK5 E;  3ZYK A;  1FMV A;  2UXN B;  1YD8 G;  1UCU A;  1Y64 B;  2VKD A;  3WAJ A;  3CKD A;  3CX8 B;  4YJ2 E;  3B57 A;  3R84 B;  4HKA A;  2HPJ A;  4ZI3 D;  4MBQ A;  5IYZ E;  4O8S A;  3KV5 A;  4P09 A;  2KND A;  1MND A;  2WMO A;  4IDZ A;  3GA8 A;  4TN7 B;  4PK6 A;  2KT9 A;  4QKN A;  3ZLI A;  3NRX A;  4QWN B;  2A3D A;  3C51 A;  5L3C B;  4MHC A;  1PFO A;  3AA0 B;  4V1A v;  2VL8 A;  4EAH A;  2X67 A;  2CCQ A;  4GIW A;  3AB3 B;  3ZN1 B;  4AKR B;  5BMV E;  1UX5 A;  3N2O A;  2CLY B;  3HL6 A;  4YHJ A;  3DJB A;  3MK7 C;  2X9Y A;  2XUE A;  3ETU A;  2CM0 A;  2NOX A;  4HGA A;  1ZV4 X;  4P0B A;  5ETW A;  5JQG E;  4UXN B;  4K0U A;  3UUM A;  3PJV D;  4JUY A;  1BR0 A;  3GMI A;  3WI3 A;  3HI2 A;  3HR0 A;  5C8Y E;  2PFV A;  3RX6 A;  1MMA A;  3RKO A;  1D1C A;  3VHL A;  3LG7 A;  2M67 A;  3O9X A;  4L5G A;  3OYZ A;  2DNX A;  2DCF A;  2Y6X A;  5FXZ A;  4EYU A;  3OKQ A;  2BZB A;  4H9R C;  4WBN E;  3V5U A;  4ZI7 E;  5FY0 A;  4PAG A;  1D0X A;  4WNK A;  4H9Q C;  3NZQ A;  4ZI3 C;  2IAK A;  3EVY A;  4AKH A;  4OHF A;  3V5S A;  2RA1 A;  4NUU A;  1SHZ C;  4N78 D;  3SOL A;  3F2E A;  3KV6 A;  1HTJ F;  5JDH A;  3G2Q A;  2KMF A;  3TKL B;  3VKH A;  3AAA B;  2N1G A;  3CX7 B;  5FXX A;  3EDV A;  3CX6 B;  4DMV A;  4PK5 A;  3AAI A;  2H7V C;  3LFM A;  2ZM2 A;  3L3P A;  1S35 A;  3ZC0 A;  5FMN A;  3PU3 A;  2XAG B;  3NZP A;  4PJL A;  3R6N A;  2X51 A;  3I0O A;  3AAE B;  4JLE A;  2LEH A;  3FBL A;  5JR9 A;  4DO0 A;  2EHO C;  2BDE A;  4MLK A;  4ERR A;  4KP3 C;  1MNE A;  3OBV E;  4IE0 A;  2VKO A;  4X20 E;  5L3F B;  2MTQ A;  3N2G E;  4XBF B;  4IIJ E;  5LXT E;  4IE5 A;  2N2N A;  3RYC E;  3N9L A;  1EZ3 A;  5LHH B;  2V7M A;  4O4J E;  3ZMU B;  3Q2M A;  3FHN A;  2WSS V;  4QHO A;  4CI3 B;  2C5K T;  4IE6 A;  1D0Z A;  2YIN A;  1G8X A;  2IC6 A;  2Y8D A;  3A5X A;  4UVB B;  1MMN A;  5JRE A;  2D5U A;  3QC9 A;  4AKL A;  3QK6 A;  3UUX B;  2V7J A;  2XAS B;  2LT3 A;  1G73 A;  2GK9 A;  2WAU A;  4C91 A;  3J9X 1;  4TUY E;  5HXC A;  5LYJ E;  1BR2 A;  3VU7 H;  3I9Y A;  2L9Q A;  5JDG A;  4PNI A;  2DHR A;  2K48 A;  3HA4 A;  2YK0 A;  4ILU A;  4U74 A;  5L3E B;  4IGU A;  2D0U A;  2NW8 A;  3C98 B;  4EZH A;  5J2T E;  5KX5 E;  3K3N A;  4YJ3 E;  3H3A A;  4AXP A;  5FNV E;  3CML A;  4KBM B;  2KWI B;  3O1H A;  3HKD E;  4QXB B;  5H6Q B;  2ODV A;  5LHG B;  3UUL A;  3M65 A;  1BR4 A;  3W15 B;  2LSJ A;  5JVD E;  4P0A A;  5F3J A;  5LJM A;  2D0T A;  2VWA A;  2W63 A;  3EDU A;  4I50 E;  2X0L B;  3LK3 B;  3C64 A;  2KWH A;  3DTO A;  5DAB A;  5JR9 C;  2V7K A;  3I0Q A;  2NP9 A;  2LSG A;  5HWX A;  2P9B A;  4OYJ A;  2K24 A;  3RYF E;  5CA0 E;  4O2A E;  3G2O A;  5JDL A;  3N9O A;  1HFA A;  1V9D A;  3ESL A;  3GN5 B;  1YKE B;  2DWG A;  4AKI A;  4DND A;  3LJC A;  4OYK A;  4BIK A;  4ADZ A;  3MXZ A;  5JDF A;  2X9W A;  3ZN0 B;  4PK4 A;  4QX7 B;  4KUM B;  2A2F X;  4GOU A;  4O4H E;  3ZCI A;  2LJL A;  5KDM C;  4X1Y E;  1AJ3 A;  3PDY A;  3HVN A;  3D0T A;  5TAO A;  2Z6E A;  2NW9 A;  1MMD A;  2DWK A;  2V1D B;  4XAX B;  2IW5 B;  4XZC A;  4I43 B;  2CEA A;  5FYM A;  2LSI A;  2WBL A;  2LSK A;  3ZMT B;  3MJX A;  4EOZ B;  3ZMV B;  4J2C A;  3KVB A;  4H63 V;  1LRZ A;  1US7 B;  2LHN A;  3CWZ B;  5HXR A;  5EK2 A;  2HPL A;  4UV9 B;  4ZHQ E;  4UEL A;  3T8O A;  2CE7 A;  2J1D G;  1KNZ A;  3PTR B;  4IHJ E;  4TZ4 C;  3U78 A;  4EZ4 A;  1IZN B;  4H9P C;  2ZMA A;  2LE8 A;  3N2K E;  3OYX A;  3HKB E;  2NTX A;  2YU2 A;  4IE7 A;  4AKG A;  3KVA A;  3O1I A;  2CMR A;  5HYA A;  5EK4 A;  4CI2 B;  5FXW A;  4OFZ A;  4MFR A;  3CPZ A;  2ACX A;  1WRD A;  4M1P A;  5L3B B;  4EB6 E;  3AA6 B;  3FXD B;  2H3R A;  1NAF A;  5LG4 A;  3KBT A;  3MAC A;  3KBU A;  5F8P A;  4Z8X A;  2CWY A;  1LVK A;  4C90 A;  2JMK A;  4H9O C;  3O1J A;  3ZCJ A;  3J7Y q;  3IHR A;  4PFP A;  4CQI A;  1OXZ A;  5H6R B;  1KK7 A;  1YW0 A;  3S4U A;  3I9W A;  3E08 A;  4FI5 A;  2PJQ A;  4BJM A;  5LCY A;  4X1K E;  3SWH A;  3U3I A;  4O4L E;  3ZMZ B;  2ES0 A;  4DVD A;  3CQX C;  3LK4 2;  5FXV A;  4QXC B;  3Q5W A;  5IHY A;  1FEW A;  1IJ5 A;  3PU8 A;  4UEM A;  3AA7 B;  2DLR A;  4CXX A;  2NTY A;  2Q9Q D;  3RYH E;  2ZM8 A;  3PUQ A;  3UUN A;  1QSD A;  2JRK A;  3K3Q C;  5FP3 A;  2XAF B;  2KLQ A;  3GN5 A;  3RC8 A;  1HCI A;  1WLX A;  4G63 A;  3JC6 C;  2KIN B;  5HXH A;  3AVS A;  2V26 A;  2VKH A;  4QX8 B;  3ZC1 A;  3PUG A;  3Q9D A;  3ZPO A;  3N9P A;  2K5B B;  2X66 A;  3N9N A;  3OJA A;  5EK3 A;  3IBP A;  1D1A A;  4PFO A;  3H37 A;  2EHO D;  4PJJ A;  3BQI A;  3K3O A;  3HKC E;  3NBX X;  4CXW A;  4NUV A;  1B7T A;  2LM9 A;  2X9X A;  2YEV C;  3ZEF B;  2YU1 A;  5DJQ C;  4HEA A;  4O4I E;  1WYB A;  4AQG A;  1NWM X;  2LHR A;  3LK2 B;  2XHE B;  1HF8 A;  2KXP B;  1HG2 A;  2QA7 A;  5HXE A;  2H7O A;  5EZY E;  1BR1 A;  2Y48 B;  4H63 H;  2WWU A;  4HTE A;  2XAH B;  3ANW B;  1M3I A;  1U4Q A;  2E9X D;  1VOM A;  4H9N C;  3ONX A;  4ISS A;  3WAK A;  3UFE A;  2ZM0 A;  3N9M A;  2N9D A;  1U5P A;  1QUU A;  3E0Z A;  3K8P C;  3KDS E;  4HFV A;  5M4Y A;  3P7I A;  2PG8 A;  3MA9 A;  1SA0 E;  2C0S A;  3FB2 A;  4I55 E;  4YLH A;  3JC6 D;  2ZLY A;  2OA5 A;  4CZZ B;  2WMN A;  1X79 A;  5HXS A;  1HG5 A;  5LGU B;  2K9A A;  4GK0 E;  3F57 A;  3AA1 B;  3C50 A;  4X1I E;  1MMG A;  4TX5 A;  5ADX L;  3G2M A;  3N9Q A;  4E7S A;  4WBO A;  1OWA A;  1WR6 A;  2L3L A;  5HAX A;  3RH3 A;  1E1H B;  5LNK A;  1M3J A;  2L8K A;  4ZI2 C;  2CA5 A;  3C4W A;  2VAS A;  2B1E A;  2MOZ A;  4UIG A;  3C4Z A;  2XAQ B;  3ETV A;  4FJO A;  2NW7 A;  3KIN B;  5LBQ B;  1IJ6 A;  1ZEE A;  3NRY A;  3RYI E;  4AI6 A;  3L09 A;  1MIY A;  3PUR A;  4BJN A;  5A1L A;  1Z0P A;  2HH7 A;  2CWO A;  2ODU A;  3VKG A;  2JJ9 A;  3BQL A;  4BAY B;  2CXL A;  2SPC A;  2DI4 A;  2VK9 A;  5JR9 B;  5J1G A;  5LGT B;  4A56 A;  2LSY A;  3UT5 E;  3FBZ A;  4ANJ A;  2LOP A;  2Q9Q C;  3KV4 A;  1FMW A;  2A72 A;  2I59 A;  4U72 A;  1S94 A;  4UVC B;  5JDQ A;  1FIO A;  2XTL A;  3FXE B;  4DMW A;  4MAL A;  5JDN A;  5JRC A;  3ZYM A;  3SS1 A;  3ZJ2 A;  4G2A A;  2CXF A;  3Q5X A;  2D2S A;  1UX4 A;  3CQF A;  2E9X A;  4ASK A;  5E0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...