3IF8B

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
237
Chain Sequence
LFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHRIFFTNMVTCSQVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 71
structure length 237
sequence length 252
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3if8B02
3.30.1040.30 Alpha Beta 2-Layer Sandwich Carboxypeptidase Inhibitor; Chain A Carboxypeptidase Inhibitor; Chain A 3if8B03
3IF8B
chains in the Genus database with same CATH superfamily
3N9QA 4KHZF 4GKKT 4O4IE 3C51A 4HFEA 4UV9B 1M3JA 3IHRA 4LMLA 1ZFIA 5L3BB 1JNZA 4ZI2D 2LHNA 4Z91A 3FXDB 5AQGB 1DTDB 5LCYA 4KP3C 2YU2A 4E7SA 4G63A 4BJMA 2KZ7B 4ZZCA 2KMFA 2KLQA 3SWHA 2NP9A 3MZKB 3J9X1 3RKOA 1GQEA 1IBMT 3L09A 2XQ9A 5LJMA 2LHRA 2DWGA 3B5MA 4AI6A 2W62A 4QHOA 4EGWA 3VKGA 4ZZBA 2XHEB 4CXWA 4IIJE 2UUBT 3UU3A 4LF4T 4JI6T 2PJQA 4CXXA 2I59A 4NUVA 2LRKA 5EK4A 4TX5A 3AEAA 4DR6T 2V5DA 2XQ3A 4WYVA 2GK9A 5FL0A 4O4HE 3OJAA 2W61A 5AQLB 2CXFA 3O1JA 4LF8T 3I9YA 2VASA 1W09A 4JEHB 4DV0T 5DABA 3C50A 2PTFA 5AQVB 1SHZC 3GN5A 4HGAA 5LGTB 4WNKA 3AE5A 4H9NC 3TLUA 3ZN1B 5FP3A 2JPFA 3FZKB 4UVBB 1MIWA 2YOEA 3F2EA 4ZHQE 2XQYA 5C8YE 3P7IA 4PNIA 2H89A 1E2AA 3I0QA 4KHPT 2UXBT 2N2NA 5L47A 5JREA 2X0YA 1IJ5A 1CHUA 3HKEE 1SA0E 2IHR1 4LFCT 3UQ4A 3ZSTA 2H3RA 4I0UA 1VCTA 2X9XA 2XQ8A 1UGOA 2LSJA 1YW0A 2W63A 4DR2T 5FVLA 4EZHA 2WU2A 2K5BB 1M3IA 4DUZT 2UXXB 4XZCA 1XDPA 5KXJA 4JV5T 3PUVF 3MA9A 2CBIA 5LGNB 4A56A 2UU9T 2WMOA 1BR1A 1WRDA 1W0AA 3ONXA 4DBRA 4QH5A 3FB2A 2RP4A 4PAGA 3NZPA 3RPUA 5FXVA 3ZT7A 2A2FX 5JRCA 1XNRT 3AE1A 5JR9C 3G2MA 4N78D 1I94T 1J1JA 4AIUA 1HNWT 1XNQT 5JDHA 5LJNA 3N2KE 4PK6A 2XAFB 4HEAA 3ZYLA 5CFBA 3T1YT 4JI8T 4BJNA 1WLXA 2WWVA 1IAPA 4O2BE 4Q25A 3CKDA 2LSKA 4DV7T 2QGSA 3PDYA 4JI4T 3ESLA 3HA4A 4F8HA 2AE9A 2VKDA 5FY1A 3ZT5A 2MYSA 4TUYE 2IUBA 2VWAA 5L3GB 5ADXL 4ZI3C 5C3JA 1MMAA 4EB6E 2M67A 3PU8A 2JRKA 2V6YA 4JUYA 2Q9QA 4G2AA 5CGMA 4HWIB 4U31A 2JQKA 4AKGA 4LF9T 2JIWA 3R6NA 3AAIA 5L4EA 3AAAB 3OVUA 4I43B 2IC9A 4DV5T 4E7ZA 2W66A 3K3QC 2ACXA 4ISTA 1JNRA 1MNEA 2BVMA 3QOFA 3FZFB 5F3JA 3PUAA 5H6RB 1IZNB 1WR6A 3IEEA 2NW7A 3ONJA 2CHNA 1HG2A 3PUSA 1HX1B 2E2AA 3T8OA 2FJDA 4CZZB 3NVOA 4LMJA 3AEGA 4L0RA 2CWYA 4DBQA 4PJMA 4DV3T 4UELA 5HEUA 1FMWA 4P0BA 2UUAT 3PJAA 1OEDE 1KK7A 4IGUA 2JMHA 2QYWA 5KMGP 4B3ST 4ADZA 2XPKA 1X9BA 3L3PA 4KUMB 1WFDA 3A5XA 4HFHA 1D1AA 3AE4A 3IA3A 2ZM2A 3TLWA 1IJ6A 4AKHA 1OEDC 1W9RA 3JAFA 3FXEB 5FVKA 2X68A 3LBXB 3BQLA 2NWBA 2HPLA 4LMKA 2V7IA 5FNVE 2E9XC 4UV8B 2YU1A 2LM9A 4PJLA 2XUEA 3Q5XA 4P09A 4X62T 1T8BA 2CLYC 3ZEFB 5HXRA 2LM2A 2XAJB 3AE9A 3JADA 5FL1A 2JMKA 2G0UA 2LLYA 2H7VC 1H7CA 2WS3A 1NWMX 5DQVA 4HFIA 2X0HA 5AQFB 2BVLA 2LSIA 5IUXA 5L3DB 4B3MT 3K1SA 4GOUA 1V9DA 1ZOYA 2IW5B 4X20E 3CPZA 4HTEA 3AEFA 4V1Av 4U2ZA 4UVCB 2XQ4A 4YJ3E 5J1GA 1XDOA 3GN5B 2EHOA 3NZQA 4LF6T 3FBZA 2XQ5A 2K24A 3QNUA 1VOMA 4OX9T 3S4UA 1OEDB 2J1DG 1KEYA 3P4SA 3CQXC 3O4XE 2E9XB 1S94A 5LMUT 1HNZT 4H9RC 3X1DA 5H6QB 2LKGA 4DR1T 5FXXA 1UCUA 4P0AA 4ZS3A 2X0LB 3AE6A 4ZEYA 1W0BA 3PV0F 4IDPA 2OA5A 4K0UA 2K9AA 2WDRA 1YKHB 3DP7A 1HF8A 1ZP0A 3VHLA 4J2CA 3N2GE 1AJ3A 3N9LA 4IE0A 3RYHE 3P4RA 2PBIA 1EZ3A 5JRCB 3PE0A 1LVKA 2NR4A 2DNXA 1D1CA 5HEOA 2K48A 4GK5E 1ZFLA 2H7OA 1D0ZA 4IHJE 3FBLA 3CQCB 4F6RC 3AA6B 4DNDA 5AQSB 3QUJA 3I9WA 4HN9A 2LJLA 4JLEA 3IBPA 1SE7A 4GK0E 5LP6E 3RKGA 1WR0A 3Q9DA 3UU4A 3ZSSA 4LFAT 2DI4A 4OYJA 2C5IT 4M1PA 5ABFB 3SOLA 5BR8T 2ZM6T 3ZJ1A 3G06A 4UVAB 2V6YB 1M62A 4X65T 4YSYA 2XSAA 5HEGA 3CQFA 3AA1B 5FY7A 3ZMSB 4IDQA 3L39A 2XZEA 2WZHA 3NWIA 2ZLYA 4AKIA 3JC6C 2L8KA 4AXPA 1MIVA 4BA9A 4OFZA 4ILUA 5EK3A 3RYCE 2HPJA 2YDQA 2X9YA 4HFCA 5EK2A 5AQIB 2CCQA 3GA8A 3ONLC 3CMLA 4AQFC 1O3XA 4TZ4C 4X64T 2WMNA 2FJBA 5L4HA 2WM9A 2C5KT 1KNRA 3VU7H 4PK4A 3C4ZA 3C64A 1MIYA 3UUXB 4A97A 2EHOC 3ANWA 4EIWA 1T72A 5ABGA 4K0KT 3O1IA 4CI1B 1M7KA 3KBTA 1QLBA 3CX6B 2Y48B 3RQWA 2CA5A 3HKBE 3P4WA 2ODVA 1ZHCA 4U3CA 3PUZF 3P8CD 3N9PA 3ZMVB 4JI3T 1FJGT 5JDGA 2E5LT 3UQ7A 3NRXA 2VB6A 3AA0B 3HR0A 1US7B 2MTQA 3A8YC 1L0VA 3KV9A 1D1BA 3TKLB 4DR3T 3ZMZB 2WDVA 4NXMT 1DU2A 3RGLA 3N9OA 1XWMA 4GIWA 4QXHB 3RYIE 1UURA 2DCFA 2IC6A 1LRZA 5E0OA 2ACZA 3UU6A 5J2UE 2D2SA 3QC9A 2NW8A 2WB5A 2UUCT 1I6ZA 3ZN0B 3KINB 4UEMA 4C90A 5KX5E 1N33T 3Q5EA 2BG9A 3BQKA 3ZLIA 2VK9A 3E0ZA 3AVSA 3Q5WA 4H9OC 2QVAA 4U74A 4KBMB 4YFSA 4OHFA 3WAJA 4NUUA 4HFVA 2EHOB 3LDQB 3HKDE 5CJ5A 1WCRA 4ZI3D 3G2PA 2WP9A 2H88A 5HCMA 4CXYA 3OPCA 3CWZB 4JYAT 4CN4A 2M6IA 3PUGA 4IL4A 2XTLA 1T7SA 2BDEA 4IE6A 1S35A 2VKJA 1G8XA 3CQGB 2CWOA 3F57A 2CPTA 2N1GA 4MBQA 3AE7A 3ZKRA 2WDQA 3N5LA 4EYYR 4HFDA 4MHCA 5JQGE 3AXJA 1J5WA 4U72A 2UXNB 3ZT6A 2L3LA 2CM0A 3RF1A 4H9PC 2WWUA 2HN1A 2CXLA 5AQTB 5EZYE 4PJJA 1WYBA 4U2YA 4X1YE 3HKCE 2ZMAA 5AQUB 2WBLA 4JI2T 2CHOA 4YTMA 3EABA 5AQPB 4HWCA 2HHHT 1WYCA 5HAXA 3ZC0A 1BR0A 4QKNA 3FZHB 2E9XD 3GMIA 2K3WA 4TWDA 4LFBT 1NEKA 3LSVA 4ZOLE 2B76A 1G73A 5JR9B 3QK6A 4PFPA 4H9QC 4KI0F 2XASB 3SRZA 1KFYA 3CX8B 2YINA 4BIKA 2IAKA 2LSYA 1NENA 5DJQC 2VL0A 3RIUA 3CK6A 4IDZA 3F31A 2D0UA 5LHGB 4AKLA 3DTOA 2WU5A 3OYZA 1E1HB 3H37A 2ABZC 3ZCJA 3PUWF 3G2QA 2BS4A 2XAGB 4JI5T 1FMVA 3RYFE 3RH3A 5JTGA 4DO0A 3KFWX 4LF7T 2V5CA 3EAMA 2MAWA 3LK3B 4ZI7E 3AVRA 4YHHT 4HWHA 2XY8B 4AKRB 4IE5A 2W2UA 3UUNA 2BBHA 4U7YA 2QA7A 3PU3A 1MMGA 2RA1A 2YKSA 4PK5A 5CA0E 2Y8DA 4I50E 1MMDA 5LNKA 4YT0A 4HFBA 4YTPA 3LK2B 5L3FB 3VKHA 2C0SA 4EOZB 3WI3A 3LFMA 3ZCIA 1B7TA 1HR0T 3EDVA 4C91A 4QWNB 4CN1A 2F4VT 5AQRB 2FJEA 3M65A 3OKQA 5LB7B 4B3RT 2CXDA 2LOPA 1Y64B 5DQWA 4FJOA 4JBWF 4UF0A 2JJ9A 4EXTA 2BKPA 5M4YA 3CX7B 3I1AA 2ZM0A 4YY3T 2Q9QC 4A5XA 4YTNA 3ABVA 3ETUA 1YXRA 4COFA 2NTYA 2JQ9A 2W4XA 5FXZA 1KNPA 3C4WA 4ZS2A 3PJAJ 2KXPB 4NPPA 2CLYB 2PG8A 1LKXA 2MPKA 2NW9A 3VRBA 1HNXT 4ZXLA 2BZBA 2XQ7A 4QX8B 2LT3A 1IBKT 4PFOA 3HL6A 4X1KE 5TAOA 3E08A 1HFAA 4AQYT 3MK7C 2HN2A 4YSZA 2HH7A 4DMVA 2DLRA 1KF6A 1VCSA 3VRAA 3KBUA 3DJBA 3JC6D 4QX7B 2Y6XA 3AA7B 1HTJF 2IIUA 4MFRA 5AQMB 4DR7T 4NXNT 4JI7T 2KWIB 3RIUC 4A98A 4FI5A 4O4LE 3B13A 3K3NA 3QB5A 2CBJA 4X1IE 4MLKA 4TWHA 1OXZA 2W0GA 1QUUA 2VURA 3AE2A 1FEWA 1ZEEA 3O1HA 3PUQA 5JDQA 4KMCA 4CI2B 3HI2A 3L8RA 3MACA 4UR9A 2XM1A 2EHOD 2BS3A 4Z90A 3NBXX 3K3OA 2VQFT 1VRBA 2NOXA 4OK0A 2Q9QB 4ILCA 3ZMUB 2L9QA 1HG5A 2WZIA 4UXNB 1J5ET 5AFUL 5AQQB 5JDLA 1T98A 2VKHA 2X51A 4TN7B 2V26A 3RIFA 4DMWA 2C5JA 5JH7E 3N2OA 3KVBA 5IYZE 2XAHB 1HS7A 4JEUB 3H3MA 3RQUA 3TLTA 4IDNA 4DUYT 3UTKA 3LBXA 4BAYB 3PTRB 3V5SA 3BQIA 3CVRA 3RC8A 1SUMB 4HE8A 5IHYA 3W15B 2VVSA 3AE8A 1X79A 3KV6A 1XZYA 4EZ4A 5HEJA 2B1EA 1HCIA 3OYXA 5LG4A 2BS2A 4I4TE 2M6BA 2CMRA 4ZI2C 2CE7A 1LVFA 4NIQA 2N9DA 3TLVA 3UULA 1KNZA 2W67A 2YEVC 2JQHA 3ZYKA 2NTXA 2UXDT 4AQGA 4O8SA 2VQET 2DWKA 2X66A 2V8SV 2LRLA 3UFGA 1YKEB 3OBVE 3EUHA 5FY0A 4TWFA 3FHNA 5FKYA 2XQ6A 3I0OA 5ABHA 3AEBA 3PJVD 3MXZA 2KT9A 3K8PC 3TLSA 2OLTA 1OEDA 4QH4A 2D9DA 4LF5T 2V7KA 3M3ZB 5HXEA 2KNDA 5LGUB 2W00A 2A3DA 2IDOB 2E9XA 4ILBA 4WZXA 4YJ2E 2A9UA 4O4JE 2P9BA 2I0MA 3GWHA 4CI3B 4XBFB 2X9WA 1YD8G 2A72A 2ZM8A 4IREA 1MMNA 1Z8UA 3P4PA 4IE4A 5L3CB 5AQHB 3VR9A 3MJXA 2KWHA 5HXCA 4QXBB 3RIAA 2YDSA 4TNVA 5JDMA 2UXCT 4UF0B 2D5UA 5HEHA 5ETWA 4U7IA 4DIDB 5IWAT 3B57A 4DVDA 3OTOT 2VKOA 4MALA 2YN6A 4H9SE 1ZV4X 4QXCB 3KV5A 3Q2MA 3KVAA 4YXDA 3ZYMA 5BMVE 4TV9E 3N9MA 1UUSA 2KINB 1UK5A 3H3AA 3RI5A 3NKZA 2BKNA 3RHWA 4YHJA 4JI1T 2E5VA 2V6XA 3UUMA 3WAKA 3ZJ2A 4HSCX 1ZKEA 3RRCA 3E22E 5C2TA 1IBLT 2XQAA 2V1DB 5L2LA 2XAQB 2XSBA 5ABFA 2IMLA 5HYAA 5LYJE 5HCJA 3QB5K 3PUXF 3FZMB 3BK9A 3JAEA 1D0XA 5LXTE 1Z0PA 4QH1A 3FZLB 4ISSA 4P1NA 4GKJT 4ASKA 4O2AE 5LBQB 2V7JA 5LHIB 2LSGA 1N36T 4H63H 2DHRA 2VVNA 4X5TA 5HXSA 3AEDA 4ANJA 4IT4A 3C4XA 2RPAA 5FMNA 1N34T 2XJ7A 2Z6EA 3R84B 5HXHA 3EVYA 4XAXB 1QSDA 3KDSE 2WY2A 3PURA 4L9IA 2MBGA 2OV9A 2YDRA 2ES0A 5F5WA 2DL1A 1PFOA 2X9HA 3LJCA 5A1LA 3HVNA 4DV6T 4YLHA 2X67A 3LK42 5L3EB 2WAUA 1MNDA 4EEDA 3AB3B 2BG9E 3ZMTB 1YQ3A 3AE3A 3EHZA 4ILAA 2WSSV 2KSRA 1YQ4A 1BR4A 3SS1A 2J47A 2BG9C 4KX6A 2LEHA 3ZC1A 2MOZA 2FUPA 4OYKA 2J62A 2BKOA 5JVDE 3ZPOA 4I55E 3A7MA 4HKAA 4EAHA 3ANWB 3ETVA 4DR4T 3O9XA 3MKDA 4EEBA 3UU5A 4WBNE 1U4QA 2Q9QD 1E7PA 3J7Yq 4U33A 5LHHB 5LOVE 3CIRA 5HWXA 3AAEB 5LMNT 5AQJB 4Z8XA 4IL9A 1Y01A 2LKHA 4CN6A 4EYUA 4L5GA 4AQFA 2J4GA 1N32T 5LBMA 5LG3A 1XMOT 3NRYA 4B3TT 1FIOA 2CEAA 3RRWA 5JDNA 5FXWA 3RX6A 3LG7A 5CB4E 3V5UA 4UIGA 4JI0T 3EDUA 2WCAA 3P4QA 4PW8A 2D0TA 4X66T 2V7LA 3RLFF 3SFDA 3UUBA 1OWAA 5ABEA 4WBOA 5F8PA 1CUNA 5GONE 4AISA 2AXDS 5LA6E 3P50A 1BR2A 5CA1E 2VL8A 1S3RA 2LE8A 5FYMA 5J0ZA 3RC3A 2BG9B 1HX8A 4H63V 1NAFA 2XM2A 1U5PA 3VR8A 3UT5E 2BBJA 3AECA 1UX4A 2WQYA 3Q5DA 4EV6A 2FBWA 3EI0A 2YK0A 4IE7A 4TV8E 1R8IA 1DTVA 1UX5A 1D0YA 2QRXA 2LOSA 3SFEA 2SPCA 4HWDA 2JQQA 3D0TA 1XMQT 3U3IA 3PUYF 5KDMC 4ERRA 3KV4A 4GYSA 2PFVA 4IDOA 3C98B 3T1HT 4TNWA 3UFEA 4DV4T 3N9NA 4DV1T 5AQKB 3AEEA 2R6GF 3U78A 5JDFA 2V7MA 5HWYA 4HWFA 5AQNB 4GYRA 3UU8A 3IF8B 2E8IA 4YSXA 2CRBA 3AXJB 3G2OA 2FJAA 4WW0A 5AQOB 3JCFA 4CQIA 4B6XA 2I6HA 4PJNA 5JR9A 5J2TE 4DR5T 4DV2T 2ODUA
chains in the Genus database with same CATH topology
3PJVD 3N9QA 5J1GA 3MXZA 2KT9A 1WYCA 3GN5B 3K8PC 4O4IE 5HAXA 3ZC0A 4HSCX 3C51A 1BR0A 2EHOA 4QKNA 3GMIA 2E9XD 3NZQA 3FBZA 4UV9B 2K24A 1M3JA 2V7KA 3IHRA 5HXEA 2KNDA 5LGUB 1VOMA 2W00A 5L3BB 4ZOLE 2A3DA 2E9XA 1G73A 5JR9B 3QK6A 4PFPA 4H9QC 4YJ2E 4O4JE 4ZI2D 2LHNA 3FXDB 2P9BA 2XASB 3GWHA 3SRZA 4CI3B 3S4UA 4XBFB 2X9WA 3CX8B 1YD8G 2A72A 2ZM8A 5LCYA 2YINA 4KP3C 2YU2A 4BIKA 2J1DG 1MMNA 4E7SA 4G63A 4BJMA 4IE4A 2IAKA 5L3CB 2LSYA 2KZ7B 5DJQC 3CQXC 2KMFA 2KLQA 3SWHA 3O4XE 3MJXA 2E9XB 1S94A 2KWHA 2NP9A 3MZKB 4IDZA 5HXCA 3J9X1 3F31A 3RKOA 2D0UA 4QXBB 4H9RC 5LHGB 4AKLA 3DTOA 3L09A 5LJMA 5H6QB 3OYZA 5FXXA 1E1HB 1UCUA 2LHRA 2DWGA 3H37A 5JDMA 4AI6A 4UF0B 2D5UA 4P0AA 4ZS3A 2X0LB 2W62A 4QHOA 5ETWA 3ZCJA 3G2QA 3VKGA 2XAGB 2OA5A 3B57A 2K9AA 2XHEB 4K0UA 4CXWA 1FMVA 4DVDA 3RYFE 2VKOA 4IIJE 3RH3A 4DO0A 4MALA 1YKHB 3DP7A 1HF8A 3KFWX 3VHLA 4H9SE 1ZV4X 2PJQA 4J2CA 4QXCB 4CXXA 3KV5A 3Q2MA 2I59A 3KVAA 4NUVA 3N2GE 5EK4A 3LK3B 4TX5A 3N9LA 3ZYMA 4TV9E 5BMVE 1AJ3A 4IE0A 4ZI7E 3RYHE 3AVRA 3N9MA 2PBIA 1EZ3A 5JRCB 2KINB 3PE0A 1LVKA 2GK9A 4O4HE 3H3AA 4AKRB 2DNXA 3OJAA 2W61A 1D1CA 4IE5A 2CXFA 3UUNA 3O1JA 2K48A 4GK5E 3I9YA 2VASA 4YHJA 4JEHB 5DABA 3UUMA 3C50A 3WAKA 2QA7A 3ZJ2A 2H7OA 1SHZC 1D0ZA 1ZKEA 3FBLA 1MMGA 2RA1A 3CQCB 3E22E 3PU3A 4IHJE 4PK5A 3RRCA 3GN5A 2Y8DA 4F6RC 5CA0E 4HGAA 3AA6B 4DNDA 5LGTB 3QUJA 4I50E 4WNKA 3I9WA 2V1DB 5L2LA 1MMDA 2XAQB 4HN9A 2LJLA 4H9NC 4JLEA 3ZN1B 5HYAA 5LNKA 5FP3A 5LYJE 3IBPA 2JPFA 4GK0E 5LP6E 4UVBB 1MIWA 5L3FB 3LK2B 3BK9A 3F2EA 4ZHQE 3VKHA 2C0SA 4EOZB 2XQYA 3WI3A 3LFMA 5C8YE 1D0XA 3Q9DA 3ZCIA 5LXTE 3P7IA 1Z0PA 4PNIA 1B7TA 2DI4A 3I0QA 4OYJA 2N2NA 2C5IT 3EDVA 4C91A 4QWNB 4M1PA 4ISSA 5JREA 4ASKA 4O2AE 3SOLA 1IJ5A 5LBQB 3HKEE 2V7JA 5LHIB 3M65A 1SA0E 3OKQA 2LSGA 4H63H 2H3RA 2DHRA 3ZJ1A 2CXDA 4UVAB 5HXSA 2X9XA 4ANJA 2LOPA 2LSJA 3CQFA 3AA1B 5FY7A 1Y64B 3C4XA 1YW0A 2W63A 5FMNA 5DQWA 3ZMSB 4EZHA 2Z6EA 2K5BB 3R84B 1M3IA 2ZLYA 4AKIA 4FJOA 4UF0A 3JC6C 2L8KA 2UXXB 4AXPA 4XZCA 5HXHA 1MIVA 4BA9A 3EVYA 4XAXB 4OFZA 2JJ9A 4EXTA 4ILUA 3CX7B 5M4YA 3I1AA 5EK3A 2ZM0A 3RYCE 1QSDA 3KDSE 2HPJA 3MA9A 5LGNB 3PURA 4L9IA 2X9YA 2MBGA 4A56A 2Q9QC 5EK2A 2CCQA 2WMOA 3GA8A 3ETUA 2ES0A 1BR1A 2NTYA 5FXZA 1PFOA 1WRDA 3C4WA 4ZS2A 3ONXA 3CMLA 4DBRA 3FB2A 2RP4A 2X9HA 3LJCA 5A1LA 3HVNA 4AQFC 2KXPB 4YLHA 2CLYB 1O3XA 2X67A 4TZ4C 4PAGA 2PG8A 3NZPA 3RPUA 1LKXA 2WMNA 3LK42 5FXVA 2WAUA 5L3EB 2A2FX 5JRCA 1MNDA 3AB3B 2NW9A 5JR9C 3ZMTB 3G2MA 2WM9A 2C5KT 4N78D 3VU7H 4PK4A 2BZBA 5JDHA 5LJNA 3N2KE 4PK6A 2WSSV 2XAFB 3C64A 3C4ZA 4QX8B 4HEAA 1MIYA 3UUXB 2EHOC 3ANWA 2LT3A 4EIWA 1BR4A 4PFOA 3SS1A 3ZYLA 3HL6A 4X1KE 5TAOA 3E08A 3O1IA 1HFAA 2LEHA 3MK7C 3ZC1A 4BJNA 4CI1B 2HH7A 2MOZA 1WLXA 1IAPA 4O2BE 4OYKA 3KBTA 3CKDA 2LSKA 4DMVA 2DLRA 3CX6B 2QGSA 2Y48B 3PDYA 3ESLA 3HA4A 2CA5A 3HKBE 5JVDE 2ODVA 2VKDA 1ZHCA 3KBUA 4I55E 4HKAA 3DJBA 3JC6D 5FY1A 4QX7B 3P8CD 4EAHA 3ANWB 3N9PA 2Y6XA 3ZMVB 3AA7B 3ETVA 2MYSA 4TUYE 1HTJF 4MFRA 5JDGA 3O9XA 3MKDA 3NRXA 2VB6A 3AA0B 3HR0A 1US7B 4WBNE 2MTQA 2VWAA 5L3GB 1U4QA 3KV9A 2KWIB 2Q9QD 1D1BA 4FI5A 3TKLB 5ADXL 4O4LE 3B13A 3ZMZB 3J7Yq 4ZI3C 3K3NA 5LHHB 1MMAA 4EB6E 4X1IE 2M67A 3N9OA 5LOVE 5HWXA 3PU8A 4MLKA 4GIWA 1OXZA 3AAEB 2W0GA 2JRKA 4QXHB 1QUUA 3RYIE 4JUYA 2Q9QA 4Z8XA 4G2AA 1FEWA 1ZEEA 2DCFA 2IC6A 3O1HA 3PUQA 4AKGA 5JDQA 1LRZA 4KMCA 3R6NA 4CI2B 3AAIA 3HI2A 4EYUA 3AAAB 4L5GA 4AQFA 3MACA 5E0OA 5LBMA 5J2UE 2D2SA 4I43B 3NRYA 2IC9A 2EHOD 3QC9A 4E7ZA 1FIOA 3K3QC 2ACXA 2NW8A 2CEAA 3NBXX 3K3OA 3RRWA 1VRBA 2NOXA 5JDNA 4OK0A 2Q9QB 4ISTA 5FXWA 3ZMUB 3RX6A 3LG7A 1MNEA 5CB4E 2BVMA 3V5UA 2L9QA 3ZN0B 5F3JA 3PUAA 1HG5A 5H6RB 4UXNB 1IZNB 3KINB 4UEMA 1WR6A 4UIGA 4C90A 5KX5E 3IEEA 5AFUL 5JDLA 1T98A 2NW7A 2VKHA 2X51A 3EDUA 3BQKA 4PW8A 4TN7B 3ZLIA 2VK9A 2D0TA 3E0ZA 2V26A 3AVSA 1HG2A 3PUSA 4DMWA 2V7LA 3Q5WA 4H9OC 2C5JA 3T8OA 5JH7E 4CZZB 3N2OA 3KVBA 4U74A 5IYZE 2XAHB 4L0RA 2CWYA 1OWAA 1HS7A 4KBMB 4YFSA 4DBQA 4PJMA 4OHFA 4WBOA 5F8PA 1CUNA 5GONE 3WAJA 4NUUA 5LA6E 4JEUB 4HFVA 4UELA 1BR2A 2EHOB 1FMWA 4P0BA 5CA1E 2VL8A 1S3RA 2LE8A 3HKDE 5FYMA 3UTKA 4ZI3D 3G2PA 3RC3A 1KK7A 1HX8A 4H63V 4IGUA 2JMHA 3LBXA 1NAFA 5KMGP 4ADZA 4CXYA 3L3PA 3ZPOA 4BAYB 4KUMB 3CWZB 3PTRB 3A5XA 1D1AA 1U5PA 3V5SA 2ZM2A 3BQIA 3UT5E 3PUGA 3CVRA 1IJ6A 1UX4A 3RC8A 4AKHA 4HE8A 5IHYA 2XTLA 2BDEA 4IE6A 3FXEB 3W15B 2YK0A 1S35A 2VKJA 2X68A 4IE7A 4TV8E 1G8XA 3CQGB 1X79A 2CWOA 3KV6A 3LBXB 1UX5A 3F57A 4EZ4A 1D0YA 3BQLA 2NWBA 2N1GA 2B1EA 2HPLA 2V7IA 5FNVE 2E9XC 2LOSA 4UV8B 4MBQA 2SPCA 2YU1A 2LM9A 1HCIA 4PJLA 2XUEA 3Q5XA 3N5LA 3OYXA 4EYYR 5LG4A 4P09A 2JQQA 3D0TA 4I4TE 4MHCA 5JQGE 3U3IA 5KDMC 4ERRA 2CMRA 2CLYC 3KV4A 4U72A 3ZEFB 4GYSA 5HXRA 2CE7A 4ZI2C 2PFVA 2XAJB 2UXNB 3C98B 1LVFA 2L3LA 2N9DA 3UFEA 3UULA 2JMKA 3N9NA 2CM0A 1KNZA 2YEVC 2G0UA 3ZYKA 2H7VC 1H7CA 1NWMX 2NTXA 4H9PC 2WWUA 2V7MA 5HWYA 5JDFA 3U78A 2CXLA 4AQGA 5DQVA 4O8SA 2DWKA 2X66A 4GYRA 3IF8B 2E8IA 2BVLA 5EZYE 2LSIA 4PJJA 1WYBA 5L3DB 3G2OA 4X1YE 1YKEB 3OBVE 3HKCE 3EUHA 5FY0A 4GOUA 2ZMAA 4WW0A 1V9DA 2WBLA 3FHNA 2IW5B 4CQIA 4B6XA 4X20E 3CPZA 4HTEA 4V1Av 3I0OA 4PJNA 4UVCB 5JR9A 5J2TE 4YJ3E 2ODUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 B; 
#chains in the Genus database with same CATH topology
 3N9Q A;  4KHZ F;  4GKK T;  4O4I E;  3C51 A;  4HFE A;  4UV9 B;  1M3J A;  3IHR A;  4LML A;  1ZFI A;  5L3B B;  1JNZ A;  4ZI2 D;  2LHN A;  4Z91 A;  3FXD B;  5AQG B;  1DTD B;  5LCY A;  4KP3 C;  2YU2 A;  4E7S A;  4G63 A;  4BJM A;  2KZ7 B;  4ZZC A;  2KMF A;  2KLQ A;  3SWH A;  2NP9 A;  3MZK B;  3J9X 1;  3RKO A;  1GQE A;  1IBM T;  3L09 A;  2XQ9 A;  5LJM A;  2LHR A;  2DWG A;  3B5M A;  4AI6 A;  2W62 A;  4QHO A;  4EGW A;  3VKG A;  4ZZB A;  2XHE B;  4CXW A;  4IIJ E;  2UUB T;  3UU3 A;  4LF4 T;  4JI6 T;  2PJQ A;  4CXX A;  2I59 A;  4NUV A;  2LRK A;  5EK4 A;  4TX5 A;  3AEA A;  4DR6 T;  2V5D A;  2XQ3 A;  4WYV A;  2GK9 A;  5FL0 A;  4O4H E;  3OJA A;  2W61 A;  5AQL B;  2CXF A;  3O1J A;  4LF8 T;  3I9Y A;  2VAS A;  1W09 A;  4JEH B;  4DV0 T;  5DAB A;  3C50 A;  2PTF A;  5AQV B;  1SHZ C;  3GN5 A;  4HGA A;  5LGT B;  4WNK A;  3AE5 A;  4H9N C;  3TLU A;  3ZN1 B;  5FP3 A;  2JPF A;  3FZK B;  4UVB B;  1MIW A;  2YOE A;  3F2E A;  4ZHQ E;  2XQY A;  5C8Y E;  3P7I A;  4PNI A;  2H89 A;  1E2A A;  3I0Q A;  4KHP T;  2UXB T;  2N2N A;  5L47 A;  5JRE A;  2X0Y A;  1IJ5 A;  1CHU A;  3HKE E;  1SA0 E;  2IHR 1;  4LFC T;  3UQ4 A;  3ZST A;  2H3R A;  4I0U A;  1VCT A;  2X9X A;  2XQ8 A;  1UGO A;  2LSJ A;  1YW0 A;  2W63 A;  4DR2 T;  5FVL A;  4EZH A;  2WU2 A;  2K5B B;  1M3I A;  4DUZ T;  2UXX B;  4XZC A;  1XDP A;  5KXJ A;  4JV5 T;  3PUV F;  3MA9 A;  2CBI A;  5LGN B;  4A56 A;  2UU9 T;  2WMO A;  1BR1 A;  1WRD A;  1W0A A;  3ONX A;  4DBR A;  4QH5 A;  3FB2 A;  2RP4 A;  4PAG A;  3NZP A;  3RPU A;  5FXV A;  3ZT7 A;  2A2F X;  5JRC A;  1XNR T;  3AE1 A;  5JR9 C;  3G2M A;  4N78 D;  1I94 T;  1J1J A;  4AIU A;  1HNW T;  1XNQ T;  5JDH A;  5LJN A;  3N2K E;  4PK6 A;  2XAF B;  4HEA A;  3ZYL A;  5CFB A;  3T1Y T;  4JI8 T;  4BJN A;  1WLX A;  2WWV A;  1IAP A;  4O2B E;  4Q25 A;  3CKD A;  2LSK A;  4DV7 T;  2QGS A;  3PDY A;  4JI4 T;  3ESL A;  3HA4 A;  4F8H A;  2AE9 A;  2VKD A;  5FY1 A;  3ZT5 A;  2MYS A;  4TUY E;  2IUB A;  2VWA A;  5L3G B;  5ADX L;  4ZI3 C;  5C3J A;  1MMA A;  4EB6 E;  2M67 A;  3PU8 A;  2JRK A;  2V6Y A;  4JUY A;  2Q9Q A;  4G2A A;  5CGM A;  4HWI B;  4U31 A;  2JQK A;  4AKG A;  4LF9 T;  2JIW A;  3R6N A;  3AAI A;  5L4E A;  3AAA B;  3OVU A;  4I43 B;  2IC9 A;  4DV5 T;  4E7Z A;  2W66 A;  3K3Q C;  2ACX A;  4IST A;  1JNR A;  1MNE A;  2BVM A;  3QOF A;  3FZF B;  5F3J A;  3PUA A;  5H6R B;  1IZN B;  1WR6 A;  3IEE A;  2NW7 A;  3ONJ A;  2CHN A;  1HG2 A;  3PUS A;  1HX1 B;  2E2A A;  3T8O A;  2FJD A;  4CZZ B;  3NVO A;  4LMJ A;  3AEG A;  4L0R A;  2CWY A;  4DBQ A;  4PJM A;  4DV3 T;  4UEL A;  5HEU A;  1FMW A;  4P0B A;  2UUA T;  3PJA A;  1OED E;  1KK7 A;  4IGU A;  2JMH A;  2QYW A;  5KMG P;  4B3S T;  4ADZ A;  2XPK A;  1X9B A;  3L3P A;  4KUM B;  1WFD A;  3A5X A;  4HFH A;  1D1A A;  3AE4 A;  3IA3 A;  2ZM2 A;  3TLW A;  1IJ6 A;  4AKH A;  1OED C;  1W9R A;  3JAF A;  3FXE B;  5FVK A;  2X68 A;  3LBX B;  3BQL A;  2NWB A;  2HPL A;  4LMK A;  2V7I A;  5FNV E;  2E9X C;  4UV8 B;  2YU1 A;  2LM9 A;  4PJL A;  2XUE A;  3Q5X A;  4P09 A;  4X62 T;  1T8B A;  2CLY C;  3ZEF B;  5HXR A;  2LM2 A;  2XAJ B;  3AE9 A;  3JAD A;  5FL1 A;  2JMK A;  2G0U A;  2LLY A;  2H7V C;  1H7C A;  2WS3 A;  1NWM X;  5DQV A;  4HFI A;  2X0H A;  5AQF B;  2BVL A;  2LSI A;  5IUX A;  5L3D B;  4B3M T;  3K1S A;  4GOU A;  1V9D A;  1ZOY A;  2IW5 B;  4X20 E;  3CPZ A;  4HTE A;  3AEF A;  4V1A v;  4U2Z A;  4UVC B;  2XQ4 A;  4YJ3 E;  5J1G A;  1XDO A;  3GN5 B;  2EHO A;  3NZQ A;  4LF6 T;  3FBZ A;  2XQ5 A;  2K24 A;  3QNU A;  1VOM A;  4OX9 T;  3S4U A;  1OED B;  2J1D G;  1KEY A;  3P4S A;  3CQX C;  3O4X E;  2E9X B;  1S94 A;  5LMU T;  1HNZ T;  4H9R C;  3X1D A;  5H6Q B;  2LKG A;  4DR1 T;  5FXX A;  1UCU A;  4P0A A;  4ZS3 A;  2X0L B;  3AE6 A;  4ZEY A;  1W0B A;  3PV0 F;  4IDP A;  2OA5 A;  4K0U A;  2K9A A;  2WDR A;  1YKH B;  3DP7 A;  1HF8 A;  1ZP0 A;  3VHL A;  4J2C A;  3N2G E;  1AJ3 A;  3N9L A;  4IE0 A;  3RYH E;  3P4R A;  2PBI A;  1EZ3 A;  5JRC B;  3PE0 A;  1LVK A;  2NR4 A;  2DNX A;  1D1C A;  5HEO A;  2K48 A;  4GK5 E;  1ZFL A;  2H7O A;  1D0Z A;  4IHJ E;  3FBL A;  3CQC B;  4F6R C;  3AA6 B;  4DND A;  5AQS B;  3QUJ A;  3I9W A;  4HN9 A;  2LJL A;  4JLE A;  3IBP A;  1SE7 A;  4GK0 E;  5LP6 E;  3RKG A;  1WR0 A;  3Q9D A;  3UU4 A;  3ZSS A;  4LFA T;  2DI4 A;  4OYJ A;  2C5I T;  4M1P A;  5ABF B;  3SOL A;  5BR8 T;  2ZM6 T;  3ZJ1 A;  3G06 A;  4UVA B;  2V6Y B;  1M62 A;  4X65 T;  4YSY A;  2XSA A;  5HEG A;  3CQF A;  3AA1 B;  5FY7 A;  3ZMS B;  4IDQ A;  3L39 A;  2XZE A;  2WZH A;  3NWI A;  2ZLY A;  4AKI A;  3JC6 C;  2L8K A;  4AXP A;  1MIV A;  4BA9 A;  4OFZ A;  4ILU A;  5EK3 A;  3RYC E;  2HPJ A;  2YDQ A;  2X9Y A;  4HFC A;  5EK2 A;  5AQI B;  2CCQ A;  3GA8 A;  3ONL C;  3CML A;  4AQF C;  1O3X A;  4TZ4 C;  4X64 T;  2WMN A;  2FJB A;  5L4H A;  2WM9 A;  2C5K T;  1KNR A;  3VU7 H;  4PK4 A;  3C4Z A;  3C64 A;  1MIY A;  3UUX B;  4A97 A;  2EHO C;  3ANW A;  4EIW A;  1T72 A;  5ABG A;  4K0K T;  3O1I A;  4CI1 B;  1M7K A;  3KBT A;  1QLB A;  3CX6 B;  2Y48 B;  3RQW A;  2CA5 A;  3HKB E;  3P4W A;  2ODV A;  1ZHC A;  4U3C A;  3PUZ F;  3P8C D;  3N9P A;  3ZMV B;  4JI3 T;  1FJG T;  5JDG A;  2E5L T;  3UQ7 A;  3NRX A;  2VB6 A;  3AA0 B;  3HR0 A;  1US7 B;  2MTQ A;  3A8Y C;  1L0V A;  3KV9 A;  1D1B A;  3TKL B;  4DR3 T;  3ZMZ B;  2WDV A;  4NXM T;  1DU2 A;  3RGL A;  3N9O A;  1XWM A;  4GIW A;  4QXH B;  3RYI E;  1UUR A;  2DCF A;  2IC6 A;  1LRZ A;  5E0O A;  2ACZ A;  3UU6 A;  5J2U E;  2D2S A;  3QC9 A;  2NW8 A;  2WB5 A;  2UUC T;  1I6Z A;  3ZN0 B;  3KIN B;  4UEM A;  4C90 A;  5KX5 E;  1N33 T;  3Q5E A;  2BG9 A;  3BQK A;  3ZLI A;  2VK9 A;  3E0Z A;  3AVS A;  3Q5W A;  4H9O C;  2QVA A;  4U74 A;  4KBM B;  4YFS A;  4OHF A;  3WAJ A;  4NUU A;  4HFV A;  2EHO B;  3LDQ B;  3HKD E;  5CJ5 A;  1WCR A;  4ZI3 D;  3G2P A;  2WP9 A;  2H88 A;  5HCM A;  4CXY A;  3OPC A;  3CWZ B;  4JYA T;  4CN4 A;  2M6I A;  3PUG A;  4IL4 A;  2XTL A;  1T7S A;  2BDE A;  4IE6 A;  1S35 A;  2VKJ A;  1G8X A;  3CQG B;  2CWO A;  3F57 A;  2CPT A;  2N1G A;  4MBQ A;  3AE7 A;  3ZKR A;  2WDQ A;  3N5L A;  4EYY R;  4HFD A;  4MHC A;  5JQG E;  3AXJ A;  1J5W A;  4U72 A;  2UXN B;  3ZT6 A;  2L3L A;  2CM0 A;  3RF1 A;  4H9P C;  2WWU A;  2HN1 A;  2CXL A;  5AQT B;  5EZY E;  4PJJ A;  1WYB A;  4U2Y A;  4X1Y E;  3HKC E;  2ZMA A;  5AQU B;  2WBL A;  4JI2 T;  2CHO A;  4YTM A;  3EAB A;  5AQP B;  4HWC A;  2HHH T;  1WYC A;  5HAX A;  3ZC0 A;  1BR0 A;  4QKN A;  3FZH B;  2E9X D;  3GMI A;  2K3W A;  4TWD A;  4LFB T;  1NEK A;  3LSV A;  4ZOL E;  2B76 A;  1G73 A;  5JR9 B;  3QK6 A;  4PFP A;  4H9Q C;  4KI0 F;  2XAS B;  3SRZ A;  1KFY A;  3CX8 B;  2YIN A;  4BIK A;  2IAK A;  2LSY A;  1NEN A;  5DJQ C;  2VL0 A;  3RIU A;  3CK6 A;  4IDZ A;  3F31 A;  2D0U A;  5LHG B;  4AKL A;  3DTO A;  2WU5 A;  3OYZ A;  1E1H B;  3H37 A;  2ABZ C;  3ZCJ A;  3PUW F;  3G2Q A;  2BS4 A;  2XAG B;  4JI5 T;  1FMV A;  3RYF E;  3RH3 A;  5JTG A;  4DO0 A;  3KFW X;  4LF7 T;  2V5C A;  3EAM A;  2MAW A;  3LK3 B;  4ZI7 E;  3AVR A;  4YHH T;  4HWH A;  2XY8 B;  4AKR B;  4IE5 A;  2W2U A;  3UUN A;  2BBH A;  4U7Y A;  2QA7 A;  3PU3 A;  1MMG A;  2RA1 A;  2YKS A;  4PK5 A;  5CA0 E;  2Y8D A;  4I50 E;  1MMD A;  5LNK A;  4YT0 A;  4HFB A;  4YTP A;  3LK2 B;  5L3F B;  3VKH A;  2C0S A;  4EOZ B;  3WI3 A;  3LFM A;  3ZCI A;  1B7T A;  1HR0 T;  3EDV A;  4C91 A;  4QWN B;  4CN1 A;  2F4V T;  5AQR B;  2FJE A;  3M65 A;  3OKQ A;  5LB7 B;  4B3R T;  2CXD A;  2LOP A;  1Y64 B;  5DQW A;  4FJO A;  4JBW F;  4UF0 A;  2JJ9 A;  4EXT A;  2BKP A;  5M4Y A;  3CX7 B;  3I1A A;  2ZM0 A;  4YY3 T;  2Q9Q C;  4A5X A;  4YTN A;  3ABV A;  3ETU A;  1YXR A;  4COF A;  2NTY A;  2JQ9 A;  2W4X A;  5FXZ A;  1KNP A;  3C4W A;  4ZS2 A;  3PJA J;  2KXP B;  4NPP A;  2CLY B;  2PG8 A;  1LKX A;  2MPK A;  2NW9 A;  3VRB A;  1HNX T;  4ZXL A;  2BZB A;  2XQ7 A;  4QX8 B;  2LT3 A;  1IBK T;  4PFO A;  3HL6 A;  4X1K E;  5TAO A;  3E08 A;  1HFA A;  4AQY T;  3MK7 C;  2HN2 A;  4YSZ A;  2HH7 A;  4DMV A;  2DLR A;  1KF6 A;  1VCS A;  3VRA A;  3KBU A;  3DJB A;  3JC6 D;  4QX7 B;  2Y6X A;  3AA7 B;  1HTJ F;  2IIU A;  4MFR A;  5AQM B;  4DR7 T;  4NXN T;  4JI7 T;  2KWI B;  3RIU C;  4A98 A;  4FI5 A;  4O4L E;  3B13 A;  3K3N A;  3QB5 A;  2CBJ A;  4X1I E;  4MLK A;  4TWH A;  1OXZ A;  2W0G A;  1QUU A;  2VUR A;  3AE2 A;  1FEW A;  1ZEE A;  3O1H A;  3PUQ A;  5JDQ A;  4KMC A;  4CI2 B;  3HI2 A;  3L8R A;  3MAC A;  4UR9 A;  2XM1 A;  2EHO D;  2BS3 A;  4Z90 A;  3NBX X;  3K3O A;  2VQF T;  1VRB A;  2NOX A;  4OK0 A;  2Q9Q B;  4ILC A;  3ZMU B;  2L9Q A;  1HG5 A;  2WZI A;  4UXN B;  1J5E T;  5AFU L;  5AQQ B;  5JDL A;  1T98 A;  2VKH A;  2X51 A;  4TN7 B;  2V26 A;  3RIF A;  4DMW A;  2C5J A;  5JH7 E;  3N2O A;  3KVB A;  5IYZ E;  2XAH B;  1HS7 A;  4JEU B;  3H3M A;  3RQU A;  3TLT A;  4IDN A;  4DUY T;  3UTK A;  3LBX A;  4BAY B;  3PTR B;  3V5S A;  3BQI A;  3CVR A;  3RC8 A;  1SUM B;  4HE8 A;  5IHY A;  3W15 B;  2VVS A;  3AE8 A;  1X79 A;  3KV6 A;  1XZY A;  4EZ4 A;  5HEJ A;  2B1E A;  1HCI A;  3OYX A;  5LG4 A;  2BS2 A;  4I4T E;  2M6B A;  2CMR A;  4ZI2 C;  2CE7 A;  1LVF A;  4NIQ A;  2N9D A;  3TLV A;  3UUL A;  1KNZ A;  2W67 A;  2YEV C;  2JQH A;  3ZYK A;  2NTX A;  2UXD T;  4AQG A;  4O8S A;  2VQE T;  2DWK A;  2X66 A;  2V8S V;  2LRL A;  3UFG A;  1YKE B;  3OBV E;  3EUH A;  5FY0 A;  4TWF A;  3FHN A;  5FKY A;  2XQ6 A;  3I0O A;  5ABH A;  3AEB A;  3PJV D;  3MXZ A;  2KT9 A;  3K8P C;  3TLS A;  2OLT A;  1OED A;  4QH4 A;  2D9D A;  4LF5 T;  2V7K A;  3M3Z B;  5HXE A;  2KND A;  5LGU B;  2W00 A;  2A3D A;  2IDO B;  2E9X A;  4ILB A;  4WZX A;  4YJ2 E;  2A9U A;  4O4J E;  2P9B A;  2I0M A;  3GWH A;  4CI3 B;  4XBF B;  2X9W A;  1YD8 G;  2A72 A;  2ZM8 A;  4IRE A;  1MMN A;  1Z8U A;  3P4P A;  4IE4 A;  5L3C B;  5AQH B;  3VR9 A;  3MJX A;  2KWH A;  5HXC A;  4QXB B;  3RIA A;  2YDS A;  4TNV A;  5JDM A;  2UXC T;  4UF0 B;  2D5U A;  5HEH A;  5ETW A;  4U7I A;  4DID B;  5IWA T;  3B57 A;  4DVD A;  3OTO T;  2VKO A;  4MAL A;  2YN6 A;  4H9S E;  1ZV4 X;  4QXC B;  3KV5 A;  3Q2M A;  3KVA A;  4YXD A;  3ZYM A;  5BMV E;  4TV9 E;  3N9M A;  1UUS A;  2KIN B;  1UK5 A;  3H3A A;  3RI5 A;  3NKZ A;  2BKN A;  3RHW A;  4YHJ A;  4JI1 T;  2E5V A;  2V6X A;  3UUM A;  3WAK A;  3ZJ2 A;  4HSC X;  1ZKE A;  3RRC A;  3E22 E;  5C2T A;  1IBL T;  2XQA A;  2V1D B;  5L2L A;  2XAQ B;  2XSB A;  5ABF A;  2IML A;  5HYA A;  5LYJ E;  5HCJ A;  3QB5 K;  3PUX F;  3FZM B;  3BK9 A;  3JAE A;  1D0X A;  5LXT E;  1Z0P A;  4QH1 A;  3FZL B;  4ISS A;  4P1N A;  4GKJ T;  4ASK A;  4O2A E;  5LBQ B;  2V7J A;  5LHI B;  2LSG A;  1N36 T;  4H63 H;  2DHR A;  2VVN A;  4X5T A;  5HXS A;  3AED A;  4ANJ A;  4IT4 A;  3C4X A;  2RPA A;  5FMN A;  1N34 T;  2XJ7 A;  2Z6E A;  3R84 B;  5HXH A;  3EVY A;  4XAX B;  1QSD A;  3KDS E;  2WY2 A;  3PUR A;  4L9I A;  2MBG A;  2OV9 A;  2YDR A;  2ES0 A;  5F5W A;  2DL1 A;  1PFO A;  2X9H A;  3LJC A;  5A1L A;  3HVN A;  4DV6 T;  4YLH A;  2X67 A;  3LK4 2;  5L3E B;  2WAU A;  1MND A;  4EED A;  3AB3 B;  2BG9 E;  3ZMT B;  1YQ3 A;  3AE3 A;  3EHZ A;  4ILA A;  2WSS V;  2KSR A;  1YQ4 A;  1BR4 A;  3SS1 A;  2J47 A;  2BG9 C;  4KX6 A;  2LEH A;  3ZC1 A;  2MOZ A;  2FUP A;  4OYK A;  2J62 A;  2BKO A;  5JVD E;  3ZPO A;  4I55 E;  3A7M A;  4HKA A;  4EAH A;  3ANW B;  3ETV A;  4DR4 T;  3O9X A;  3MKD A;  4EEB A;  3UU5 A;  4WBN E;  1U4Q A;  2Q9Q D;  1E7P A;  3J7Y q;  4U33 A;  5LHH B;  5LOV E;  3CIR A;  5HWX A;  3AAE B;  5LMN T;  5AQJ B;  4Z8X A;  4IL9 A;  1Y01 A;  2LKH A;  4CN6 A;  4EYU A;  4L5G A;  4AQF A;  2J4G A;  1N32 T;  5LBM A;  5LG3 A;  1XMO T;  3NRY A;  4B3T T;  1FIO A;  2CEA A;  3RRW A;  5JDN A;  5FXW A;  3RX6 A;  3LG7 A;  5CB4 E;  3V5U A;  4UIG A;  4JI0 T;  3EDU A;  2WCA A;  3P4Q A;  4PW8 A;  2D0T A;  4X66 T;  2V7L A;  3RLF F;  3SFD A;  3UUB A;  1OWA A;  5ABE A;  4WBO A;  5F8P A;  1CUN A;  5GON E;  4AIS A;  2AXD S;  5LA6 E;  3P50 A;  1BR2 A;  5CA1 E;  2VL8 A;  1S3R A;  2LE8 A;  5FYM A;  5J0Z A;  3RC3 A;  2BG9 B;  1HX8 A;  4H63 V;  1NAF A;  2XM2 A;  1U5P A;  3VR8 A;  3UT5 E;  2BBJ A;  3AEC A;  1UX4 A;  2WQY A;  3Q5D A;  4EV6 A;  2FBW A;  3EI0 A;  2YK0 A;  4IE7 A;  4TV8 E;  1R8I A;  1DTV A;  1UX5 A;  1D0Y A;  2QRX A;  2LOS A;  3SFE A;  2SPC A;  4HWD A;  2JQQ A;  3D0T A;  1XMQ T;  3U3I A;  3PUY F;  5KDM C;  4ERR A;  3KV4 A;  4GYS A;  2PFV A;  4IDO A;  3C98 B;  3T1H T;  4TNW A;  3UFE A;  4DV4 T;  3N9N A;  4DV1 T;  5AQK B;  3AEE A;  2R6G F;  3U78 A;  5JDF A;  2V7M A;  5HWY A;  4HWF A;  5AQN B;  4GYR A;  3UU8 A;  3IF8 B;  2E8I A;  4YSX A;  2CRB A;  3AXJ B;  3G2O A;  2FJA A;  4WW0 A;  5AQO B;  3JCF A;  4CQI A;  4B6X A;  2I6H A;  4PJN A;  5JR9 A;  5J2T E;  4DR5 T;  4DV2 T;  2ODU A; 
#chains in the Genus database with same CATH homology
 3PJV D;  3N9Q A;  5J1G A;  3MXZ A;  2KT9 A;  1WYC A;  3GN5 B;  3K8P C;  4O4I E;  5HAX A;  3ZC0 A;  4HSC X;  3C51 A;  1BR0 A;  2EHO A;  4QKN A;  3GMI A;  2E9X D;  3NZQ A;  3FBZ A;  4UV9 B;  2K24 A;  1M3J A;  2V7K A;  3IHR A;  5HXE A;  2KND A;  5LGU B;  1VOM A;  2W00 A;  5L3B B;  4ZOL E;  2A3D A;  2E9X A;  1G73 A;  5JR9 B;  3QK6 A;  4PFP A;  4H9Q C;  4YJ2 E;  4O4J E;  4ZI2 D;  2LHN A;  3FXD B;  2P9B A;  2XAS B;  3GWH A;  3SRZ A;  4CI3 B;  3S4U A;  4XBF B;  2X9W A;  3CX8 B;  1YD8 G;  2A72 A;  2ZM8 A;  5LCY A;  2YIN A;  4KP3 C;  2YU2 A;  4BIK A;  2J1D G;  1MMN A;  4E7S A;  4G63 A;  4BJM A;  4IE4 A;  2IAK A;  5L3C B;  2LSY A;  2KZ7 B;  5DJQ C;  3CQX C;  2KMF A;  2KLQ A;  3SWH A;  3O4X E;  3MJX A;  2E9X B;  1S94 A;  2KWH A;  2NP9 A;  3MZK B;  4IDZ A;  5HXC A;  3J9X 1;  3F31 A;  3RKO A;  2D0U A;  4QXB B;  4H9R C;  5LHG B;  4AKL A;  3DTO A;  3L09 A;  5LJM A;  5H6Q B;  3OYZ A;  5FXX A;  1E1H B;  1UCU A;  2LHR A;  2DWG A;  3H37 A;  5JDM A;  4AI6 A;  4UF0 B;  2D5U A;  4P0A A;  4ZS3 A;  2X0L B;  2W62 A;  4QHO A;  5ETW A;  3ZCJ A;  3G2Q A;  3VKG A;  2XAG B;  2OA5 A;  3B57 A;  2K9A A;  2XHE B;  4K0U A;  4CXW A;  1FMV A;  4DVD A;  3RYF E;  2VKO A;  4IIJ E;  3RH3 A;  4DO0 A;  4MAL A;  1YKH B;  3DP7 A;  1HF8 A;  3KFW X;  3VHL A;  4H9S E;  1ZV4 X;  2PJQ A;  4J2C A;  4QXC B;  4CXX A;  3KV5 A;  3Q2M A;  2I59 A;  3KVA A;  4NUV A;  3N2G E;  5EK4 A;  3LK3 B;  4TX5 A;  3N9L A;  3ZYM A;  4TV9 E;  5BMV E;  1AJ3 A;  4IE0 A;  4ZI7 E;  3RYH E;  3AVR A;  3N9M A;  2PBI A;  1EZ3 A;  5JRC B;  2KIN B;  3PE0 A;  1LVK A;  2GK9 A;  4O4H E;  3H3A A;  4AKR B;  2DNX A;  3OJA A;  2W61 A;  1D1C A;  4IE5 A;  2CXF A;  3UUN A;  3O1J A;  2K48 A;  4GK5 E;  3I9Y A;  2VAS A;  4YHJ A;  4JEH B;  5DAB A;  3UUM A;  3C50 A;  3WAK A;  2QA7 A;  3ZJ2 A;  2H7O A;  1SHZ C;  1D0Z A;  1ZKE A;  3FBL A;  1MMG A;  2RA1 A;  3CQC B;  3E22 E;  3PU3 A;  4IHJ E;  4PK5 A;  3RRC A;  3GN5 A;  2Y8D A;  4F6R C;  5CA0 E;  4HGA A;  3AA6 B;  4DND A;  5LGT B;  3QUJ A;  4I50 E;  4WNK A;  3I9W A;  2V1D B;  5L2L A;  1MMD A;  2XAQ B;  4HN9 A;  2LJL A;  4H9N C;  4JLE A;  3ZN1 B;  5HYA A;  5LNK A;  5FP3 A;  5LYJ E;  3IBP A;  2JPF A;  4GK0 E;  5LP6 E;  4UVB B;  1MIW A;  5L3F B;  3LK2 B;  3BK9 A;  3F2E A;  4ZHQ E;  3VKH A;  2C0S A;  4EOZ B;  2XQY A;  3WI3 A;  3LFM A;  5C8Y E;  1D0X A;  3Q9D A;  3ZCI A;  5LXT E;  3P7I A;  1Z0P A;  4PNI A;  1B7T A;  2DI4 A;  3I0Q A;  4OYJ A;  2N2N A;  2C5I T;  3EDV A;  4C91 A;  4QWN B;  4M1P A;  4ISS A;  5JRE A;  4ASK A;  4O2A E;  3SOL A;  1IJ5 A;  5LBQ B;  3HKE E;  2V7J A;  5LHI B;  3M65 A;  1SA0 E;  3OKQ A;  2LSG A;  4H63 H;  2H3R A;  2DHR A;  3ZJ1 A;  2CXD A;  4UVA B;  5HXS A;  2X9X A;  4ANJ A;  2LOP A;  2LSJ A;  3CQF A;  3AA1 B;  5FY7 A;  1Y64 B;  3C4X A;  1YW0 A;  2W63 A;  5FMN A;  5DQW A;  3ZMS B;  4EZH A;  2Z6E A;  2K5B B;  3R84 B;  1M3I A;  2ZLY A;  4AKI A;  4FJO A;  4UF0 A;  3JC6 C;  2L8K A;  2UXX B;  4AXP A;  4XZC A;  5HXH A;  1MIV A;  4BA9 A;  3EVY A;  4XAX B;  4OFZ A;  2JJ9 A;  4EXT A;  4ILU A;  3CX7 B;  5M4Y A;  3I1A A;  5EK3 A;  2ZM0 A;  3RYC E;  1QSD A;  3KDS E;  2HPJ A;  3MA9 A;  5LGN B;  3PUR A;  4L9I A;  2X9Y A;  2MBG A;  4A56 A;  2Q9Q C;  5EK2 A;  2CCQ A;  2WMO A;  3GA8 A;  3ETU A;  2ES0 A;  1BR1 A;  2NTY A;  5FXZ A;  1PFO A;  1WRD A;  3C4W A;  4ZS2 A;  3ONX A;  3CML A;  4DBR A;  3FB2 A;  2RP4 A;  2X9H A;  3LJC A;  5A1L A;  3HVN A;  4AQF C;  2KXP B;  4YLH A;  2CLY B;  1O3X A;  2X67 A;  4TZ4 C;  4PAG A;  2PG8 A;  3NZP A;  3RPU A;  1LKX A;  2WMN A;  3LK4 2;  5FXV A;  2WAU A;  5L3E B;  2A2F X;  5JRC A;  1MND A;  3AB3 B;  2NW9 A;  5JR9 C;  3ZMT B;  3G2M A;  2WM9 A;  2C5K T;  4N78 D;  3VU7 H;  4PK4 A;  2BZB A;  5JDH A;  5LJN A;  3N2K E;  4PK6 A;  2WSS V;  2XAF B;  3C64 A;  3C4Z A;  4QX8 B;  4HEA A;  1MIY A;  3UUX B;  2EHO C;  3ANW A;  2LT3 A;  4EIW A;  1BR4 A;  4PFO A;  3SS1 A;  3ZYL A;  3HL6 A;  4X1K E;  5TAO A;  3E08 A;  3O1I A;  1HFA A;  2LEH A;  3MK7 C;  3ZC1 A;  4BJN A;  4CI1 B;  2HH7 A;  2MOZ A;  1WLX A;  1IAP A;  4O2B E;  4OYK A;  3KBT A;  3CKD A;  2LSK A;  4DMV A;  2DLR A;  3CX6 B;  2QGS A;  2Y48 B;  3PDY A;  3ESL A;  3HA4 A;  2CA5 A;  3HKB E;  5JVD E;  2ODV A;  2VKD A;  1ZHC A;  3KBU A;  4I55 E;  4HKA A;  3DJB A;  3JC6 D;  5FY1 A;  4QX7 B;  3P8C D;  4EAH A;  3ANW B;  3N9P A;  2Y6X A;  3ZMV B;  3AA7 B;  3ETV A;  2MYS A;  4TUY E;  1HTJ F;  4MFR A;  5JDG A;  3O9X A;  3MKD A;  3NRX A;  2VB6 A;  3AA0 B;  3HR0 A;  1US7 B;  4WBN E;  2MTQ A;  2VWA A;  5L3G B;  1U4Q A;  3KV9 A;  2KWI B;  2Q9Q D;  1D1B A;  4FI5 A;  3TKL B;  5ADX L;  4O4L E;  3B13 A;  3ZMZ B;  3J7Y q;  4ZI3 C;  3K3N A;  5LHH B;  1MMA A;  4EB6 E;  4X1I E;  2M67 A;  3N9O A;  5LOV E;  5HWX A;  3PU8 A;  4MLK A;  4GIW A;  1OXZ A;  3AAE B;  2W0G A;  2JRK A;  4QXH B;  1QUU A;  3RYI E;  4JUY A;  2Q9Q A;  4Z8X A;  4G2A A;  1FEW A;  1ZEE A;  2DCF A;  2IC6 A;  3O1H A;  3PUQ A;  4AKG A;  5JDQ A;  1LRZ A;  4KMC A;  3R6N A;  4CI2 B;  3AAI A;  3HI2 A;  4EYU A;  3AAA B;  4L5G A;  4AQF A;  3MAC A;  5E0O A;  5LBM A;  5J2U E;  2D2S A;  4I43 B;  3NRY A;  2IC9 A;  2EHO D;  3QC9 A;  4E7Z A;  1FIO A;  3K3Q C;  2ACX A;  2NW8 A;  2CEA A;  3NBX X;  3K3O A;  3RRW A;  1VRB A;  2NOX A;  5JDN A;  4OK0 A;  2Q9Q B;  4IST A;  5FXW A;  3ZMU B;  3RX6 A;  3LG7 A;  1MNE A;  5CB4 E;  2BVM A;  3V5U A;  2L9Q A;  3ZN0 B;  5F3J A;  3PUA A;  1HG5 A;  5H6R B;  4UXN B;  1IZN B;  3KIN B;  4UEM A;  1WR6 A;  4UIG A;  4C90 A;  5KX5 E;  3IEE A;  5AFU L;  5JDL A;  1T98 A;  2NW7 A;  2VKH A;  2X51 A;  3EDU A;  3BQK A;  4PW8 A;  4TN7 B;  3ZLI A;  2VK9 A;  2D0T A;  3E0Z A;  2V26 A;  3AVS A;  1HG2 A;  3PUS A;  4DMW A;  2V7L A;  3Q5W A;  4H9O C;  2C5J A;  3T8O A;  5JH7 E;  4CZZ B;  3N2O A;  3KVB A;  4U74 A;  5IYZ E;  2XAH B;  4L0R A;  2CWY A;  1OWA A;  1HS7 A;  4KBM B;  4YFS A;  4DBQ A;  4PJM A;  4OHF A;  4WBO A;  5F8P A;  1CUN A;  5GON E;  3WAJ A;  4NUU A;  5LA6 E;  4JEU B;  4HFV A;  4UEL A;  1BR2 A;  2EHO B;  1FMW A;  4P0B A;  5CA1 E;  2VL8 A;  1S3R A;  2LE8 A;  3HKD E;  5FYM A;  3UTK A;  4ZI3 D;  3G2P A;  3RC3 A;  1KK7 A;  1HX8 A;  4H63 V;  4IGU A;  2JMH A;  3LBX A;  1NAF A;  5KMG P;  4ADZ A;  4CXY A;  3L3P A;  3ZPO A;  4BAY B;  4KUM B;  3CWZ B;  3PTR B;  3A5X A;  1D1A A;  1U5P A;  3V5S A;  2ZM2 A;  3BQI A;  3UT5 E;  3PUG A;  3CVR A;  1IJ6 A;  1UX4 A;  3RC8 A;  4AKH A;  4HE8 A;  5IHY A;  2XTL A;  2BDE A;  4IE6 A;  3FXE B;  3W15 B;  2YK0 A;  1S35 A;  2VKJ A;  2X68 A;  4IE7 A;  4TV8 E;  1G8X A;  3CQG B;  1X79 A;  2CWO A;  3KV6 A;  3LBX B;  1UX5 A;  3F57 A;  4EZ4 A;  1D0Y A;  3BQL A;  2NWB A;  2N1G A;  2B1E A;  2HPL A;  2V7I A;  5FNV E;  2E9X C;  2LOS A;  4UV8 B;  4MBQ A;  2SPC A;  2YU1 A;  2LM9 A;  1HCI A;  4PJL A;  2XUE A;  3Q5X A;  3N5L A;  3OYX A;  4EYY R;  5LG4 A;  4P09 A;  2JQQ A;  3D0T A;  4I4T E;  4MHC A;  5JQG E;  3U3I A;  5KDM C;  4ERR A;  2CMR A;  2CLY C;  3KV4 A;  4U72 A;  3ZEF B;  4GYS A;  5HXR A;  2CE7 A;  4ZI2 C;  2PFV A;  2XAJ B;  2UXN B;  3C98 B;  1LVF A;  2L3L A;  2N9D A;  3UFE A;  3UUL A;  2JMK A;  3N9N A;  2CM0 A;  1KNZ A;  2YEV C;  2G0U A;  3ZYK A;  2H7V C;  1H7C A;  1NWM X;  2NTX A;  4H9P C;  2WWU A;  2V7M A;  5HWY A;  5JDF A;  3U78 A;  2CXL A;  4AQG A;  5DQV A;  4O8S A;  2DWK A;  2X66 A;  4GYR A;  3IF8 B;  2E8I A;  2BVL A;  5EZY E;  2LSI A;  4PJJ A;  1WYB A;  5L3D B;  3G2O A;  4X1Y E;  1YKE B;  3OBV E;  3HKC E;  3EUH A;  5FY0 A;  4GOU A;  2ZMA A;  4WW0 A;  1V9D A;  2WBL A;  3FHN A;  2IW5 B;  4CQI A;  4B6X A;  4X20 E;  3CPZ A;  4HTE A;  4V1A v;  3I0O A;  4PJN A;  4UVC B;  5JR9 A;  5J2T E;  4YJ3 E;  2ODU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...