1E9TA

High resolution solution structure of human intestinal trefoil factor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell motility factor
molecule keywords INTESTINAL TREFOIL FACTOR
publication title High-Resolution Solution Structure of Human Intestinal Trefoil Factor and Functional Insights from Detailed Structural Comparisons with the Other Members of the Trefoil Family of Mammalian Cell Motility Factors
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 1e9tA00
1PE31 3L4YA 2QLYA 2PSPA 1PS2A 3TOPA 3LPPA 2QMJA 3L4XA 1PCPA 3L4TA 3L4VA 3L4ZA 3LPOA 1PSPA 3TONA 1HI7A 3L4UA 3CTTA 3L4WA 1E9TA
chains in the Genus database with same CATH superfamily
1PE31 3L4YA 2QLYA 2PSPA 1PS2A 3TOPA 3LPPA 2QMJA 3L4XA 1PCPA 3L4TA 3L4VA 3L4ZA 1XU6A 3LPOA 1PSPA 3TONA 1HI7A 3L4UA 3CTTA 3L4WA 1E9TA
chains in the Genus database with same CATH topology
1PE31 3L4YA 2QLYA 2PSPA 1PS2A 3TOPA 3LPPA 2QMJA 3L4XA 1PCPA 3L4TA 3L4VA 3L4ZA 3LPOA 1PSPA 3TONA 1HI7A 3L4UA 3CTTA 3L4WA 1E9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE3 1;  3L4Y A;  2QLY A;  2PSP A;  1PS2 A;  3TOP A;  3LPP A;  2QMJ A;  3L4X A;  1PCP A;  3L4T A;  3L4V A;  3L4Z A;  3LPO A;  1PSP A;  3TON A;  1HI7 A;  3L4U A;  3CTT A;  3L4W A;  1E9T A; 
#chains in the Genus database with same CATH topology
 1PE3 1;  3L4Y A;  2QLY A;  2PSP A;  1PS2 A;  3TOP A;  3LPP A;  2QMJ A;  3L4X A;  1PCP A;  3L4T A;  3L4V A;  3L4Z A;  1XU6 A;  3LPO A;  1PSP A;  3TON A;  1HI7 A;  3L4U A;  3CTT A;  3L4W A;  1E9T A; 
#chains in the Genus database with same CATH homology
 1PE3 1;  3L4Y A;  2QLY A;  2PSP A;  1PS2 A;  3TOP A;  3LPP A;  2QMJ A;  3L4X A;  1PCP A;  3L4T A;  3L4V A;  3L4Z A;  3LPO A;  1PSP A;  3TON A;  1HI7 A;  3L4U A;  3CTT A;  3L4W A;  1E9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...