3L4WA

Crystal complex of n-terminal human maltase-glucoamylase with miglitol
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
864
structure length
863
Chain Sequence
b'VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 270
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4wA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4wA01
1HVXA 3AOFA 3HJEA 3DX1A 3MUY1 1WAWA 4C7GA 4DWSC 3UR8A 5KEZA 1H0IA 3AIRA 1OIMA 4D6CA 4D72A 4S3KA 7TAAA 3ZIZA 4AXNA 5A8QA 4XB3A 3AHYA 4UQEA 4FK9A 1E6ZA 1HNYA 3BC9A 4H7VA 1BLIA 3BUPA 5CGMA 4HMDA 3AIWA 1FH7A 4M82A 3CMGA 3L4XA 3CPUA 5A2AA 3VIHA 3CUIA 3ZO9A 3EJUA 5BCAA 3KEHA 3AS1A 1JF5A 4QP0A 4AD2A 3CV5A 1BGAA 4UFHA 5GQBA 1PIFA 4AZHA 2V3EA 1Q6FA 1UASA 3T0BA 2VX5A 5C71A 3DX0A 1HT6A 1KXTA 1PS3A 1QPKA 4WSKA 4GPNA 5D9MA 3L4TA 3FHAA 3RIKA 1V3JA 1HJWA 3WF3A 2UY3A 3VM5A 1XH1A 2YOCA 3WH5A 2F61A 1PX8A 3ZJ8A 1BGGA 4AZ6A 5I3DA 3NJ3A 2DSWA 1LL7A 5CLTA 4EKJA 4MB1A 2XG9A 3N04A 3VVGA 2JIEA 2D0HA 1X6NA 2X2JA 3MU7A 4A3YA 4CU8A 5IHRA 1MYRA 1TA3A 2WMFA 4P7LA 3BCDA 2VZSA 3K4AA 3RDKA 5JBEA 3TOPA 3VDCA 3M6DA 3AS2A 2VX7A 1J0IA 2EBNA 3TA9A 2VJXA 4F8XA 4PYSA 4XZBA 5I23A 1YQ2A 2A3CA 3TV8A 1WCGA 1SYTA 3AXXA 3BVVA 2XN1A 2JF7A 2W67A 5ABFB 3ZT5A 1HP5A 2WPGA 1CXHA 4DUXA 2ZX9A 1GORA 3EMCA 4D1JA 5EFFA 3SCNA 5A6BA 3WUFA 4UQDA 4D6FA 4KWUA 3D4YA 4B15A 1J0KA 1TZ7A 2XN0A 3MMUA 1BYCA 2UY2A 2XVNA 4U2YA 3GH5A 3SEPA 3WD3A 4H8VA 1XSKA 2YFNA 2UY4A 2VUYA 1UKTA 3MKKA 4FLOA 1CXLA 3WF1A 1TR1A 3POCA 1KBBA 3WNOA 2G3JA 1CGVA 4ATLA 2BVDA 2BHUA 3WDIA 3PZ9A 4HPGA 4HOZA 1JI2A 5ABGA 3AIQA 1W3LA 1PIGA 4QLKA 5FIPA 1K6AA 4PMZA 4D6HA 4X0NA 1OT2A 1H49A 2RGMA 2DPEA 3K8KA 1TMQA 1DHKA 1UQZA 4MNJA 2G3MA 2BVYA 9CGTA 3WDHA 1UD2A 1BYDA 3ARYA 1RPKA 5A8MA 2D73A 1BF2A 1OBAA 4KH2A 1J0JA 2WHJA 2GJXB 3EMQA 1KBKA 1EQCA 2GDVA 3DX2A 2WK2A 3PZOA 3TONA 3GNOA 4CD7A 2XFYA 2CCRA 5D8ZA 3N17A 4HZ6A 1AQMA 3CIVA 3IJ8A 4GQQA 1G9HA 1QI2A 2X0HA 3VKKA 2WWDA 4M56A 1PZ2A 3VGBA 4HU8A 1R47A 3EJPA 2WYSA 4JFSA 3QHOA 3ZJ6A 2CBUA 1US3A 4DWSA 2W63A 3PTMA 4FNSA 3DECA 2YLAA 3AS3A 1CGTA 4FNRA 3PZQA 4Q22A 1JZ8A 1E4MM 3AI0A 4R5EA 2WHMA 4J3XA 1OIFA 4UTFA 3HG4A 4D71A 1XD0A 1G5AA 2NT1A 1EH9A 1Q6DA 5CPQA 1CPUA 3GBEA 4NXKA 1ZL1A 4W7UA 3IAQA 5M03A 4RE2A 2W5FA 3S2CA 2Y2WA 5A2CA 2WC3A 1UR8A 5DEZA 3DYOA 2J75A 2WMJA 4OUEA 1UD5A 4PMYA 3AHTA 1CGXA 3W26A 4WKAA 1SR0A 2BVTA 1V3KA 3OGVA 2J8GA 1E3XA 2YL9A 2VRJA 3LPPA 2WVVA 2B31A 1LL4A 3DYPA 4KGJA 3M07A 3WNKA 1B1YA 3WNPA 4B16A 1E6SM 4GKLA 4AYSA 5FL0A 4PTMA 4PUEA 3MS8A 2J7EA 2PWDA 2D24A 2CHNA 3VNZA 1ZBKA 1E43A 1QI4A 3EDDA 2UWFA 1H4PA 2PWEA 2QLYA 2Y8KA 1BYBA 3CUHA 1C90A 4NXSA 3CHFA 4QCEA 5BXSA 3N12A 2X0YA 1WZAA 3UG5A 3QHNA 1V6UA 4HZ8A 4YHGA 3II1A 6A3HA 1E6XM 1JZ6A 4NI3A 5HBFA 4Z2JA 2WZIA 1W2VA 5CZKA 1IZJA 3W29A 1DTUA 1KWKA 4DO5A 1GQLA 4ZEPA 2EQDA 3VTRA 2J7GA 3WELA 1HIZA 1HI7A 4ZFMA 4AD3A 5CPTA 3AIBA 2XSAA 2OSXA 2FH6A 3W81A 1EOMA 3WENA 3PZTA 2WSPA 3IANA 5ABEA 2CXGA 4HP5A 2BHYA 1L0PA 2XN2A 1K9TA 1TA3B 4F79A 2OW6A 1ECEA 2IXUA 1JF6A 4GI9A 1ODZA 3W0KA 3SIMA 3O2LA 4A3HA 2W66A 5E9AA 1HJVA 4P8VA 2E4TA 4Z2HA 3WN6A 1TVNA 3FAWA 4U2ZA 2DSUA 4P8WA 5E09A 4H8HA 2YFOA 5LA2A 2E8YA 1L8NA 1JDDA 4V2XA 3GXFA 1CXIA 3CBWA 2D20A 3OIHA 2BXYA 1BYAA 4W88A 2GFTA 4BQ5A 1LG1A 1E6PA 1I75A 1E4LA 3CHEA 5IXEA 1KQZA 3IJ9A 1TG7A 2QMJA 2VZTA 4WLCA 1PSPA 2GJRA 2XGBA 1UHVA 1OB0A 4MDOA 1NWTA 3AS0A 3CHCA 2O9RA 4UOQA 1OGSA 1E15A 1LF1A 2VTFA 3T2OA 2X09A 2PWFA 1JZ4A 3UESA 2OSWA 2WMHA 1VFFA 4OBSA 1B2YA 4PTVA 3AISA 3WNNA 3QHMA 1WDQA 2J77A 2WXDM 2DSKA 4EAMA 1MXGA 4UQCA 1XYZA 5DMYA 1OD0A 3H53A 1R46A 4WSJA 2VZUA 2ZE0A 1E55A 3WSUA 3EYPA 3W27A 1G01A 3W4RA 1B0IA 4JFUA 1E4NA 5D9NA 1UKQA 2EACA 2VMFA 1V6WA 4D1IA 5IHSA 2DH2A 3W6LA 1CXKA 2PBOA 4IUGA 1LWJA 4WIWA 4LGXA 3AYRA 1B3YA 3VGDA 1GOMA 2V3GA 1UWSA 5E6YA 4IPLA 1GW1A 4TOQA 1JDCA 3RPMA 1NOFA 3B8SA 1Q6GA 2VI0A 3VM7A 1KR1A 4ACZA 5E0CA 1SMDA 2XYLA 4W5ZA 1ZS2A 5I0DA 3U5YA 1HN1A 1UOKA 3D50A 3VPLA 2UY5A 2AAAA 1EQPA 4J3UA 1B90A 2DGAA 1E0WA 1CBGA 2XSBA 3ARSA 4DM1A 2E9LA 1R87A 1BHGA 1HL9A 1EXPA 1JNEA 4AC1X 4NX0A 3WNMA 4AD0A 1TVPA 3AMDA 4CGTA 1K9FA 5FKYA 1NWUA 4W8AA 3EJSA 1UZ4A 3SCPA 3RM4A 3PZVA 4YHEA 1GJUA 4U3AA 1W1TA 1FFQA 5FD0A 3VUPA 5A69A 2DT3A 2CNCA 5A8NA 3TP4A 2VZVA 1BSIA 2WVVB 1DWFM 4V27A 3WF0A 2E9MA 3W24A 1J11A 5A6SA 3BCFA 5A94A 3GXMA 7A3HA 4AIEA 4NZCA 4XZWA 2JIWA 4AMCA 3WEZA 1GNXA 4CVWA 4AZCB 5BYWA 2DDXA 1KR0A 4UQ9A 4Y7EA 5AYBA 4CD4A 2OWCA 5I24A 1A3HA 1JYWA 1G1YA 2EJ1A 2E0PA 4DO4A 3FNDA 5I2UA 1KFWA 3THCA 1QWNA 2NT0A 5HPOA 1HXJA 2XFRA 3ZMRA 1QW9A 5BXRA 4J3VA 3ZM8A 5HPCA 1NQ6A 2FGLA 3RILA 2FYVA 1V08A 1NOWA 1CYGA 5EMYA 2FDMA 3PZMA 3FN9A 1V3HA 4U33A 4ML4A 4DUVA 4JAWA 5D9OA 3GXIA 4JKMA 3BVTA 3AYSA 3OLDA 4Z2LA 2QF8A 2DT0A 1KQYA 1JG9A 2W4XA 2YL8A 1N82A 4HA1A 1EO7A 2VCBA 3S5YA 4B3LA 1W2PA 1KXQA 5FCZA 2IUZA 3KLLA 1WO2A 1CEOA 3DDGA 5AY7A 4AMWA 1V6VA 5A95A 1E0VA 4XUYA 1GPFA 5IFTA 4U5IA 1EDGA 2VO5A 1E72M 3B9EA 2XWEA 1E9LA 4GO9A 3T0DA 3VGHA 3E1F1 5BROA 2QHAA 2DSVA 3H54A 3GYCA 2Y5EA 1HKIA 1J18A 3RM9A 3SCTA 1JFHA 1QW8A 3UEQA 3TTOA 1CLXA 4NF7A 3I3DA 2ZUNA 1E6NA 3G6MA 3D5HA 1ZJAA 2WNWA 4PMUA 3QOKA 3DC0A 1EDQA 2EADA 2ZXBA 2JE8A 3GH7A 1J12A 1VEOA 2EABA 3K46A 4KGLA 4FNPA 3AHXA 2XHYA 3N18A 4EE9A 4P8XA 4PMVA 2XGIA 1KXVA 3MV11 3VD5A 1OGBA 2XM1A 1RP8A 3L2LA 1B3ZA 2YBTA 4W8BA 3D52A 1W9UA 1KGWA 3VNYA 3NUKA 1F4HA 1WKYA 2TAAA 4J27A 3BVUA 1V0NA 3BSHA 1S46A 4H04A 3U57A 5JUVA 4JL1A 1V02A 1JFXA 1R86A 2BS9A 3PTKA 1XGZA 2GDUA 1W9DM 2OWXA 1NP0A 3K8MA 1FHDA 3WUBA 1W9BM 4RE4A 1OWQA 2XIBA 1HL8A 2XTKA 4W86A 3A47A 3BAKA 1UYQA 3WKZA 2YA2A 3K8LA 3LPFA 1UKSA 1MVYA 2ZUTA 5BRQA 2J62A 3KWXA 2DT1A 2GK1A 4UFLA 2YLLA 4WKFA 3FW6A 2WCSA 1EO5A 1KWGA 1NWRA 2CEQA 1HKJA 1PAMA 1GQIA 5EB8A 1WE5A 3K1DA 3CHDA 3GXPA 1ESWA 3T09A 4QCFA 2Y4SA 1LG2A 2JEQA 3KL0A 1V3MA 3WBAA 1NM9A 1JZ7A 2J8FA 4ACZB 3VX1A 1FP8A 2J7CA 5DFAA 4OOZA 5LA0A 1ZBWA 3DYMA 2ZIDA 5AYIA 3BAIA 4OJYA 2FH8A 4NRSA 5D4YA 2EAEA 3T2PA 1EIBA 1KCLA 3MO4A 3AIVA 2IGTA 3ARQA 1CXEA 3EBVA 2FHFA 4LXFA 4E8CA 2A3EA 2ZUVA 1R85A 4J3TA 4UOZA 1E56A 3CO4A 2AOSA 1JYNA 1CGYA 4W85A 1QI0A 3F5KA 4TUFA 4BS0A 1H09A 2CBVA 3ZQ9A 3EDJA 3ARUA 5IDIA 1C91A 1K9EA 2D3NA 1R34A 3WEMA 2YL6A 3J7HA 1V0MA 3OGRA 3CZJA 2PB1A 4CD5A 3EJQA 1J9YA 4BZYA 2RGLA 4X9YA 3VIJA 1HKKA 3WF2A 3W28A 4AD5A 2OYMA 3F5LA 2IXVA 3OZPA 2CERA 5I79A 5E0FA 4L4OA 1C8YA 2VRKA 3VDHA 4UOJA 1UD4A 2NW0A 2PWHA 3THDA 1FH9A 2WM0A 5EBAA 1JIBA 5M5DA 3OZOA 1ODUA 2WMIA 3OBAA 1XCXA 4LYQA 1MW0A 5CSYA 4PTXA 3T08A 1KTBA 4MB5A 1UA7A 2XIIA 1FOBA 1GHSA 4HZ7A 2CYGA 3CC1A 1T0OA 3W37A 1UQYA 3PZUA 3NDYA 4LYRA 3S5ZA 4LX4A 3T0AA 2QMKA 3ECQA 4CKQA 1I1XA 4BF7A 1QOXA 1RH9A 5CJ5A 3BMWA 2CHOA 1W32A 4BQ2A 3CZGA 3VGFA 3GNRA 3VGGA 3CH9A 3IK2A 2FHBA 3LX9A 3AHZA 3CZ8A 1QI5A 6CGTA 3GNPA 2CESA 4WK9A 2BY2A 3L4VA 4H41A 1R8LA 2F7PA 3WIJA 1Q6EA 1QHOA 2VR5A 1CTNA 4Z2KA 4NZFA 1GONA 2XVPA 4B9YA 1UR0A 3SCVA 2J7DA 4AWEA 1EHNA 1SFSA 1BFNA 4V28A 1JL8A 1OINA 3S6TA 2CPUA 1VRXA 5F7UA 1NARA 1ZU8A 2ALWA 3OG2A 3WQ6A 1ITXA 1B30A 4N0RA 4D6IA 1C93A 1JXJA 4AZGA 3A5VA 1TQTA 2O9OA 3N15A 1BPLB 3RCNA 1V02E 1HJQA 1O7AA 3AIEA 2VR4A 4CUCA 4FLQA 1CZ1A 2JFEX 4UFJA 1TQVA 2PF0A 5A3HA 1GQJA 4YPJA 2BHZA 1NOUA 4ZXLA 3GXDA 2D0GA 2Y8VA 2CIPA 4PBGA 4JFVA 4CU7A 5JBDA 4JCMA 2DT2A 5BRPA 3GM8A 1R75A 1XYFA 5FL1A 5A2BA 1BG9A 3BSGA 4E8DA 4CN6A 3W25A 2W92A 2E3ZA 2Q8XA 1P6WA 4MADA 4UNIA 2XWDA 1FP9A 3VMPA 1GUVA 2D23A 3GBDA 4PMXA 3D3AA 1OT1A 1MFUA 5HOSA 3HZ3A 3VSUA 1BG4A 3UCQA 2DEPA 1HTYA 1GOOA 4RL3A 5DT5A 1E9TA 1EGZA 5DT7A 4KRTA 4PCSA 1A47A 1X6LA 2JALA 2F2HA 2WWCA 3OB8A 1E4IA 3UG4A 2VX4A 3KZSA 2ZWYA 2ZXQA 2GK1B 3ARRA 4RE3A 4M1RA 1RD6A 3A4WA 4HPHA 1EOKA 1PPIA 1M04A 4MDPA 1GVYA 3DHUA 4KRUA 2PWGA 3VIGA 2HVMA 1FA2A 4TVUA 4B9ZA 4MNKA 5HNNA 5CXPA 4HOWA 1MW3A 4AW7A 1W1PA 2EO7A 1R7OA 1D3CA 2ZX6A 3UG3A 5JBFA 1F4AA 5LYRA 3DHPA 3FY1A 3U7VA 4HOXA 2D22A 2C8NA 4KMQA 3BXWA 2PI6A 3ZR6A 1W1YA 2X2HA 3BAJA 1SMAA 3EDFA 4H8UA 3WH6A 2F8QA 4W7WA 2YA1A 4D6JA 5LA1A 2VNCA 2WKGA 3BUIA 3L2MA 2VURA 5C8BB 2YA0A 2ZUUA 1HJSA 2YIHA 2ZUMA 2WHLA 1C7SA 2D1ZA 3SURA 3EDEA 2VT0A 3NYDA 3VDBA 1MQRA 2VC9A 4JKKA 3WD0A 1CGUA 3GH4A 1QNSA 3OLEA 3SUUA 1C7TA 5A6LA 1WPCA 3DDFA 3KLKA 2J74A 3GXTA 4JFWA 3N13A 3MANA 3VOCA 4AY1A 2G3NA 1MXDA 2AMGA 5HDRA 3AZRA 4C7FA 3HN3A 4ATWA 1J0ZA 1JD9A 4JHOA 1KB3A 2EPLX 3WL1A 2ZWZA 4B3KA 1W9PA 2WLZA 4DM2A 5BXTA 2VCAA 4OZOA 2DH3A 1TQSA 4LQ1A 4DWSB 4W89A 1E6QM 1LJYA 3BUDA 3PZGA 4JZ5A 2OLHA 5GNYA 2F7QA 2ZXAA 5A6KA 3AMCA 1WDRA 2WVUA 4NSBA 3WY2A 2PC8A 4CVUA 2WHKA 2XJ7A 1JGIA 5A6JA 3T2QA 3RMEA 3CTTA 1E1EA 1ISVA 5A6AA 1TQWA 3RJXA 3VD7A 3M7SA 4FMVA 4PEEA 4BA0A 3A4AA 4PMDA 2VOTA 2X2YA 3AHVA 3PN8A 4H2CA 1UWRA 3WUEA 4HU0A 3WY3A 3WMBA 4F9DA 2WKLA 1UG6A 4MAVA 1ISZA 2XM2A 4AD4A 2D2OA 3A3HA 1FFRA 2YKKA 1GQKA 1JD7A 3MUAA 1WZMA 4K68A 4UZUA 1GVIA 4PSPA 3HG3A 1NP2A 4AD1A 3EDKA 4NZJA 5JIWA 3SUWA 4PRWA 1ZJBA 4GIAA 5FOOA 2V3DA 3AICA 4W8LA 1VENA 1WDPA 1R33A 1JDAA 5A1AA 2OSYA 2ZUWA 1JZ5A 2YDQA 4S3JA 4P7OA 1QNPA 3POHA 4CCDA 4FNUA 3BAYA 2OW7A 1W9XA 1CENA 3MI6A 2EXOA 4AZ7A 3A6OA 1IT0A 3MUZ1 2YJQA 1XCWA 4MJ2A 1NH6A 1C8XA 5I6SA 4E4PA 3WDPP 4GZJA 1V6XA 3LPOA 1C8QA 2WLYA 3HG2A 1VBUA 4MNLA 2WVTA 1UD6A 2BXZA 4FLSA 3K4DA 5CG0A 1B9ZA 1DWAM 3HU7A 5GPRA 1U30A 1Y7VA 2GSJA 5I77A 2X05A 3WD2A 1VFMA 5D9PA 1UWUA 1J01A 1XC6A 4TVDA 1BVNP 1CNVA 2BY0A 1AQHA 4MJ4A 1WDSA 4GZIA 4FNTA 4UQAA 2EPKX 1E6RA 1OM0A 1DP0A 2W62A 4GI8A 1CIUA 1O6IA 3UETA 3VX0A 4P7QA 3MUIA 4M81A 2VQUA 2WMGA 4M80A 4W87A 4GINA 4W5UA 3MSDA 1QBAA 2QPSA 1H5VA 2VZOA 3GDBA 4OIFA 1E71M 3LRKA 3W6MA 3BMVA 2GUYA 2EPMX 1BTCA 1CLVA 4ACYA 4IISA 3QOMA 1VJZA 4XX6A 1WP6A 3NIYA 4M8UA 3EJTA 6TAAA 1TUXA 2BFGA 1XH0A 2VL4A 2A3BA 7CGTA 1VF8A 3WUGA 4UCFA 1DEDA 1UR1A 2DSZA 1BVZA 1VFUA 3AMLA 1QNOA 3BVXA 4P7RA 5JIPA 3ARPA 3VD4A 3ALFA 4EK7A 3VD3A 3WD4A 3GZAA 2X1IA 4X0VA 1XD1A 1HP4A 3DX3A 1E3ZA 3D51A 3BLKA 1EA9C 2F1AA 5DO8A 1J0YA 3EJRA 3VIKA 2J25A 5E6ZA 3ARTA 2CETA 1W3HA 2G41A 3MMDA 1MW2A 1OSEA 1BQCA 2XVLA 2ESCA 1HJUA 3WH8A 4CCCA 4MB4A 2J4GA 4GQRA 1K9DA 1PX3A 3AFBA 3HMCA 8A3HA 2WBKA 2G4FA 5IFPA 2F7RA 3N1AA 3CZNA 4ZE4A 4JKLA 4CD6A 2VVSA 4BQ3A 4Q7NA 3D4ZA 5TD4A 4UR9A 5I78A 1G0CA 3VIFA 2X8RA 4QLJA 3BUQA 3FXYA 2X2IA 4E2OA 1GCYA 3WQWA 3L4WA 4W7VA 2Z1SA 4PMRA 3LRMA 3L4UA 4FNQA 1NWSA 2G8ZA 1XH2A 4AZ5A 3KE0A 4JFTA 3WH7A 4UFMA 3CZKA 2ZX5A 3LMYA 5EFDA 1U2YA 1W9VA 2CKRA 4CN1A 3WDJA 4OBRA 2YDRA 1PX4A 5CSUA 3AQUA 1VBRA 1JAEA 2F1BA 2O9TA 2OYKA 4NRRA 4AISA 3PZIA 2O92A 5A8OA 1ZB5A 1E0XA 4HMEA 1CWYA 3A22A 3LXBA 5I5RA 2J7BA 4WKHA 1LWHA 4M24A 2C0HA 1PBGA 2PBGA 4GXPA 1O7DC 2WZHA 1H1NA 3AJ7A 2WAGA 2DIJA 1DWJM 3APGA 1J10A 4U31A 3RJYA 3WDQA 3SUVA 3VILA 3WY1A 4CD8A 1MQPA 1H2JA 5CGTA 4R27A 3ZJ7A 3SCRA 2PSPA 4CCEA 4BQ4A 3PZNA 4D6DA 1UH2A 3CZSA 3WQ5A 3AXIA 3W38A 3CZEA 1GOKA 4HA4A 3VO0A 1QVBA 3ZSTA 4Z2GA 1U33A 4P8UA 1PS2A 3QR3A 1UR4A 4HA3A 4P7NA 2O9PA 5E1QA 1HXKA 4BCEA 2A3HA 4PSRA 1W1VA 1Q6CA 4D6EA 3EMZA 3VIOA 3PBGA 3CUJA 3B9AA 1HWWA 1HKMA 1HJXA 4N42A 1C92A 5GNZA 1V3LA 3ZT6A 4FLRA 1GOIA 3VSVA 1OGGA 3GXNA 2W91A 3ALGA 2E40A 4JIEA 2EPNA 1XHGA 1ISXA 5ECUA 3SCQA 2WZEA 2ZUSA 3AXHA 2FGZA 3CGTA 3ZOAA 1CECA 4JHZA 1CXFA 1E70M 3CMJA 5CQ1A 5A6MA 1GZJA 3VIPA 4AYGA 2WC4A 4IM4A 1AMYA 3TTSA 3FHQA 1EDTA 3ZSSA 3DX4A 3WFZA 4TX8A 2ZXDA 2Y24A 1H11A 1J0HA 1UH4A 2J7FA 1JZ2A 4YN5A 1FHLA 4MNMA 3AMGA 1JYVA 4EANA 3G6LA 1KGXA 2YBUA 3BAXA 3VMNA 3PTQA 3WQ8A 3WQ4A 2F7OA 1YHTA 2CITA 3SCWA 3HG5A 3M46A 2OYLA 5GNXA 1Q4NX 3MMWA 1BAGA 1WZLA 1QNQA 3N9KA 3ARXA 2EPOA 4JCLA 2VCCA 4AZBA 2D3LA 2DIEA 1I1WA 1QHPA 1UR2A 4L4PA 1X1NA 2BY3A 2J79A 4AZCA 2WSKA 2BY1A 2QPUA 3WBEA 3BVWA 1XRVA 3A24A 2D0FA 2HISA 1UH3A 4PCTA 1QHZA 4MPKA 4DUWA 1MWOA 3A4XA 2XVGA 3UR7A 3CUFA 3VD9A 1UUQA 1V0KA 4ATDA 5D8WA 4FF5A 4PMOA 2OWWA 1W3JA 1JZ3A 1TE1A 1UR9A 1TFVA 5KZ6A 1JAKA 3VIIA 1W3KA 4URIA 4UFIA 2C7FA 2WMKA 3OGSA 3AIUA 4AEEA 2XPKA 2WC7A 3I3EA 1V03A 3WDRA 3BGAA 4AZIA 4ZENA 3TTYA 2XVKA 5DF0A 3U7BA 1VJSA 3N11A 2V38A 4MTVA 1UD8A 3MSGA 3I3BA 4AIUA 1CDGA 3RO8A 3WY4A 3GTNA 4AIOA 3UERA 3VIMA 1VEMA 3F4VA 3ARZA 1E40A 3AMKA 4J3SA 3BLBA 5A6BD 2E8ZA 3ZT7A 1TQUA 1LLOA 1KTCA 3NSXA 1QI3A 1B31A 1ISWA 3AZTA 4C7DA 2WB5A 4UFKA 5BXPA 4HMCA 1CGWA 4QLLA 4J3WA 4MAZA 1M01A 2WW5A 4W93A 1IZKA 2G3IA 2JF6A 3VDAA 3IAPA 3SUSA 2BV9A 2YL5A 2V5DA 2ZICA 2Z1KA 3AZSA 4TXEA 4OOUA 4F9JA 1UD3A 2CBJA 2VX6A 2VQTA 2GJPA 1VIWA 1UWQA 4WF7A 2V5CA 1WNOA 5CPSA 2NSXA 2YDSA 1D7FA 4J7RA 1LQ0A 4TX6A 3WD1A 2QV4A 1VFOA 3VU2A 8CGTA 4GZEA 3VSTA 1IV8A 3LXAA 4GO8A 3VMOA 3LXCA 4U5KA 2EEXA 3WL0A 4CN4A 1UA3A 3NSNA 2WCGA 4UQBA 3WMCA 3O6AA 3FAXA 2MANA 3OLGA 2WBGA 1HF6A 3PHAA 5AC5A 5M17A 3NDZA 2J78A 3RM8A 1QNRA 3L4ZA 1E5JA 3JUGA 1VEPA 2J47A 2VVNA 1PZ3A 4AMXA 2XUCA 2DQXA 3KL3A 1B3VA 1JXKA 3W53A 4HTYA 1QBBA 1XV8A 3SCSA 4XV0A 1DWGM 3BH4A 1GOWA 1E1FA 3F5JA 1PEZA 3LPGA 2VRQA 4A4AA 1PE31 1R7AA 2FE0A 1Z32X 4PUDA 3IGUA 1ZBVA 3SCOA 4DWSD 3U5UA 2GVYA 1B3XA 2A3AA 3LRLA 5ABFA 2V3FA 1C3FA 1ITCA 1PJ9A 4MB3A 3A21A 2ZOXA 3AROA 2WMIB 1V0LA 4OGZA 3CZLA 1GJWA 1M03A 4DO6A 4ZXOA 1KCKA 4GI6A 3BLPX 4QDMA 3ARWA 1PCPA 2E9BA 3WEOA 3WF4A 5A8PA 2CBIA 1B3WA 1D2KA 1JNDA 4PMQA 1DWHM 4D6GA 1H41A 3O9NA 2CKSA 3WQVA 3CUGA 1M53A 3SUTA 5ABHA 4PTWA 1GHRA 1W91A 2W61A 4QFUA 4LYPA 2WCAA 5AC4A 4PN2A 1KGUA 5CLWA 4ZE5A 4WJXA 1UZ1A 1EHAA 2ZX7A 3OLIA 1G94A 4JL2A 1JI1A 5BWFA 1QWUA 1WB0A 5E70A 3ARVA 1V6YA 3H55A 1VB9A 1UKOA 1ISYA 3BUBA 1MQQA 2GJXA 1JYXA 3A23A 4OKDA 5HXMA 1MFVA 1AQ0A 3BAWA 3QGVA 3KL5A 2J7HA 3WNLA 1HX0A 3MV01 3ZJKA 1DWIM 1UWTA 1FH8A 3L4YA 1XSJA 5M3WA 3ZR5A 1WZKA 1UWIA 1QX1A 1V3IA 1M7XA 1VAHA 1UKPA 3IJ7A 4AEFA 1RP9A 4M29A 4TVCA 1MW1A 3NSMA 1XSIA 4IPNB 2F18A 1ZBCA 1H0GA 1SZNA 2BNJA 3B9DA 1H3GA 3NCOA 4J28A 3WH9A 4U3CA 2XFFA 4TTUA 1KXHA 3WMSA 4F66A 1AVAA 3VGEA 4LPCA 3OA5A 3VINA 1E73M 1GOQA 1HVQA 1US2A 4CU6A 3SCUA 1TCMA 1LL6A 3W82A 4W84A 1OCQA 1E5NA 3WFLA 4TTGA 2ZX8A 4PMNA 3CLWA 2JEPA 4QAWA 2WANA 4UZSA 2WVSA 2FHCA 5C70A 1OD8A 4Z2IA 3TTQA
chains in the Genus database with same CATH superfamily
1WAWA 5A7EA 3RVUD 5KEZA 2ED7A 5JZ7D 5D2NC 3L5XL 1WAUA 4D6CA 4DJDA 3F2CA 4S3KA 1G7PA 7TAAA 3TT1H 5DT1H 5AAMC 5A8QA 2XIJA 1HNYA 1CD1B 4O4YL 1U8NA 4B0MB 3AW5A 3CB3A 4FQPA 5A2AA 2IDSA 5IM7B 1R24A 4NUQA 1S5IL 2W0FB 1KB5B 5L88L 1YNYA 3H3BC 4H88H 3TOYA 3QUXB 1N3NA 1UASA 5DCDA 1SZEA 3WF3A 3CFKB 1FDZA 3S9DB 3W0WA 3MCKA 2GOKA 3A6CH 4ZX4A 1SLWA 1DBMH 3OGCB 3V36A 4IMDA 3CUPA 4RGNC 3DGGB 1JN6B 2VXQA 1S78C 2NR6A 1HP5A 4N1EA 3UT0A 1JPTH 4PULA 1UZGA 3GMPA 4O50A 1OCBA 4PY8J 4PTUB 3SN4A 4D0CA 5E8DL 4WDXA 1YPXA 2VUYA 4FLOA 4F93B 4NUGL 1GGIH 4Y96A 3PZ9A 3CEUA 4BEQA 3QEHA 1PIGA 1R38A 2N1KA 2BVYA 4WWID 4JRFA 4YR6B 1K5WA 1BYDA 4NQVB 1GC1H 4B27A 1MCOH 1ORSB 5L0QC 1XICA 3DX2A 1SJAA 2Z24A 4YHZL 1A7QL 4NNPL 2QUTA 4HU8A 1XTLA 4TIMA 3U4KA 3X1FA 4WZ9A 2FWOB 4HPYH 4MYPA 3ILEA 4LF3A 2I17A 5IOPB 4PRNA 2BNRA 4ZW5A 1PKNA 2VWEC 3AI0A 3BOVA 1DN2A 4W9ZA 4AYID 2HVNA 5FO7B 3GBEA 5JHDB 4WDWA 3E3HA 5M03A 3FH7A 2JB5L 2W5FA 3S2CA 1NIUA 1HL5A 3CMOH 4PODA 1T7VA 1UD5A 1H7WA 3QUYB 4L6OA 3VQLA 4RMBA 1E3XA 1HL4A 8PAZA 3RNQA 4P2RE 4OI9A 3FFCD 2RCSL 5D71H 1KCXA 3QSKB 5FYJD 3QO0A 5J12B 1CQYA 2OX4A 1S2UA 3OGOE 1FVEB 5E9DE 4P5KB 1NGPH 2HVOA 1E7UA 4F80A 1I1AA 2G5UA 5D09A 3T6XA 1Z1WA 3ABKB 3WKNA 4PBXA 1GQLA 1EERB 1H50A 1XU6A 1NFIA 3MV7E 4P2RB 5F71A 1CT8A 4BXSV 2E4FA 5BOPA 1CCZA 2YB4A 1KV3A 4MAYB 4W9JC 3IANA 4AENA 2D9QB 4DKAA 3MYPA 2FKPA 4H8QA 5E9DB 2B0MA 3SIMA 4N1CA 4BKNA 1UIOA 3EO0A 2PO6C 4XVTL 5CJQH 4KVCL 1TPXB 1TEFA 1CLYH 1X4ZA 3MV7B 4RA0C 1BYAA 3NZHH 5JMRA 1LG1A 1U95B 4IG2A 5DHDA 1TU2B 1B0RA 2QMJA 4FXRA 1U8OB 2OU4A 1AH4A 2GUOA 2DVXA 1XIEA 2O9RA 1E15A 1U8CA 1XXXA 2PP3A 1HZKA 1B2YA 4PTTA 4GAGL 2GGGA 3SDXA 2OP4L 1I3UA 2J2ZA 4N6RA 4NAFA 4ERSH 4UQCA 1UACH 2B1HH 1U1UA 1HOCA 1E55A 3R12A 2O30A 3IDYB 1G7MB 4O28A 3H22A 4LSBA 1R5WA 3STPA 5CJ8A 4E0RB 3F85A 1OP5H 4LCIH 1OY0A 2CLFA 4DNMA 3SKNA 4DGIL 4TL5A 3QAQA 1GY2A 1AG0A 4FQJL 1OYBA 1RLCL 4XVDA 1V55B 3GBLA 3BWUC 3ML8A 4TSCH 2Y6TE 2P5WA 5F2GA 4YZFF 4D0DA 2UY5A 2AQ1A 3MLZL 4TNWK 5G4HC 3UXFA 3S36H 4XWOC 1AQDB 1NLBL 5G2IA 5A8GA 3TM6A 2WN2A 4MWAE 4W8AA 2AGKA 5CN2A 4OJFL 5C54A 2AXHA 1PWLA 1LL1A 3EA3A 2E9MA 3FTYA 3WEZA 4CVWA 4NAEA 2FLIA 3ROOB 3TNNA 4PJHA 1JVOA 3RUBL 4W9FC 3FIGA 1SVBA 3KXFE 3GUTB 5B1CA 4Y19E 3L68A 5I15L 5KYXB 5DD6A 2TSYA 4L8SB 3W22A 3SDCC 4MWAB 4LKCA 3GU2A 4OLWL 4JG1H 1W3NA 1PVHA 5EMYA 3P4OA 1ES0A 4XC3H 5FA3A 3F4DA 3AFLA 1M05B 5K9QI 2AK4A 2A85A 1QO3A 2YKLL 1XLHA 4LB4A 4LLVB 4P59H 2PLJA 4PFEA 1JPGB 2W4XA 4HA1A 4R90L 2V67A 3EYUL 4H6EA 1KIQB 5LGJA 4RETB 1V6VA 1EJOL 2HYMA 1GPFA 3B9EA 4P3DA 4XKYB 1IFHL 3EGXB 3KXFB 2Q6WB 1K4CA 4Y19B 4ZUTB 4AI7A 5D2LA 3LNHA 2Y5EA 4LAQL 4PRHE 1JQXA 2JNZA 1JFHA 4BR1A 1Y0EA 3PGFH 3TLQA 4DJFC 2E7CA 1P53A 1GCFA 1OAYL 2ZG3A 2RA1A 4PB9H 4DEFA 2WXIA 1WA3A 3R4IA 3TURA 4GKNA 3CD4A 5HVHC 4C55A 5E5MA 1MCDA 3C5SA 1KXVA 1JGDA 1QJWA 1ALDA 4FL4C 2B4CC 3S7GA 4GW1B 4DEPB 4ANVA 1KGWA 3GMNA 1WKYA 2FX8H 1XYBA 3BVUA 2KERA 1A4MA 3VABA 4PRHB 3FCTB 1G7QB 3VXTB 4X6CA 3URNA 3HHMA 3PTKA 4JG9A 3G1YA 3BAKA 2CD0A 3C4UA 5JOPE 1H6EA 3FSOA 2WCSA 1UZ6E 4DK6A 2CEQA 5H94B 3BWAA 3WJLA 2YXXA 4Z08A 4ZI8A 2ODOA 3BV7A 2X7VA 2H41A 2KMWA 2WNZA 2UV8G 1DZ0A 2J1YA 3BYTA 2JMRA 4PLJC 4GO6B 4L5FL 3MLPA 2VEKA 3MRQB 3AIVA 5CEZL 1LEKB 4O15A 3MA7B 2G2RB 4XCCL 2C9PA 1BFOA 3M0YA 3D0CA 3ULVH 2WXRA 1S5HB 3ZQ9A 3A6BH 2PP9A 3NGBB 1C91A 4ODSH 3LV3B 1E90A 1RUMH 1YN6B 4K37A 3EJQA 5EBWA 2RGLA 4NP4L 2I5QA 3L3OC 3F5LA 2GSGA 1SDDB 5I3JA 4JDYA 1UXSB 3SYOA 1U9KA 1E5AA 2WSQA 1S3RA 1VGEH 4PN6A 4K2SA 4G9FD 2CPCA 3NL5A 2JI2A 3LQAC 1I8IA 1DVXA 3AVEA 1T4KB 2EH8L 1PZ5B 2GI7A 4GA8A 2EYSB 1HWHB 1QLFB 1TJGL 1YUHA 2IG2H 2XV2A 1A6AA 2FPYA 3GNRA 3IK2A 4EI6A 1ZVNA 4UQIM 2J57A 1VFTA 4H8WH 4QOKE 2DLFL 2CESA 2F38A 3RPBA 4E4FA 4LSQL 2ZCHL 1CTNA 3RPIA 3V4VA 1F2XK 2CLKA 4HXBH 1EHNA 3GFUA 2HE5A 3NZ8A 1F45A 2VABB 4QG6A 4ZRGA 3H7LA 3OG2A 1FTXA 4JDVB 1DIEA 3A5VA 2HP4A 2WO3B 1WGOA 3GSNA 1MCRA 4IBZA 5BMWA 4QOKB 4YDLC 3E3QE 3DETD 4NO0D 1JF1A 4UDUA 5I74C 4E8DA 6ENLA 5FLUA 4Z7UE 3RUGB 3CLFH 1MJ8L 2Q8XA 4G80B 1WFMA 2BSBA 1OM3L 1FP9A 3VMPA 2DUZA 1MCLA 4HS8H 1KLFA 3B7SA 3ES8A 5ILTH 4EUPG 3LD8B 5DT7A 1X6LA 4RFNC 3VXSD 1CL7L 4XCEA 1T1XB 4RE3A 3U36A 2VE6B 3P93A 1I53A 3RQ3A 2R2HB 5FFOA 4Z7UB 4AW7A 2ZVRA 3TBVA 4HIIA 3EYSH 4OU3A 4ILDA 3TN0D 1A7RH 3KCPA 2KI6A 1VC4A 5I1HH 1JWSA 2ZYHA 2BG5A 3WH6A 2F8QA 4QSFA 4B5WA 2WKGA 2IPTH 1RURH 3UWQA 3ZK0A 3MOQA 5ALBL 3CBRA 3D39A 2OFQA 3U6WA 1A6TB 4U1GC 1NFDF 4ZFCA 1ZLSH 4GYKA 2VD9A 4MMWA 5C0JB 5HYEA 2GBTA 3UU0A 2R69A 4GX9A 1J0ZA 2NY2B 4GWEA 4CMMB 1VD6A 4Z0SA 1JHLL 1NQKA 3CSBA 2H32H 1A7OL 2WVUA 2PC8A 5DK2B 5HA7A 5A6JA 2YUVA 5IQLA 3DO4A 3T0EE 2P3ZA 3FO2B 3ITTA 5BW6A 4N90E 2AQRA 4JQAA 3WJMB 1HNFA 5GS0C 4H2CA 5HULA 5DEFB 2J55A 3S37H 1LWIA 1OX5A 1QYGH 3W1QA 1INDL 4JPQA 4CSSA 2H26A 2R0KH 4GIAA 4QS6A 5CU9A 2IPKB 2VDOH 4LRNL 1S6NA 3SDAB 1JCJA 4DN3L 1KPUB 2Q3OA 3T0EB 1W9XA 3GB7A 2FVKA 3TH6A 5JXAL 2IQAA 3HG2A 1UD6A 1CI3M 2Q10A 1HCYA 1KPRB 3P4LA 1T6VN 4D8PB 1TITA 3MREA 4AZUA 1Y7VA 4M1DL 3KPRE 4IUOA 1G67A 1E5ZA 2XWBB 2IDUA 1XC6A 3MKVA 5F0LB 4KJPD 4HC1L 5MEOB 3E9AA 3W7EA 4DIXA 5KYWA 1VPXA 1QTPA 4IIFA 1F8TL 3GDBA 4OIFA 2WINA 1QT1A 2F9RA 4A2DA 3OMNB 3MRGB 5GIRB 1WP6A 2R69H 4KJWC 2O26U 1XH0A 2A3BA 1I1RA 3N1MC 2OXGA 4Y5XA 2X3BA 3KPRB 1SYSA 4JEGB 2OMZA 5SX5H 3C2SA 5B39G 1F6AB 1F1AA 3CHVA 4P05A 4WW2B 3OU8A 5FDWA 3GVWA 4HHGA 3OTRA 2PTVA 1A1OA 2H3XC 1DV7A 4QRUA 2F1AA 5MP6L 1HKLH 4YHYB 4KCWA 2R1MA 1E9OA 2H1LM 5GGTL 1W3HA 4JTGA 2N0MA 3FYYA 5KZDA 2XVLA 1GGBH 4F0MA 3ARDD 4Y1AE 4KKAC 2G4FA 1RZGB 2F7RA 2UXGA 5I17A 4B95C 1A0EA 5AVRB 2KZWA 1BQSA 2EINB 3EKCA 4DYKA 4X8JA 1I8MA 2VH5L 4W7VA 3RYMA 3B2VH 4YHLH 3TJEL 1K8ZA 3LRMA 3UJJH 3FL7A 3VXSA 1NWSA 2VDPL 3TH3T 4OZ4B 3MT1A 2ATPB 2P8MB 3LKNA 3AG1B 4Y1AB 1DE4B 2F1BA 1DQQB 2HWGA 3PZIA 3W1NA 4H8NA 2F2KA 4AL8L 5IP4A 5F89A 4IIQB 1AHKA 2HUEA 4HGMA 4K0OA 1MWAA 3RVVD 1K3UA 3QS2A 4G6JH 4F8LA 1C5BH 1TZIA 1I7TA 3M45A 3SUVA 3WTSA 4HUXA 1H2JA 2XH4A 3OL2A 2DZUA 1T3FA 3AY4C 1TWWA 5JHLA 3SYQA 5F2IA 1GOFA 1A0QL 1DQLL 4KK9D 3CZEA 2FBJL 4X8CA 2C7UB 1XCTA 2KZ1B 3II2A 2BVWA 5AW7B 1O4UA 1SVCP 3LENA 2ICSA 4JFZH 1GZHC 1HWWA 3M1CA 4U10A 3QSTA 2Z31C 4PS8A 4FLRA 3N5AA 4G5ZL 2JJTA 4M5YH 1JFQL 3V0GA 3BZDA 5LAXB 2VSMB 5IF0A 4J5NA 2EPNA 1AXIB 2VDQL 1ITBB 2ZRVA 1EXUA 3D4CA 3T3PF 3FHQA 1ADOA 5C9JB 1LO5B 3NIDB 1P0BA 3DFPA 3MX0B 1F1GA 3K5RA 4BSVA 3R13A 4QRPD 1FHLA 4ZO9A 4B9JA 2OZ0A 4YBQC 2PCXA 4IOFC 1POKA 2FJGA 2LU3A 4MD0B 4IGBA 3VKBA 2PLCA 3B7TA 1MZRA 3LKSA 4OCRL 3TNOA 3SGEI 2VCCA 2J79A 5DJ0B 2QSCH 3OVQA 3CPGA 1FE8H 2JQAA 2CLMA 1MWOA 3QV7A 2R7EB 3LCYA 1J05A 3W9DB 5F4WA 4A2MA 4QTIH 1W3JA 1TFVA 2O61B 1GYAA 4UFIA 4BEUA 1MQ8A 3OGSA 4QT5A 1T7LA 4UOW0 1UENA 1MWAH 3IMWA 2V5KA 5EU3B 2FEDD 2CE6A 2RDTA 4M6ML 3SZ8A 4Z9KB 3MSGA 2A74C 1J96A 5FF2A 2Y0FA 1R9XA 3N40F 3ELAT 3AMKA 3QV6A 3OR7A 3SKJH 3FX4A 4CNTA 3DX7B 3R0KA 1IZKA 1K1DA 3ZX1A 2NWRA 4MFDA 5DD3H 4S3GA 5SV4A 1KELL 1ZENA 3CNKA 3SQOL 1F74A 2EDOA 1FORL 3VMOA 1YAZA 4PPTA 3QZWB 4X4XB 4ASTA 2WCGA 4L3FA 5F21B 4G8FA 4IRJD 3MGOB 1NPJA 5EO9A 1B9BA 4PJIE 5BNXD 4E41D 1HILA 3HZKA 3L4ZA 2J47A 1BAFL 5IB1B 3C0LA 1KLUA 4HTYA 3IVUA 1NGZA 3BPCA 5ADOL 5F9DC 2E1DA 3ATAA 3ARDA 2JF1A 1PY0A 3C2EA 4EIZC 4FFZL 4ONGH 3RX2A 5ABFA 2V3FA 3A21A 3QDGD 5DRZA 5J13C 2VGGA 5D7LA 2GW5A 2X42A 1U8LA 3DBPA 2FFCA 4PGDA 3IB4A 3QIBD 1UUSA 3CH1B 1YBQB 1TTRA 3UTSD 1DWHM 4EACA 1VADA 4M93B 3RU8X 4MA1B 1BVKB 3UXAA 5HI5D 4YXKL 3CUGA 4A3QA 1EBHA 1W91A 4NRZA 3GYEA 4HKXB 3WMLA 5K1JA 4TX9A 2NQDA 3B8TA 4TVPL 4LDLB 5H37H 4KY1L 2IAMD 5E70A 3W1XA 1M7DB 3ZKMC 3V4BA 2D69A 5JDJA 4BQBA 3HPXA 1A1MB 3V0UA 2PA6A 4ZTYA 1IGJB 5IMLA 5D72L 3MV01 5JQHC 3MRCB 2O6PA 4I3SH 1NBVH 4AJWA 4YOKA 3AWNA 1MRFH 2BWIA 1EMTL 1VSCA 3W7DA 1OTTC 2BVQB 1XCQA 4G7VH 1ZBCA 1P2CA 1KB5L 2O5YH 5F1IB 2DU2A 3B8IA 3D46A 3LCFA 4J28A 4XVUC 2ED8A 1FKXA 1VACB 3SPGA 1LL6A 1CK0H 5GJTH 5LQBH 1QBMH 2FX9L 4Z42C 4G7YL 1A4KB 2HLAB 3KDNA 4HK3N 3N41B 1X5HA 3N2MA 4JN8A 1ZJHA 3NJXA 5DFVD 3W2JA 3G0SA 4QRPA 2I07A 2Z7GA 3QZ6A 3GEWB 3U0PA 3UJIL 4IYKA 1PZSA 1NSNH 1AJZA 3V6OE 2NX9A 4AC2A 1DR9A 4MMXC 2WMPB 2HE8A 3S4SA 3E6FB 1YHPA 3DV4B 3WIIL 3CVHB 1PTGA 3SYCA 1KBGL 3FGCA 1XLBA 4R9XA 1KN2L 5CKAA 4AWTA 4N4QA 1BGAA 2J9ZA 1Q6FA 1F3WA 5C9XA 2F74B 2W60B 5ESVA 3LY0A 2P8PA 1WAPA 3L3IB 3NJ3A 4UTBL 2YCJA 3J27A 4FDWA 1TPB1 4EZLA 3G8EA 4FX8A 3TWCL 1XB3A 3AUWB 3M6DA 4LGPB 3QFDA 3TA9A 5BVJA 3C2AL 4YLQT 1Q65A 1A50A 3BVVA 1E9YB 2XN1A 3OKMB 3AT0A 4MZ8A 3KBJA 2YS4A 3QFJE 1WWWX 3PCYA 1ADQH 1D6VH 3UJRA 3WFCL 3BQUB 4KMTH 2R1XA 4Y9GA 2VIRA 4WEBL 2IQ0A 2NNCA 4Z7VF 1F11A 2OBGA 2IWEA 1K6AA 1UM6H 1BCIA 1VZIA 3U0TB 1MCWW 1KM2A 4X22A 3UZ5A 2ICES 1Q8MA 5FLVA 2E46A 3OXSA 2DBLH 4DGYL 4V2CB 1AJ2A 4OCWH 3ITVA 3MUUA 4HIJA 2H9AB 4MSSA 1E5CA 3HI1B 2Y1HA 3CIVA 3VAVA 4NM4L 2VKZG 3KPSE 1EGJA 5DJXB 2J6EL 3MUCA 1DVYA 5HDQL 4AHOA 3JR2A 4HK6A 4ZFZB 1DBBL 5T3XE 1OCWH 4F20A 1CB2A 2QQNL 3DECA 4JANA 3IM1A 3QDGA 2QVIA 3VOGA 3HGOA 4GXMA 5H2BA 1E4MM 2WHMA 1AGDA 3OF6A 2HUHA 4RV3A 1Q6DA 4WDTA 4KI1A 4JPWL 5DEZA 1WC7A 4DNHA 3S46A 1KRBC 4GMTL 3H7VA 3TR9A 1H15B 4AQEA 2IAMA 5CC6A 4W4OC 3HN8A 5D5ME 6REQA 4GG8A 4WU7B 1P0EA 2XV3A 5DK0B 4RSYA 4FYRA 4BFNA 4DKDC 4WHCA 4C59B 1HW6A 5CEYB 2KKQA 4XB8A 1LDPH 1IWAA 4M48H 4K55A 2DZSA 2CZNA 2CLRA 3UG5A 3CZFA 2ZOKB 4LWWA 2YAPA 4NI3A 1O6VA 5BOOA 5CZKA 1XLKA 3MZTA 1U6AL 2EQDA 5EMLA 4PJFA 4JHUA 3WELA 1FWTA 3RTLA 4MXQC 3EBHA 5K69A 2WSPA 1R0MA 1L0PA 4M61B 2IQ9L 1K9TA 1WOBA 2I32A 4DP5X 3RL2B 1M68A 3RGVD 4G7FA 1ODZA 1BEYL 3LOWA 4OZHE 1EP1A 4O1FA 4HISA 1IBGH 2NTSP 3FAWA 4U2ZA 4AGQA 4OJAA 3GTFA 2YFOA 1YMHA 1EGJH 3V0HA 4Q8UA 4RCXA 2V7HA 2HMCA 3BKCL 3NTCH 5IFAH 1T1ZA 3TVMD 4LEOA 2E6AA 1TG7A 4JNXA 4DJMA 4HDIB 4F33A 5DLML 3LN4A 3DFSA 5AHMA 1K02A 1GK8A 1G9NC 1MF2L 1QSED 3FJLA 3GVVA 4RISH 5DZLA 2IVFC 5I1LB 1F2QA 3FSZA 3GR7A 3TPUB 2LGNA 4N0YH 5IG7B 3S0PA 3FF8A 4GUJA 1XYZA 3H53A 1R46A 1GZGA 3HTLX 3OJGA 3B0UX 4GRWE 2DQCL 2QDVA 2QSTA 2QF7A 3IDGB 2X2UA 2ALDA 3T77B 2NY0D 5IR1B 3RPMA 5TDPB 3MGTB 3LSBA 5G1YA 1DCEA 3IXTB 2J27A 4ACZA 2YEZA 1EJVC 4HUKB 2X6AA 3EGDA 4AE0A 4IX2A 3TBCA 5IMKB 1B90A 3O8XC 2H3NB 5FB8B 1N6QH 5JPMA 4GRWB 3WXVH 4CC0A 3QXUA 3RP1A 4AC1X 3WNMA 1MCJA 2X6BA 1XPYA 3EEZA 3SN6N 3EJSA 4HKBA 1BJ1J 4MXWL 3ESPA 4YHEA 1INEL 4CC1A 3VUPA 2DT3A 3H2FA 5C6TL 2Z7KA 4IOSA 4CMHB 1OAZL 5FYKD 5LXVA 4H3DA 4CVZA 5FXCH 3MUJA 3OKOB 4C1NA 5FWQA 3KWWA 4LARL 8RUCA 1OAXH 4HNNA 5G4OA 1DBKL 3BW9A 3VFRB 2VXSH 4NZTH 1KFWA 2R4RH 1FFPB 5EWIH 2GZXA 2QEZA 4GBXC 5HPOA 4AIXA 3BH8A 4FI4A 3P5YA 5LWYH 3PHOA 1TR7A 1JGLH 3SRDA 3KPPA 2BWQA 2SEBB 3RY4A 4RLDA 2YX0A 3OLDA 2PU1A 4KI5C 3EYFB 3QQXA 1BAWA 3V0AC 2GGHA 3SE4C 4LOEA 3S5YA 1W2PA 3RDTA 1EJ8A 4J6RH 4KTYA 1LBMA 5A2FA 1EDGA 3JWNC 1NFKA 3APCA 3SIZA 5JOFB 4QCIA 2PPEA 2PTWA 2V2HA 5J06A 1HHIB 1PUDA 1P7TA 4OTKA 3T65A 5LO7A 1C5CL 4H1LB 1IGCL 1XW8A 2Y07L 1XIDA 1BIIA 4X4ME 5DJ2B 1T80A 3Q6GH 3D5HA 4LLWB 1L7IH 5AB3A 4HCRA 4Z1AA 1EDQA 3IDUA 4GXFA 3MB9A 2XXGA 2JE8A 4MZ3A 1GEQA 3JWDL 2XHYA 3EHBC 4G71B 4NIRA 4K3ZA 2Y89A 1BFSA 3IKKA 4J2XA 4JIHA 1JFXA 2DZAA 2GDUA 2OX5B 4M1BA 2XIBA 1UYQA 3TFBA 3LPFA 5HGAB 2P0IA 4YE0A 2DT1A 2HJFA 3UBXG 1I1FB 2DLHA 3DUGA 1DANT 4OZFG 1NFGA 3ZHFA 3NA9L 2YK1H 3TYEA 5DBTA 2DZXA 3FRUA 2R91A 2ZXEB 3IRDA 4OQTA 3VA6A 1FP8A 4FFYA 2R9HC 2CWRA 2X6MA 4L4LA 2DFAA 1G4TA 3N6JA 2NY1D 5JXED 5D4JA 1NICA 3L81A 4NQEB 4CADB 4YO0B 4IHOA 2PSNA 2ESVE 4F2EA 5CILL 3T3MF 1H60A 4Q9RH 5IJVB 4JYDA 4B3EA 4HSHA 3KUMA 4M5ZH 4A66A 1QSEA 3TU9A 1ZLWK 5CEWA 1IQ8A 3FB8B 4BZYA 3T9WA 3VIJA 2VL5B 1KXQE 3IS1X 4WCYL 1T1YB 2WNQA 4E4UA 4R4FL 3OZPA 5FKPA 2NXYD 1NGYB 1GVSA 3V0WL 4BUQA 4QRFA 2Y6SD 4F2BA 4BYHA 5CSYA 5T33L 4PTXA 4MVBD 5AAWC 2H8PA 1M65A 1SEBA 2VDPB 4B0MM 4ZD3H 3H70A 3MBEC 4XPAH 2Y7NA 4F7PA 1ZDQA 1UQYA 3M1BA 3FRPB 3UTOA 1AHWB 3Q2CA 3KYOA 2CHOA 4N9GA 4L5ZA 1NCCL 3CZGA 3AG4B 4JGNA 2ISVA 4IKJA 1QI5A 1CE1L 4A6YB 4PAZA 3CSTA 3IN0A 1MDAA 5CINH 4KXZH 5CKGA 3QJHB 3UMTA 4OCYH 4Z2KA 4MHHG 1UR0A 5LNDA 1S3TC 4J5VA 4DJDD 2A9NH 5T1JA 2B59B 1ZSHA 3FQ1A 1F8IA 5HANA 3PQYE 1M2VB 4LSVH 4YGVB 5J8OA 2AXJA 3VI3E 4XODA 1F4XH 3COOA 3RA7L 2NVDA 1WBYB 2OKMA 1VA9A 4RUBA 4F2ME 4JO1L 3WU1A 2EIZB 1XAUA 4P2OC 2E74C 2YD9A 2I9TA 5FL1A 1Q72H 2N01B 3QYCA 2R8SL 5EZPA 2PP0A 5HGHB 5JQ6L 1UT9A 1F58L 4Q89A 4MNHB 4QDGA 2BC4A 2VDQB 2AXFB 4DXXA 4FTVE 1J1XL 1OF6A 4JFOA 3ZS4A 5L8LB 2NW2B 3RL1B 3P9MA 1H3VA 1E4IA 2NR6D 4S23A 1LE5A 5CZ0A 4NN7B 3A4WA 5GGSB 1HQ4B 1EOKA 3ITLA 1BKHA 3DXAE 2QSQA 3N4EA 4PIBA 3GVQA 4E9VA 2F53A 3GW0A 2ZX6A 3ARFC 3QZEA 4REQA 4LEBA 4MJ5B 4RDZA 3KPOB 2X87A 5AD0B 3CDCA 3BXWA 4FTVB 4RDWA 5GJMA 2WGXA 2FZ9A 2R82A 1TTCA 3O3AB 4YMZA 1RXOB 4M8QA 2XH0A 5HMDA 1NMBH 4MPQA 1MUJA 1BQHA 2D1ZA 3EDEA 1EFQA 3DXAB 4MLSA 2LW3A 2G37A 3W01A 1AS6A 1CLOH 3MHGA 1E67A 3NRPA 2ATMA 3ILDA 3K6SB 3GXTA 4JFWA 4FHKA 4QRRA 3GUWA 4NCC1 2G3NA 1E30A 3GS0A 1ZCOA 1KB3A 4CQ8A 1TKKA 4DM2A 1CDIA 4QEGA 5D1ZB 5TE4L 4W89A 1GGUA 4MA8L 2B0SH 4JPVH 1DVFC 2KT6A 4CVUA 2QGDA 1IT8A 3S98A 3M7SA 2QVNA 2FB2A 1X5AA 3TT3H 1OD9A 2EVJA 4JFDE 1ED3A 1FZKA 4X7EC 1FCUA 1WA1X 4AD1A 4NZJA 1HSBA 5JXEA 1CFMA 1CWVA 5AOIA 1R33A 4NJ9L 2ENJA 3NQKA 3UTPD 1S1RA 4CL7A 3UWZA 2YPLA 2H9GB 2VFDA 2VDGA 2NUTB 4Z7WE 4O14A 4O00A 2IQTA 2FNWA 2DYPD 1AW2A 1I1AD 3G3LA 4R3SB 3BN3B 1F3JA 4TVPE 3KYMB 4JFDB 1NIFA 5IBXC 1XF3A 1N18A 2P46B 1DWAM 2Z2BA 4AEIL 2WOQA 3NSYA 2ZRYA 1G7HA 3NQDA 1D7BA 4Z7WB 3VZYA 1F4YH 1OFPA 3NN8A 3AAZA 2WPBA 4W5UA 5DO2C 3JYCA 3ZLFA 4UB0H 5CBEB 1EZWA 1VJZA 2WJ5A 4Q14A 2FIKA 1X97A 1N5YL 3WCYA 5EDSA 2DSZA 3O6LL 5EO0B 2ACUA 3GNMH 1C9WA 1OF2A 4G6MH 3BZ4A 1P4LB 4EK7A 5EU4B 1ACZA 1VFHA 3GAKA 2J72A 5DO8A 2BZNA 4FI8A 4MDJA 4EIGB 4RZCA 3JXAA 2G41A 2R9RA 2F6KA 3OMZA 1IKNA 2PDIA 3H7BA 3WUWG 4TLTA 4WO0A 1IM9A 3GBMH 2YWYA 3HBGA 1QOQA 4WWNA 5C09A 3KFTA 1X7IA 5B3JE 4QLJA 4DY1A 5IB2A 4JM2C 1PS9A 2KC0A 1SFDA 4FNQA 1T2QL 2P5WD 5EZLB 2QS8A 3DOHA 2HRLA 2VITA 2TYSA 1ZHLB 5CSUA 3ABOA 1R3QA 1BZQK 3OVPA 5CAKA 1ZB5A 3MYZA 4CILA 4H9YA 5EU5A 2V7NB 4HH9B 2AK1L 3HB3C 3B9KD 1DWJM 4X5WA 3GZKA 3IFLL 1MQPA 1PDYA 3OAYH 1ET5A 2PSPA 3TIDA 4BQ4A 4HIXH 2ZSWA 4JY6B 5DU7A 2Z1BA 3D85B 5DMIH 4LP8A 4AOFA 2INZA 3TQKA 1CB7B 1KT2B 1Z5YD 4OIIL 32C2A 2HPIA 3BISA 5IMMA 3IDXH 1HJXA 1PVNA 5I6LA 4TQHA 3VA2C 3DMMB 1BXXA 3ZT6A 4HT1L 3KDOA 2AK4D 1JPDX 3HPFA 3BLDA 3R0MA 2ZZUT 1W0VA 1XHGA 4LOUC 4X4KA 1Q1PA 3RZWA 4UBDC 4QHMA 1RUAH 3ULVD 2WUBH 3MXWL 2Z7YA 5EG6C 1NGQH 1L6XA 1GZJA 4NY2A 2KLRA 1XLIA 1TVDA 3QBUA 1UH4A 1ZSDB 3V79C 1Z9PA 3WQ4A 5EH1A 5DR5L 5KBLA 2YD7A 2A3LA 4JY5L 2V33A 3HI5H 1BAGA 5KTEH 2QCNA 3ZHLA 4NLHA 1KCWA 3VAEA 1KIRA 5J6GB 5EDXA 1YEEH 3A24A 4IGMA 4OUUB 4U1SA 4JS3A 4PCTA 3G1AA 4L48A 2DYPA 3AXMA 3A4XA 5BQ7A 3MUHL 2ADGA 4PMOA 2OWWA 1KENH 4WDIA 4R4BB 2MQ3A 4URIA 1ZIBA 2FB4H 1V03A 3O16A 2F5AL 1R6WA 4G8EB 3QIWB 1DQVA 2XZAL 3RO8A 2Y2YA 1URIA 2A0NA 3BQVA 3KLQA 1PL9A 5ECJE 4XK2A 2A6LA 5TQ0H 3JRKA 4KKLD 4WRLA 9XIAA 3MVSA 4MXVF 5D55A 5CCKH 4Y8DC 2WW5A 5LIKX 3M8OH 2JF6A 3M0HA 2FJHA 3L5JA 1S2TA 2VEIA 4XP4H 1EBGA 4XMKH 1XIIA 1LO2H 1YNTA 4DNLA 4L4TE 4BFEA 2Y25A 4HLZG 8CGTA 4EIBA 5GSRB 4FZ8H 4U5KA 3MXVL 5HI3D 2EEXA 2O5ZH 3NSNA 4M9PA 1NJJA 4DQOH 4IS6A 3C5JB 2WBGA 1HF6A 4PREB 3L5MA 3BVNA 3LNFA 4UV4H 2Q7AA 2A83A 4XV0A 3SGJA 2R0WL 1ZY9A 2ZG2A 5IWLC 4UOW1 1GOWA 4A4AA 1JNJA 4XAKD 3S9IA 3LLXA 4L4TB 1NAMB 3LRLA 2CO1A 4C91A 2HVKA 4C5YA 2QV5A 3EH2A 4X9FA 4OE7A 3CZLA 1NKGA 1UJ3B 4ZXOA 3E0GA 3KPNB 3WEOA 4LBEB 1O0VA 5EV7A 4MTMA 2DW6A 2VUNA 1KIUB 2V6HA 4LB3A 1A21A 2R1WA 3RWDB 4R85A 3UP1A 4XBGA 4ELDA 5CS7A 5HGDB 4JXCA 2WCPA 3FTSA 2XINA 3CHXA 4PTWA 3ULUE 1WA0X 4QFUA 1U5VA 3N34A 3V9EA 43C9B 1DEEB 4BZ1A 4L29A 1KGUA 5ENLA 1VHCA 2PLTA 1G94A 4FCAA 3RAOA 2H1PL 4LOCA 3MLTB 4PRAB 3B9KA 1FVCA 4OGXH 5CZXD 2C34A 2FMNA 4Q4PA 4RGMC 3BSMA 5KVDH 3CFQA 4OLZH 3UTZB 3W2MA 4Y16A 3TA3C 3PWJB 2NSOA 2OJEA 1UWAA 3I75B 2ROYA 4O5LL 2WKOF 3CVHL 4TVCA 1ZMYA 2QQKH 3DRQA 4Z7NF 5GJSH 3UC2A 1O6SB 3WJJC 1US2A 2XN9E 4NNBA 3LN9A 2X1UA 5EL1A 3O6KH 1GYWA 1JHTA 2JEPA 5D96C 2E7FA 2ZCKH 1THCA 2XFXB 2XQBL 4XP5L 4YZWA 5ACZB 1D5ZA 2C1PB 3QUKA 4GW4A 4FADA 5DRNB 1HO1A 3AHYA 4S1QH 4TRPL 4IMEA 4H7VA 3TFCA 3CK0L 4ZMZA 3N19B 1XZWA 4HSAC 4C6PA 2VDLH 3RRXA 1FGVH 3FUHA 2EDNA 3D39D 3AS1A 4OV6F 4ZSOE 4YHNB 5C71A 4M7ZC 1UC4A 1RZFL 3CE1A 1HJWA 3SE3C 4BZ1H 5I3DA 3FQTA 1WBJA 1RSFA 1PHQA 4D9QD 2ITCB 3V6FA 3V6ZB 1OC6A 1MPAL 3BANA 4W9CC 2A21A 3VDCA 4MZ2A 2ZRZA 2A3CA 1U8MA 3H42H 3AXXA 1HKFA 1IZCA 1FL6B 4XAYA 3MNDA 1G9EA 1XLEA 1YY9D 2FAUA 3WUFA 4RMSA 4ABQA 3WQGA 2PEVA 4B15A 3U1SH 3GDLA 1MCCA 2XN0A 4WO4C 3H3PH 3QXVA 3O0RL 1PKOA 3RIFK 1KBBA 4YFLI 3W7QA 5CCGE 2AQ2A 3OQEA 4Z0XA 1J5OH 5KW9L 3AU1B 1X9UA 1ERNA 1H6TA 5F3HA 3TO4A 2C19A 2ISDA 3QRGH 5DFWH 3UXLA 1C16A 3WZ0E 2L0DA 3GIQA 1W5QA 1T04B 4LSSH 2FTPA 5T3XL 4C6OA 2AF2A 4M6QA 3IJEA 2YAQA 2WK2A 3TW6A 4K7FB 3G9AB 2YXOA 2CR0A 3HC0B 2D03L 3M5VA 4D9LL 3MNMA 1KDIA 3CXDL 2WWDA 4DF9A 2ZRUA 3QUMB 3H9YA 3ITXA 2ZOUA 3U7AA 5J9PB 1IGYA 3B8YA 3IGAA 3LCLA 2XKNB 1OV8A 4FNRA 4CNPA 3P80A 1XC4A 4ZVJA 5KZCB 4TVSa 4AKOA 1TFPA 4HF5H 4H0HB 4ZQOA 3KJ6H 5KSVA 4HIBA 5FOJA 3HE7A 3WS6C 3DYOA 3OJ2C 3QCVL 4QNEA 4WKAA 4PR5B 1M7UA 2WSDA 3L3HA 5IFHL 3NPSB 4ZNEA 5C0DB 2JB6A 2WVVA 3QY7A 3WNPA 4GRLC 5E5RB 4BZ2A 3LZ3A 2RDUA 2D24A 1OEPA 4HIPA 4ZODA 1LQBC 1CX9A 1H7XA 2H32A 2WV8A 4JZNB 4PV1C 3E38A 1ONXA 1AZVA 1R3LA 2EPHA 4PRPE 4ZAKC 4X6DF 4DPRA 3G04A 4AD3A 2O56A 5AKQA 3QUZB 4XXCC 2BOLA 2XN2A 4BWWA 4U6XA 1JPIA 3IJLA 1KV7A 5GISL 4GI9A 3PY2A 3T1WA 1L9SA 2JJSA 1I85A 4XBPB 3VWJB 2CZ5A 3JWNH 1TVNA 1L6FA 4N8CH 1ENUA 4BF5A 1ONEA 5HI4D 3M17B 1EGVA 4PRPB 2BXYA 4ZS7H 2UUDK 1SLXA 1MVUB 5D7IF 3WIFB 2GGJA 4LLYA 1KQZA 3IJ9A 5J7CC 4UTJA 4XIMA 1K7XA 4JRXE 1NKOA 1I9IL 3Q1EA 2YR1A 3E2SA 4ACTA 3LBMA 4PJGA 1NMCB 4YIQA 2HZGA 1DSWA 4KWSA 4YHOH 1FFNB 3EW3B 5EO1B 3R8QA 1H51A 2BVPA 3Q05A 2X4QA 1F6PA 4HJFA 4GT7A 5A2IH 3WSUA 4JFXA 1E8WA 3LSOA 3VE9A 4JRXB 4PQXA 2HRWA 4BZ2H 1CXKA 4RJEA 4X0KB 2BLEA 3BEVA 1GOMA 1E27B 2HFEB 1NSJA 4I3RL 5L4JA 3PPHA 4NNYB 3B8SA 4QRSB 2B2XH 1GPOH 4WFHE 3DSFL 3ZYZA 2HFTA 3QDJE 4OLXL 4W5ZA 1I7RA 1HN1A 5L2KD 4NM8L 1W0YT 4HK3J 2FO1A 1BHGA 2YAEA 3H7UA 1JNEA 4AD0A 5HQMA 4YDZA 4I9AA 4CNIB 2I9LB 4QRAA 2Y62A 1O5KA 1ZHNA 3O3EB 4OTXH 4YHPA 3RZCC 4WKXA 3KVJA 5B1JA 1GJUA 4ZQPA 3VFGH 4IGBD 4XBSA 5GS1C 4NERA 3W24A 5DUBA 4GUHA 5AOKA 3RI5K 3L2NA 4F24A 2Y5SA 2FL5A 3V0SA 2TODA 4ENZA 1GG0A 1CFSA 1DJXA 1K5NA 3PDOB 4AZCB 1BQLL 3C6EA 3WE6B 4APQA 4M1CC 2OT1A 4FOKA 4WW1A 3FNDA 5I2UA 2R2EA 5BUAA 1M9SA 3MBXH 5IHHA 1A4BA 3C60A 2HT3C 1CYXA 1SO4A 1H3TA 1L9RA 2FDMA 4R8WL 2PW2A 3HCVB 2ZT9C 3TIEA 3S4TA 4YLBA 1PCXA 3BIAX 1XSOA 3ME3A 5L9DL 2G3ZA 4L7ZA 4AEOA 4TUUA 4DEUA 4TL4A 4AMWA 3EOTH 4OAWA 2XWEA 4DHGA 1VRDA 3CL7A 1RK0A 1W5MA 1U8JA 2V5LA 3VGHA 3UPRA 4DFIA 2L7EA 5FM5O 4UB9A 1E9PA 4B9IA 1T21A 1V8HA 1BP3B 2GPZA 4E5XG 4LP5A 3QXAA 1CFTB 1UWEH 4UM9B 2Q87A 3WX7A 4IDLA 3TZVB 4XH2A 3LKQB 3N1QC 4U1HA 5FI8A 3QEGL 3S35X 3MLRH 4N2AA 3G5VA 4DP2X 1TZHB 1T83C 1W9UA 3MDJA 4UF7C 4IPIA 1S46A 1VHPA 1WWBX 5JUVA 4PU2A 4LT7A 4WWPA 1SBSL 3U9UB 5EOQL 1G0YR 1PKMA 3SJ3A 5LBGA 4N28A 1CBVH 3DROB 2KPNA 3K8LA 1V8EA 5IROC 3TBYB 4UFLA 2PRHA 3GFYA 1XIWB 5D7LD 3QORA 1G87A 1HINL 3CV2A 5B8CA 5AYUL 1A4LA 4AXWA 4QCFA 3DUSA 3KL0A 4M7KL 1FIEA 2J8FA 2IPGA 3B3DA 1P4BL 4U1IB 1MIEH 1MLBA 2JKIS 3NZPA 1XL6A 3QQDB 1Q9WA 3FKKA 3EZJB 4HJTA 1FZMA 2PPFA 1YADA 5TH2B 4A6YL 4XMPL 3N2CA 1ZA3A 2CR3A 1VCFA 2NCEA 4NKQB 5JH2A 3KPTA 1CGYA 5MHBA 1LUCB 3KM2A 5I1JH 1AQ8A 1EJXC 1XGUA 2XFWA 4KROB 3SBQA 4RV8A 4MRBA 4RRPM 1R2SA 5DYOA 2BNUA 1OX4B 3Q5TA 4GKSB 4XVJH 3W1MA 4KERA 3PL6C 4JDZA 2NW0A 5KYUB 3THDA 5D2NA 2OEMA 2DQGL 1N59B 4OV9A 5C0EA 2PFHA 1I3RB 3W37A 2N59A 2BOFX 2YB1A 4Y4FC 3QG6A 2EG8A 4LVAA 1BEXA 3W7NA 2R1NA 1WVZA 3H2QA 3O6FC 4WK9A 5C5YA 5L2KA 2GFBA 4IGSA 4QNPE 3WLIA 3MRDA 4KCUA 3JWOC 3ZRSA 3FQXA 4PJBF 3M4HA 1KG0B 4P46C 4XP6L 4LAUA 5L6YH 4EI5B 1RIUH 1OINA 2IDQA 2Z93B 4AQ1C 2CU9A 4NSKA 1B4TA 3LHPL 3SBFA 2DWYA 2QGHA 4ZL1A 5E99L 1LP9E 4LHUB 5D8JH 4IXXA 3AIEA 1L9NA 4DWHA 4DP8X 2O4EA 4H2HA 4S3DA 4P3WA 5IIEB 2CNYA 4JVUA 5E56A 1RVGA 1S9XB 1P5UB 1V6TA 2BZDA 3WLBB 1PMYA 4CN6A 4IOIB 3V0JA 3KP0A 2E9GA 2K78A 2YSSB 2ARJB 3V5OA 1X5KA 2D23A 1HJCA 2DWDB 3WYRA 5FO8B 1LP9B 3GBNH 4M6NL 4XCYA 2DEPA 3QK0A 3GSXB 4WTWA 5H37A 1U3JA 5K59E 2GBVA 3ZTEA 4Y9FA 1I60A 4AQ8C 4EP8C 3VXNA 1N68A 2R23B 1MRDL 1LQ2A 3KZSA 3HG1E 2H6PA 3VG9B 1PPIA 2ZWLT 3IDMB 2PWGA 5GRUL 1IRAY 1UOZA 4WFFD 1FYTA 1JUBA 2BMKA 2J8UF 4XCFL 4LUSB 4PY7A 3VTAA 2R1YB 1SMAA 4EDWH 2OTWA 4ZBJA 5BMFL 3L2MA 2YA0A 3G1DA 4Q8WA 4PWEA 3HG1B 4FXJA 4DBUA 1IGMH 1IBDA 3IWUA 1XPGA 4XO8A 4CQBA 5MHSD 3NMEA 3VZXA 4M7LH 1AGBB 4YDKH 1WPCA 2Z1WA 1NAKL 3MANA 2FATL 5IB4B 1A8JH 4YHIA 3ZJAA 3C6LB 4C7FA 3PABB 3H2OA 3DPBA 1UB3A 2EPLX 5GZOC 1H0DA 3GIZL 4UT9H 4WV1B 4LQ1A 4DWSB 1KFBA 2DJLA 4W6WB 5T1LB 2C71A 1JGIA 5CG7A 1E4XL 3EB2A 3TN6A 3RMEA 3OF6D 3UVIA 1ISVA 3EO1B 3RJXA 4PJIB 1AJ0A 1VGKA 3VFOA 1AZZC 4YFDB 4CJ1A 4MAVA 3RX9A 1R9FA 3P0YL 1QPRA 4ALAC 2W8CA 3EF4A 3VWKB 2R0LH 1T0PB 1D5RA 2CDGA 1JDAA 4JPIA 2J56A 4A7SA 1YNKL 3MRRA 3IIXA 4RESB 2HH0L 2AEWA 4GJ1A 4WI4A 5JO5B 2XIDA 1R3VA 2PO6A 5GRVK 3NGJA 1E4HA 1WTLA 5AB1A 4ONVA 1EKOA 1XWYA 1GTHA 1C8QA 2WLYA 4HEPG 1LBFA 2OI9C 4Q8TA 1ADQA 1JTTA 2W59A 4APXB 1NFDE 3UL4A 3TYBA 2ICWA 2ZG1A 2QDEA 3SKUD 4N2MA 3HIJA 4DAGL 1BVNP 1CNVA 4LUTB 4YAQA 1JZGA 3SIKA 4WJ5A 2BSTA 4Y2OA 2FK9A 3PNRB 4IPPA 2UBPC 4GI8A 4HIHB 1YE4A 3DURB 4G72B 4I9WE 1CGSH 1GGCH 4O19A 1IEQA 2Y2TA 3HE6C 4R26L 4IKNA 4XZUB 4B5ZA 5H35A 3GIVA 3BMVA 3UWVA 4OFCA 4M8UA 3LU2A 1KA9F 3IFPB 4KKQA 4IQJA 3QKEA 1YEFL 3WO4C 1AQKL 4HUWB 5D05A 1U2CA 3CQHA 3S1XA 2VN6A 1U91A 4MQTB 3VD3A 4ZZKA 4OVVA 5REQA 1OEZW 4PJ9C 4PWIA 2WTPA 3KGUA 1E3ZA 1EA9C 2A1WH 1S2AA 3TN3A 1WAAA 1NGWA 2D7QA 2RFXB 2A0LD 4PYGA 4Y2DB 4ZPVA 3MMDA 2DMKA 2CNZA 1X6UA 2B7QA 3EWZA 3IDNA 1KLGB 5I5IA 4G43B 2HN7B 1EJFA 5LXGH 3G5YB 1KGCD 3G6JA 4NC1E 5EF0A 5F9WC 3QG7H 4FS0A 1EANA 1QPPA 2X8RA 5KG9A 3Q5YA 4RGOL 3WQWA 2PDYA 4Z8FH 1EEQA 5B3SB 1LEIA 2Y3AA 3RKPA 2MFNA 4FMKA 3F2DA 3BH9B 4B7IA 2C16A 4CN1A 1PX4A 2IF7A 2J73A 1M7JA 3KGTA 1ZNNA 3M7OA 2Q76A 2HXAA 4BJHA 4G42B 4WD0A 3ZTDC 3E0LA 1IO4C 3MZGB 3FSAA 4FA7B 4U31A 4JRLA 4IOSD 3GMOA 3ZKNC 4Y1SA 3JV6A 1NTHA 3LV6A 5E4EB 4HEMA 3PZNA 1FG2A 5EZOL 4D6DA 3CZSA 2E9JA 3QFJB 4ZB2A 4HA4A 2RACA 5DD1L 5JW3L 2J13A 4JOMA 4PSRA 1W1VA 4HOMA 1D5BA 4HUUB 3SY1A 3T40A 4B5NA 3ZLGA 3LHTA 4N42A 2N56A 5E5UB 3F12B 1T7YA 4YXHL 4DJFA 3IDJA 4JIEA 1I8JA 1J87A 1QEXA 3NDOA 3AXHA 3M5YA 3KYNA 2FWLB 3RPTA 3CGTA 3ZOAA 4ZW3A 3Q6FB 3RDTD 3FFDA 1GIGL 5L7XL 2WC4A 2PD5A 3ILPA 3TC6A 1IIKA 2P7TB 2CLVA 2QKFA 3AXKA 1A3LL 4PJDE 4Z3TA 3A3XA 1ICSA 3KPSB 5HHXH 1DVQA 4L8DB 3BKML 2NQ9A 3MTWA 1OCCB 4Y6GA 3WQ8A 1AZ1A 4LC6A 2ZJSL 3DTUB 1BYPA 4PVLA 2V9DA 4XPBL 4Q9QL 1A5BA 3MMWA 1SM3H 4AZBA 1TVHA 2BY3A 3EA1A 3MCLH 3O3BB 2HISA 2R2BA 1QRNA 3QP3A 5T3ZH 1R3HB 1Z2KA 4HXAH 1BM7A 5ESQA 1P5VA 4K7YA 1HAUA 4EXAA 3P62A 4HWEH 1QPQA 1RCYA 4AWSA 1KB9K 4PJDB 1QZ1A 5F7AA 2RJHA 3UJFA 1S1PA 3TEXA 3O6ML 3DN5A 1B4JH 3TTYA 3NWRA 4L9LC 1KJ3L 5D5MB 4ZYKA 3HNVH 3L66A 4LVGA 1MXSA 3NZRA 3HZYB 3NJKA 5C3IA 3F4VA 2WTRA 1FDLH 1NAML 2HB0A 3T42A 4KRLB 4B50A 4IMKC 3L8QA 2ZP8A 2VDNB 5AOJA 3SN0A 3IJSB 2WLLA 1XI3A 5DZOA 1RBLA 3L3OA 1DQJB 4OOUA 1UD3A 2HLFC 1MI3A 2F7IA 3QLDA 1USQA 1H3PH 5FHBL 5DMLA 2YZ1A 3H9SE 3LXAA 2A6DA 5E23A 4AC7C 4JG0L 2O6FA 1VZWA 3TNMB 1NCWH 4OZHB 3HR6A 5FAJA 4BUGA 1QNRA 1E5JA 1D9KC 2B4CH 3RVXD 4GP5B 5EOTB 3HI6L 3QRBA 1RD5A 3VZZA 3FULA 5EF3A 5HYSB 1U92B 4Z3EA 1P0DA 2Y69B 1L6SA 2OMNA 4C54A 1IR1A 4KRPB 3H9SB 3U5UA 1G1CA 2A3AA 3TK7A 5T1KD 1UGNA 3ZE0E 1S7SA 4K39A 1XWVA 1ELSA 2XPGB 1M03A 3ULUL 2V8LA 3BLPX 5AVWB 4N5EC 5HVFB 4XBEH 4JTUA 2Z65C 3MJMA 4ABWA 3VFSA 1DJSA 4RZ4A 1QMLA 2XU9A 5IVZA 3SD2A 2GITA 1H9DA 1X3DA 1N8WA 1WICA 3WQVA 3GSQB 2FMOA 1KCRH 4ADUA 2PD9A 2OFJA 3M43A 4BA8A 4M9OA 4ZUVB 4FULA 3ZE0B 1NDGA 2EAWA 3KTXA 4NO2B 3KAOA 1FYHB 4CGUB 3TF4A 1E9IA 3W7LA 5EUOA 2ZE3A 2PPDA 1QTWA 2PETA 3PWAA 5TNVA 1I7ZA 2YGYA 3HUJE 1B3IA 4NI6A 2J7HA 4IL2A 4PG9A 1VH7A 4IDJL 5C9KA 1WLHA 1NCOA 1RJLB 4RWYH 4TUKH 3N6YA 4AEFA 5B80A 3Q9PA 2FVLA 2WP3O 3ECUA 1OT4A 3FQ2A 4GABA 3NEOA 3F2BA 3LQAH 4U3CA 1IC4H 3MTRA 4C56E 4RVBA 1I9RH 4LPCA 5LNVA 3VRLF 2QKIB 1CW2A 3BGGA 2NQHA 3HUJB 1T03L 1Q9KB 4Q0XH 4XC1H 1J1PL 2VD8A 4WWKC 4ZQMA 5KBMA 3AOFA 2ENSA 1ONWA 4BHUI 4DN1A 1FKWA 4LLDA 4PGBA 4JM4H 3MC5A 2F53D 4PVNA 4EXPX 3HAEB 4KF1A 4P5TC 4YN3A 2W79A 3WTWA 2YN3A 4MD5A 2XZCH 4U6YA 2NY3B 4C56B 1N70A 2EF9A 5CGMA 2CGZA 4UNVA 1L7TH 2CGRH 3DV6B 1E1CB 4D8AA 1EZLA 3ZO9A 3MKCA 1A6WH 3DVGB 1NCUA 4X7SH 1ZA6B 5EIIB 4G1MA 3CVIH 4C6DA 5I28A 1CU4L 4FFWD 4FEMA 4MASA 2F61A 4NHCL 5DFTA 4LCCB 3W5MA 4QRRD 1JCNA 1TZAA 3L1OH 1MZZA 4LLQA 2VZSA 2YXFA 4ZUUB 3VNKA 4IEFA 1EEUA 2ENPA 3QPYA 4N9EA 1BOYA 4YL4A 1NBYB 2Q5BA 3EYOB 1KFEA 2W67A 4N4PA 2DQFB 5ITFB 2ZX9A 4LPUA 3QUML 1GORA 4ZK8A 2PODA 1W2KT 5IOKA 1MELA 3BFQG 3D0VB 2YC1A 3RF9A 4TU1A 1XEDA 4DP7X 1KM4A 1TR1A 4K1WA 1XFCA 4ZQTA 2CIKA 1ICPA 2FR4A 4ATLA 1A65A 1AA1B 1CDJA 2A9ML 4OD1L 1FLRL 4X0NA 1A3RH 3IJYA 3GGWB 4DZBA 2CHRA 5FHAH 3B8UA 4KUZH 9CGTA 2YPLD 1UCBL 4YC2B 4JFHE 2HBXA 1ORQB 4DPPA 7FABH 4KPLA 1LD9A 3F04A 5GGRB 1LILA 1Z9AA 1E8XA 4N2LA 5HMSA 2CO4A 1R47A 4YSEA 2WYSA 3SDYH 4F7EB 2CBUA 4G83A 1DLFL 2DKSA 3L9YA 4QTHB 5T1KA 4L4MA 2ESVB 3IEAA 1BVLB 5BXFB 1L0YA 5F7MC 4UTFA 3C5XA 4BELD 1CR9H 4OM1L 4BFOA 4TPRH 3IE9A 4NXKA 4OSUH 3SQBB 4NKDA 5GS0H 3V5CA 5EYWA 3P3UA 3AHTA 1T0NA 1IVTA 3GK8H 1TJ0A 2BSDA 3CASA 1Q9OB 5T8GA 1LL4A 3DVFA 2P44B 4M3JA 4B9PA 1T5XB 1T5WB 3UX9B 1AO7E 3HGRA 3NJFA 3VNZA 4FA8A 3U82B 1KCSH 4BH7A 4PLOB 3F65A 3CDGA 3LQZA 1TZGL 2VLKA 4NXSA 5IV2B 3CHFA 3OSKA 4MNGA 3XIMA 1MREL 3NBNA 2UWEF 1JZ6A 4RIRB 1IEAB 4AZ8A 3VTRA 1M7OA 1HIZA 5KJ4A 5F7EL 3CX2A 1LEGA 3KNBA 1IM9D 3W81A 4MKMA 5AW3B 4WRHA 1RUPL 4G8GA 5C09D 3PQYB 1AO7B 3ITGA 1FAIL 4LSPL 3VI3B 5I6XB 1YA5A 2Q86B 4OH2A 5GGQH 4P8VA 5E9AA 2E4TA 1E6JL 5C0GA 4Z2HA 3AY4A 2EKJA 3AITA 3IJIA 4F2MB 5D7JC 3HZVA 4MYWB 2E8YA 1OAKL 3LZFH 4E9YA 4F3FB 4LALA 4ODXA 3U4EA 1RHHA 1SNRA 1BA9A 4TS6A 5L4IA 1E4LA 4ADSA 3YPIA 1IAOA 1JUKA 1DDHB 1WCBA 5T1DL 1GZHA 1OFOA 5EA0L 4I13B 1U22A 2VMJA 4GIOA 5IHZB 2Z31A 2IWGA 2VTFA 1QABA 3CYVA 1MCEA 4XNQB 4UT7L 3AISA 3MV9D 4KRMB 4PYHA 4FPSA 5CAHA 3ROLB 1SEQH 2P5EA 3QIUC 3MRIA 4RNRB 4XCNA 5E51A 2XKUA 1KEML 1YO4A 3T1GA 1AH3A 2V0AA 1LWJA 1D6EA 3EF7A 3TJHC 5BV7L 4TOQA 3LNGA 3CFCL 2VI0A 3IRZA 2XDHA 3GZPA 1U8PA 2LQRA 2XYLA 4YSPA 4YHKH 4XX1G 3U5YA 5D70L 1C29A 2OMUA 1ACXA 3F58L 3VE0B 3FSTA 2JQZA 1E0WA 2GSHA 4NX0A 4M7TA 3AMDA 4JX0A 3WFHB 5ANMA 1MY5A 2F58L 1NTDA 3RVWD 1NANH 2WHVA 1W1TA 1C08B 5I76A 3Q37A 1JJUA 1YEJH 5HUPA 4KT2A 4F57L 2A74A 2VDIA 4GYBA 2EE6A 5B1BB 4PHXA 1FCQA 4GXVH 1G7VA 4YDNA 1O7DE 4K6AA 2DEYX 4XD4A 1KNWA 4L1SA 3NSJA 3SHSA 3K30A 3O41B 3VCRA 4IIEA 1M3IA 3RWJA 4D3CH 4K2UL 3VXGA 1O5PA 2OMYA 2ZXCA 4A3RA