3L4WA

Crystal complex of n-terminal human maltase-glucoamylase with miglitol
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 270
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4wA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4wA01
1R75A 1FHDA 3A21A 2VX5A 1X6NA 2XFYA 5I23A 1UR9A 1GVYA 3RM4A 2DIJA 1JD7A 5HDRA 2FGLA 1EO7A 5A6BD 3VIKA 4PMOA 1ZJBA 2ZE0A 2CESA 4AIOA 1E9LA 1B31A 3LRMA 4W7VA 3S2CA 3B9DA 3PBGA 2WVTA 5A6LA 4QLLA 1FFRA 1DWGM 1MFVA 5EMYA 3WH9A 2GDVA 5A8PA 1V02A 1ZJAA 2YIHA 3T0BA 1QI4A 2O92A 1PX8A 3CV5A 4KGJA 2FE0A 1QI0A 3NSMA 2NW0A 3WD1A 4TTUA 3AS3A 3CLWA 2WVUA 4ACYA 1T0OA 7CGTA 4MJ4A 3VD3A 4OBSA 2WHJA 1V0MA 2WCSA 2VRJA 3THCA 1HTYA 3GBEA 2RGLA 2VZSA 1E72M 1JZ3A 3BAJA 2W66A 1G01A 1UWIA 1JDCA 1G5AA 3H54A 1HL9A 2OSXA 5I24A 1EOKA 5FL1A 1RP9A 2XHYA 1ODUA 4U2YA 1OIMA 4MTVA 2A3HA 4C7DA 1ESWA 3BCFA 2AAAA 3IGUA 4HMEA 5CLWA 5LA0A 1BSIA 1M53A 1E5NA 3LXAA 1TG7A 3VM5A 4D6HA 1R33A 3I3DA 4D6IA 3QGVA 1O7AA 4P7RA 1EHNA 1NWUA 2PWEA 2CERA 2CYGA 2XM2A 4AEFA 2VO5A 3W27A 1PX4A 2PBOA 1QI2A 5HBFA 4J3WA 5IHRA 1ITCA 2D3LA 4EK7A 4HA3A 4C7GA 5F7UA 1BYCA 1QWUA 2OW7A 3KE0A 5M5DA 4DUXA 4AYSA 2XUCA 2YL5A 1JXJA 3W37A 4PSPA 1R8LA 3AHTA 4HMDA 4FLOA 1OSEA 6TAAA 1V3LA 4PYSA 2DGAA 1VFFA 3K46A 3MUZ1 3W4RA 4UQEA 5BXPA 2BV9A 1GVIA 1GJUA 1MVYA 4V28A 4E8DA 1JZ6A 3VGFA 1U33A 1DWHM 1H49A 1ZBVA 1WE5A 4HU0A 3AIBA 4QCEA 2VQUA 1H41A 3AYRA 2WMJA 2JF6A 3ZR6A 3ARRA 1HX0A 1IV8A 1W91A 1JYWA 4J3TA 3OLIA 3BAIA 4W87A 2DH2A 1WZAA 4QCFA 1PJ9A 3W25A 1CWYA 4GIAA 3BVTA 3VIFA 1J0YA 1L8NA 3GM8A 4FNQA 3FAXA 4P7OA 3WY1A 1W9XA 1PS3A 4DM1A 4PEEA 1UR4A 3EJPA 3AOFA 4TTGA 3VD9A 3L4VA 3FHQA 2O9OA 4Q7NA 5A3HA 3KL0A 3EMZA 1W1VA 5CZKA 1BG9A 3OLDA 3CGTA 2XFFA 1W1YA 2XVKA 2D73A 1Q6GA 4PTMA 2UY2A 1UR2A 2OWCA 3WIJA 1OINA 4ACZA 4D6EA 2DT3A 3THDA 4DM2A 1NP0A 1E71M 1J0IA 3VNZA 4H2CA 4EANA 3W28A 2D2OA 1QHZA 1TVPA 3WL1A 7A3HA 1JF6A 5LYRA 3FAWA 3KZSA 4RL3A 4W8LA 2E8ZA 1H1NA 5A6JA 1E1EA 4P8UA 4UFHA 3TONA 4D1IA 1FHLA 2XPKA 4MNLA 2W63A 1OBAA 1J9YA 2A3AA 3W6MA 4ZXOA 3AS2A 4J3XA 2CHNA 1WKYA 4B15A 2VI0A 1V6XA 2D24A 1KTCA 1UD4A 3U57A 3VMOA 1XSJA 3RPMA 4PSRA 1TUXA 4AD0A 3N1AA 3MS8A 4D72A 1E55A 3W81A 1M03A 1HJUA 2DT2A 3BVWA 3W6LA 4EKJA 1UKTA 1UWRA 5I2UA 1D3CA 3EYPA 1HP5A 1VEOA 4Z2HA 3L4ZA 4AISA 3EJRA 1S46A 4AYGA 3GNRA 1Y7VA 3TTOA 2E9LA 4M1RA 3UR7A 4IPNB 1U30A 2TAAA 1UOKA 3FXYA 1GOOA 3KL3A 3LPGA 4V27A 4BS0A 3ZT5A 2DT0A 3OGRA 3ZJ6A 3GDBA 1SYTA 2BS9A 1JD9A 1C7SA 1E6PA 1UR1A 2V3GA 3VSUA 2QV4A 1QHPA 3OZPA 1M7XA 3GXIA 1NM9A 3CZLA 3SCOA 5A8MA 3UESA 3BCDA 3WNPA 2X2JA 1KGWA 2PB1A 3PZNA 1VFMA 2WB5A 5I77A 2YDSA 2OWWA 1GORA 4DWSC 2WAGA 3W26A 3N12A 2F7OA 1EHAA 3CMGA 3LMYA 1PAMA 5D9PA 5FOOA 2YFNA 1MXGA 2J7FA 3OGVA 3BVXA 3RM9A 3RO8A 1E15A 4AWEA 1W9UA 2ZWYA 3W53A 1G9HA 2D20A 2YA1A 3VGGA 3JUGA 1BYBA 1GQLA 3IJ8A 3AIVA 1IT0A 1E0WA 4OKDA 3BUQA 1QBAA 1EIBA 3DC0A 1KTBA 3EDJA 3QOKA 3DHUA 5D8WA 3UG5A 2ZWZA 3ALFA 1V0LA 2EPLX 1QNSA 2NT0A 2VNCA 1DWIM 3U7BA 5CXPA 3ARZA 2WW5A 1E4MM 1WZKA 3F4VA 4CCCA 3VO0A 4GI8A 2VC9A 4JFUA 1B3XA 1UA3A 3WDRA 3QOMA 3WSUA 1WDRA 3LXCA 2OYLA 1G1YA 4QLJA 3D51A 2XGIA 2EJ1A 2YDRA 4PMRA 1LWHA 2W67A 3WUFA 1ISZA 5A8QA 3APGA 3K8MA 1K9EA 3N9KA 1E4IA 2WMIB 3M46A 4ML4A 4CU7A 1CDGA 1TA3B 2CKSA 4HP5A 1FH9A 5DF0A 4F9JA 3EDEA 4UCFA 2AMGA 5I3DA 3OIHA 4CVWA 3T08A 2EPKX 1TQUA 1GOKA 3SUTA 3ZJKA 2ZX7A 3L2MA 4TVUA 1JNDA 4BZYA 4PMDA 3K4AA 3M7SA 1HN1A 3LPFA 1UKOA 2ESCA 1UASA 2V3EA 3LXBA 3WY4A 1K9DA 3WEZA 1K9TA 2YDQA 1M01A 2WCGA 2ZUNA 3KLLA 2JIWA 1UA7A 1GHRA 4PMYA 3A24A 4W7WA 3AISA 1QWNA 1WZLA 1GOQA 4BA0A 5FD0A 1VF8A 2IGTA 2W61A 5CGTA 2FHBA 1E56A 5DT5A 4E4PA 1J18A 3MUAA 3VVGA 3ZOAA 4OOZA 4KRUA 4IISA 3HU7A 1BG4A 1LJYA 4AZ5A 4W86A 2EABA 1V02E 2OWXA 1OGGA 3L4WA 4S3KA 2C8NA 3LPOA 3BMWA 3ZSTA 5AC5A 4E2OA 3NSNA 1QW9A 2NSXA 3OB8A 1OCQA 3MUY1 3CZNA 2J62A 2WBGA 2JALA 3ZT6A 3BUPA 1CXFA 3AXIA 3A22A 1MFUA 3WENA 4HOXA 2XVGA 3LRLA 2JEQA 4AC1X 2BHZA 1JFXA 1CXIA 2CHOA 4BQ4A 1XHGA 1JG9A 4LXFA 1TQSA 4JFWA 2QMKA 3DX3A 4H8VA 1GJWA 4U5IA 4NF7A 5D4YA 3BSHA 1JI2A 1JYVA 1E9TA 3AIRA 4KH2A 3VDCA 3WH5A 3MU7A 6CGTA 1LWJA 4TX6A 5A95A 1KB3A 3GXDA 2J25A 1UH4A 1PEZA 5CGMA 5BCAA 1XH0A 2OLHA 3WD0A 1CENA 2J7GA 4E8CA 3CUJA 3HG2A 1LL7A 3WEMA 2WKGA 2VOTA 1E0XA 4A4AA 1V3MA 1C93A 4H8UA 2BVYA 3UR8A 1KGUA 1CGYA 3AS1A 2IUZA 3TV8A 2FH6A 4OIFA 3WMCA 3GXPA 2PI6A 3HG4A 1GNXA 3OBAA 3VGHA 1HXJA 4ZFMA 1HJSA 4CD8A 4WK9A 3UCQA 1YQ2A 4X0VA 1NWTA 1MW3A 1HVXA 2BVDA 2VCAA 2GUYA 3PZIA 1UZ1A 4CD6A 4DO4A 2GJXB 2J79A 3ZM8A 2VZOA 3VD4A 2VMFA 3TA9A 2ZXQA 2WMGA 2G41A 3A4XA 1UD5A 3VDBA 4W8AA 4D1JA 2D0FA 1G94A 1W1PA 3VGBA 4JKMA 1A47A 1J0HA 4WSJA 3UEQA 4GZJA 2E4TA 1ZBCA 3CZKA 1JYXA 4MAZA 1E1FA 4CN6A 1EDGA 4Z2GA 3D50A 3K8KA 1C7TA 1XRVA 3WNLA 2VZVA 4P8WA 2DT1A 5IFPA 1HXKA 4FMVA 4M81A 4ZENA 2QMJA 3L4YA 4AW7A 4URIA 3SEPA 3NDYA 3UERA 3D4ZA 3WELA 4FK9A 3CUHA 4H04A 3RDKA 4NXSA 5I79A 1W3HA 3RJXA 4AXNA 4CN4A 1Z32X 3AIUA 2V3FA 3VD7A 4AZ7A 4UTFA 3DYOA 2CKRA 5A6SA 3WF3A 1JYNA 2WYSA 4TX8A 4MB4A 4QDMA 2OYKA 4PRWA 2VQTA 2J4GA 6A3HA 4LQ1A 1XH2A 2D0GA 3AIQA 3K8LA 1EQCA 1JDDA 1G0CA 4F66A 1OGBA 2GJXA 3U7VA 4AY1A 2BXZA 1QNOA 4AEEA 1H4PA 2ZICA 1VBRA 1Q6EA 1OB0A 2BFGA 1E6XM 4WF7A 3NSXA 3DX0A 3RM8A 5CJ5A 3N17A 3BLPX 4MAVA 3O6AA 2GJPA 3DECA 1QNPA 1V3KA 1MQPA 3SUWA 4MB5A 5C70A 3CHEA 1R85A 1JI1A 4P7QA 3F5JA 2FH8A 5GPRA 2W5FA 3IAQA 1KXHA 2GJRA 1H09A 2WWCA 1OT2A 2C0HA 4ACZB 2EADA 3DDFA 1EGZA 3F5LA 4GZEA 2VURA 1LL4A 3NDZA 4JFSA 4HU8A 2EAEA 3AS0A 1OD8A 3QHOA 4JCLA 3ZIZA 1HVQA 2QPSA 1HKJA 4P7LA 4X0NA 3CBWA 3KL5A 3S5ZA 4UOJA 3PZGA 1Q4NX 3WN6A 2J7HA 4UQBA 3QHMA 2D3NA 2PBGA 2G3JA 2XVPA 3BLKA 5E09A 1NOUA 1V0NA 2XIBA 3H53A 4QLKA 4ATWA 5E1QA 1UKSA 1NQ6A 4X9YA 3ARQA 4TXEA 3TTSA 2XWEA 1KQYA 3K4DA 2CPUA 2F7PA 3MO4A 1ECEA 4OUEA 2VCCA 1HKKA 4AMXA 2WVSA 5E6YA 3IAPA 3RJYA 2BNJA 3IANA 1V6UA 4J3VA 4NI3A 2WMKA 4UR9A 1BYDA 1ZL1A 1CGUA 5CSUA 1BTCA 4GQRA 2GK1A 3VD5A 3BAKA 4M29A 4AZHA 2DPEA 4OBRA 3WMBA 4A3HA 3D52A 2E9MA 2DSWA 1AVAA 1LF1A 4FF5A 1R46A 5AYBA 1DP0A 2VZUA 4D6JA 2CIPA 4IUGA 4PMZA 3VM7A 3GXTA 3WQ8A 1EXPA 3VOCA 4ZE5A 1QI5A 4UZSA 1W3JA 1KCLA 1MW1A 5A2BA 2HVMA 3WL0A 1CBGA 4AD3A 3VX0A 1V6VA 5HPOA 1JGIA 3WQ5A 3LRKA 4GXPA 2DSKA 2DSUA 2WXDM 1X1NA 5TD4A 4LPCA 1B9ZA 4AD5A 2VJXA 2EACA 3WD4A 3UETA 3CHDA 2YBTA 2WSKA 7TAAA 3RIKA 2XFRA 1KR1A 4NRSA 1BF2A 1KXQA 2EBNA 2BY3A 3WH8A 4J28A 4OJYA 2F61A 3MSDA 4RE3A 4JCMA 5BWFA 1KFWA 2WBKA 2YOCA 1HP4A 5M3WA 1GUVA 2ZX8A 4ATDA 3DX1A 1E3XA 1R34A 2EPNA 3HJEA 1HL8A 4U5KA 1B1YA 2WWDA 1W3LA 1L0PA 5E70A 2J75A 1R7OA 2PSPA 3CH9A 1HJVA 4FNUA 4YHEA 2YLLA 2WPGA 1SZNA 4AZCB 3B9AA 3PZUA 3DDGA 3GXNA 1J0JA 3HG3A 1GZJA 2J74A 3WDHA 3GXFA 2WLZA 2VVSA 3AXHA 3MMUA 4KWUA 3SURA 1PZ2A 3EDKA 3SCSA 3AZTA 5BXRA 1CEOA 1OM0A 4LX4A 5DEZA 5AY7A 4AZIA 5CLTA 1US3A 2GFTA 4QP0A 2D23A 2EO7A 2HISA 3FN9A 2X05A 2VTFA 2ZUWA 2VVNA 4RE4A 3WD2A 1JZ5A 3MANA 1JNEA 3BGAA 4B16A 5GNZA 2XN1A 5D9OA 3D3AA 1H3GA 1VENA 3RCNA 1PS2A 3CUGA 4B3KA 3CC1A 3GXMA 1KGXA 5A8OA 5IHSA 2J7CA 4OOUA 3BAYA 1OGSA 2WKLA 2YL6A 1NWRA 5A94A 1UD6A 2F18A 4V2XA 1VAHA 3II1A 2Y5EA 3N18A 5KZ6A 4B9ZA 1BVZA 3W29A 1PZ3A 1E43A 2JIEA 2VZTA 2WZHA 3ARTA 1OIFA 3T2OA 1B30A 4XB3A 5A6AA 2GDUA 1XD0A 4W84A 1GCYA 3POCA 4P8VA 5HNNA 2DSVA 1WDSA 1UQZA 3AHYA 4PMVA 1ITXA 4PUDA 1DHKA 3AIEA 3OLEA 4AZCA 1XCWA 3OG2A 5CPSA 5JIWA 3EDDA 1GOMA 3A23A 1JZ8A 3ZSSA 2D1ZA 3FNDA 1XV8A 3AMLA 3CZJA 1P6WA 3WNKA 5M03A 3HMCA 1K6AA 3IK2A 1E73M 3BAWA 5GNXA 3MI6A 3PZTA 3AHVA 4W5ZA 1UR8A 2G4FA 4AD1A 2UY3A 2WSPA 1WB0A 1FFQA 3L2LA 3CHFA 3DYMA 4W7UA 1WPCA 3AQUA 4KMQA 1I75A 4LYQA 1W2VA 2PWGA 3SCWA 4W89A 1ISVA 1M04A 3VIOA 3J7HA 2Y24A 1LQ0A 1ZBKA 2WC3A 3BUIA 1B0IA 3MKKA 1AQMA 5CQ1A 5LA1A 2WZIA 1ZB5A 4CU6A 3WY2A 3ARUA 3S5YA 2J77A 1KBBA 4GZIA 3AI0A 4UQDA 8A3HA 2W62A 4R5EA 3IJ9A 4B3LA 1W9BM 4OZOA 5JBDA 5C8BB 2WHMA 1PIFA 1TVNA 4NZJA 3A4WA 5JIPA 1JFHA 2Y8KA 4YHGA 2F1AA 4N42A 4JL2A 5IDIA 5E9AA 3WH7A 3E1F1 3PZVA 2E0PA 1I1WA 4TUFA 3SCNA 4HMCA 2CNCA 3WKZA 1W9PA 2F8QA 3WF1A 2VCBA 3WUGA 1NH6A 2XWDA 3ZO9A 3WQ6A 2XGBA 2Y8VA 3N15A 3VX1A 3WEOA 4WKAA 1FP8A 1R7AA 1V3IA 3GYCA 1I1XA 3ZT7A 1LL6A 4CKQA 3SCQA 2CBUA 1H11A 1B3WA 1EQPA 3DX2A 1CXLA 5D8ZA 3ARWA 3DHPA 4IM4A 1PBGA 2BY1A 1JXKA 1NARA 4IPLA 4JZ5A 1LG2A 2PWDA 1E6RA 2J7EA 2ZUTA 5A6KA 4F8XA 2WVVA 4CU8A 3CHCA 1F4AA 2DDXA 3ZJ8A 2CBJA 1CZ1A 2ZXDA 4D71A 5HXMA 4PTWA 3VUPA 1GQIA 1BYAA 3NYDA 1V6YA 3VPLA 3SCVA 1C91A 4S3JA 2XVNA 1UQYA 4BQ2A 2WM0A 2WCAA 4TVDA 2DIEA 1H2JA 2QF8A 5A8NA 1EOMA 4R27A 1V6WA 3TTYA 2DH3A 3AMDA 3KLKA 2YJQA 5LA2A 3CUFA 4D6FA 4MNMA 1RP8A 1HJWA 4TOQA 5DT7A 3D4YA 4HZ6A 1GHSA 5DO8A 3T2QA 3W0KA 3EDFA 3T2PA 3GH5A 3ALGA 4W8BA 3EBVA 2JE8A 2AOSA 4AD2A 1AQHA 5BRQA 4PBGA 1R86A 3UG4A 1NOWA 4CD4A 4DWSD 3CZGA 1J0KA 5ABGA 4PMXA 1HWWA 3NJ3A 5I6SA 1GOWA 4Z2KA 4EE9A 4U33A 4UFIA 3OA5A 4QFUA 3CMJA 3G6MA 4M82A 1VJSA 2JEPA 1OWQA 4UFKA 1FH8A 3HG5A 1EA9C 1UH2A 3BLBA 2XIIA 3CTTA 2W91A 3N13A 3VMNA 1TFVA 2PC8A 1OD0A 2EXOA 1J11A 1GW1A 3QR3A 2ALWA 5M17A 2VUYA 4HOWA 1HIZA 1GQJA 1XGZA 2E40A 1MYRA 1HNYA 2XN2A 4MDPA 5ABFB 1UYQA 5A2AA 1JAKA 4JL1A 1UKPA 1O7DC 1SR0A 1ZU8A 5BXSA 4XUYA 4AIEA 4UZUA 4B9YA 3OZOA 4CD5A 1CIUA 1MW2A 2EQDA 2ZXAA 1BQCA 3ARYA 4UFMA 3EJTA 1NWSA 1VBUA 5BYWA 3WNMA 1QPKA 3VIHA 1PIGA 3GNOA 2Y4SA 5A1AA 3WMSA 3BC9A 4HPHA 3BUBA 3T09A 1JZ7A 3WDQA 1V3JA 4MPKA 2F1BA 1VFUA 2E3ZA 4Z2IA 1EDQA 5E0CA 4JFVA 1UZ4A 4PUEA 4F9DA 4Z2JA 3TTQA 3EJUA 1CXHA 4YPJA 1BAGA 3O9NA 3ARPA 3AHZA 1C92A 3W38A 2W92A 4U3CA 3AMGA 2D22A 1XSIA 1QX1A 1HKMA 3MSGA 1B3ZA 4M8UA 4BQ5A 5AC4A 2VRKA 4GI6A 3ZJ7A 1F4HA 2QLYA 3OGSA 4AIUA 1X6LA 3SUSA 1CXEA 4FNTA 2CETA 1QW8A 4Z2LA 3AMCA 2W4XA 4CD7A 2ZXBA 3LX9A 1LLOA 3QHNA 2GK1B 3I3BA 4W88A 3VIIA 3GZAA 3WY3A 1V0KA 2XTKA 1WDQA 1JZ4A 4JIEA 4P7NA 3AIWA 2VR4A 4C7FA 1UR0A 4J3SA 3RILA 2WANA 4DO5A 1VJZA 4D6DA 3U5YA 5ABHA 3PZMA 3WFZA 1FA2A 2NT1A 1CPUA 3GBDA 4NRRA 4EAMA 3WD3A 3BXWA 1JIBA 3EMQA 3L4TA 5ABFA 1B3VA 2EEXA 3VIMA 3VMPA 2JF7A 3PTKA 3SUVA 1UWTA 4XZBA 3BSGA 1CGVA 4GKLA 1TQVA 4MDOA 3WUEA 5HOSA 3SCUA 2E9BA 3AJ7A 3U5UA 1E4NA 2G3NA 1EDTA 1FP9A 3I3EA 3F5KA 3L4XA 4JKLA 4F79A 5BROA 3BH4A 2PF0A 3CZSA 4HTYA 2XSAA 4PMUA 1VEPA 2DSZA 2PWFA 1TZ7A 3VDAA 2ZIDA 2V38A 1PSPA 1HJQA 1WO2A 1KXVA 1E6NA 2UY5A 2CITA 3VIPA 3EMCA 4DO6A 1J0ZA 2B31A 4CVUA 3W24A 2YA0A 1BHGA 2X09A 3AHXA 4DUVA 4U31A 4YN5A 5EB8A 4H41A 3K1DA 1KBKA 3SCRA 4P8XA 3SIMA 1HF6A 4W5UA 1WNOA 4GO8A 1SFSA 2X8RA 4N0RA 1XYFA 2XVLA 2ZX5A 3N04A 3D5HA 1E6ZA 5IFTA 1E6SM 1XSKA 3W82A 4PTXA 3WH6A 4K68A 3VILA 2FYVA 1HI7A 2Y2WA 1D2KA 3G6LA 2OW6A 1SMDA 3BUDA 3AYSA 1E3ZA 5KEZA 1E5JA 1W9VA 2ZUSA 1MQRA 4LYRA 1MQQA 4W85A 2ZX9A 3VKKA 2F7RA 1UHVA 4RE2A 1C90A 3DX4A 3DYPA 2UY4A 1IZJA 2O9RA 1E0VA 1H0IA 1KR0A 2FDMA 3SCPA 3A47A 1K9FA 2A3BA 1UWSA 5IXEA 4XV0A 2BY0A 2CXGA 3BVUA 4FLQA 3MMWA 1UWUA 3NUKA 1CECA 1N82A 1GQKA 5ECUA 4J7RA 3VIJA 2BXYA 1WDPA 1KCKA 2OSYA 2WC7A 1J01A 1W32A 2ZUMA 4CUCA 1VFOA 2X2HA 2Z1SA 1XD1A 3VSVA 1VB9A 3WQ4A 3AZRA 3VNYA 2J78A 1JF5A 2WK2A 3BVVA 1ZBWA 5JBFA 3A5VA 4DUWA 3WDIA 3EJSA 2WMHA 5EFDA 5A69A 1V3HA 1DTUA 3T0DA 1V03A 1BFNA 1R87A 1PE31 1QI3A 2E8YA 1CNVA 1QBBA 1JDAA 4KRTA 1TCMA 1OT1A 1TQTA 2ZUVA 3PTQA 3SUUA 3MUIA 1DWFM 4BQ3A 4UOZA 3AFBA 3PTMA 1V08A 3WF2A 1EO5A 3T0AA 1BGGA 2FHCA 4MJ2A 2ZX6A 3S6TA 3CZ8A 1E6QM 1QHOA 2C7FA 3B8SA 1PPIA 3BAXA 3FHAA 2CEQA 1C8XA 4PCSA 4JHOA 3NIYA 1RH9A 2O9PA 1W2PA 4M80A 2D0HA 4NXKA 2XJ7A 4CGTA 3H55A 3IJ7A 3LPPA 3ZQ9A 1NOFA 2WHLA 5FIPA 2VL4A 4J27A 1QNRA 4J3UA 3WFLA 3WDPP 3MMDA 4FNSA 1YHTA 2ZOXA 2WNWA 1PX3A 2J8GA 3A3HA 1H0GA 4JKKA 4HZ8A 8CGTA 5BXTA 4U3AA 1ISWA 1JAEA 1KQZA 2QPUA 5I5RA 1TQWA 2GVYA 1HKIA 3PN8A 2G8ZA 4FLRA 4PN2A 1PCPA 5I0DA 1WP6A 4MB3A 2WLYA 3WQWA 2BHUA 1EH9A 4XX6A 1MWOA 2YKKA 2X0YA 4WJXA 1CXKA 5EFFA 4TVCA 4H7VA 3FW6A 1KXTA 4D6CA 4HA1A 3WBEA 3AROA 2BY2A 1ISYA 1E40A 1XC6A 5AYIA 4UQAA 4KGLA 3M07A 9CGTA 1A3HA 3WNOA 1B2YA 3VTRA 4GINA 4XZWA 5E6ZA 1HT6A 4WLCA 1VEMA 2OSWA 3N11A 4JHZA 2J47A 1HJXA 4DWSB 1MXDA 3B9EA 5A2CA 3KEHA 4JAWA 2YA2A 4NZFA 2DQXA 5CPQA 2WVVB 3WUBA 1B3YA 1J10A 1GONA 4UFJA 5FCZA 4PMNA 5JUVA 2OYMA 3FY1A 1UH3A 5BRPA 1C3FA 2A3EA 2A3CA 2MANA 2WMFA 1QOXA 4PTVA 4CCEA 1E70M 2DEPA 3PZQA 3GTNA 4MNJA 3A6OA 1RPKA 4BF7A 1CGWA 1UWQA 3WNNA 2O9TA 4M56A 1IZKA 5GQBA 5FKYA 4MNKA 1C8YA 4FNPA 4BCEA 4L4OA 4WSKA 4HZ7A 1UKQA 2CBIA 1LG1A 4ZXLA 4GQQA 3WQVA 4GO9A 2ZUUA 1DEDA 4AZGA 5JBEA 2VRQA 3M6DA 2XG9A 3PHAA 3VSTA 1RD6A 4NZCA 2FHFA 1TE1A 1C8QA 2FGZA 1AQ0A 3OLGA 5E0FA 4PCTA 1U2YA 1W9DM 3TP4A 3ZMRA 3HN3A 3ARVA 1UD2A 2PWHA 3EJQA 3ARXA 4WKFA 5CG0A 2BHYA 4W93A 2F2HA 3A4AA 1QNQA 2X2IA 3AZSA 2UWFA 4NSBA 4H8HA 4JFTA 3VIGA 4FLSA 1CLVA 1NP2A 1XYZA 1KWKA 1KWGA 2WHKA 4AZ6A 4CCDA 3VDHA 3VU2A 3HZ3A 3UG3A 4AZBA 1TMQA 2CCRA 1CGXA 2F7QA 2VX6A 2XYLA 1FOBA 4DWSA 3VGEA 1Q6FA 4ZEPA 1Q6DA 1XCXA 4A3YA 1ISXA 1E4LA 2X1IA 4ZE4A 2J8FA 3O2LA 4U2ZA 2XN0A 4CN1A 2VR5A 5FL0A 3ZR5A 4D6GA 1DWJM 2G3MA 1WZMA 3POHA 1BLIA 4NX0A 3WBAA 2WMIA 4MADA 5I78A 2V5CA 3PZOA 4GPNA 4LGXA 1TA3A 5D9MA 2J7DA 2VT0A 3CZEA 1UG6A 2VX7A 3VINA 1CLXA 1US2A 5C71A 3L4UA 1QVBA 1BVNP 2YBUA 1JZ2A 2WZEA 2XM1A 1ODZA 1GOIA 4FNRA 3AICA 3GH4A 1R47A 1CYGA 1GPFA 4M24A 4UQ9A 3CUIA 1AMYA 3GNPA 4HPGA 5A6MA 2IXUA 2VX4A 3GH7A 5CSYA 3ECQA 5CPTA 4WKHA 4ATLA 2BVTA 5ABEA 2EPOA 2YLAA 4UFLA 4AMWA 4LYPA 1ZS2A 2YFOA 1WAWA 2QHAA 1MW0A 1TR1A 1B90A 3AMKA 4MB1A 4WIWA 2J7BA 1VRXA 1VIWA 3WDJA 1WCGA 4L4PA 2RGMA 1O6IA 3MV11 1FH7A 1BPLB 2V5DA 1UD3A 4GI9A 5DMYA 1CTNA 3CPUA 4PMQA 3CIVA 1UD8A 2EPMX 2YL8A 5A6BA 5GNYA 5DFAA 4Q22A 5D9NA 1JL8A 1BGAA 3VGDA 4AMCA 1D7FA 3RMEA 2CBVA 3KWXA 4QAWA 2YL9A 4HOZA 2IXVA 1XH1A 1W3KA 2G3IA 4AD4A 2X0HA 1W1TA 2Q8XA 2JFEX 2V3DA 3SCTA 3MV01 1SMAA 2Z1KA 3TOPA 1H5VA 3BMVA 2GSJA 1CGTA 2X2YA 3ARSA 4OGZA 1UUQA 1J12A 5EBAA 3NCOA 4UOQA 1DWAM 4UQCA 4Y7EA 3WF0A 3PZ9A 3WF4A 2WC4A 5HPCA 4HA4A 4UNIA 1Q6CA 2XSBA 3CO4A 3AXXA
chains in the Genus database with same CATH superfamily
4DGVL 3MLRH 3RI5K 1JQVA 2HPIA 1GVOA 3QORB 2F53D 1Q94B 5C2GA 4R2GD 2YGYA 1G1OA 1T7ZA 3AAZA 4R7VA 1IHIA 3FCUB 4LAZA 5BNXD 1LCOA 4X42A 5D2NA 5D7JC 1NC4B 2E9WA 3WD1A 2EC9T 4YFEA 4OV6F 2WHJA 4P5TB 3THCA 2CR0A 4LSRH 1RCOB 3QG7L 1U8MB 1JV5B 2CIIB 5TQ0L 5INDA 1ODUA 2Y8UA 1U3HD 5GRZA 5TGBB 1XLBA 1S2AA 2J6EH 2OLAA 2HK0A 2OR9H 2H6OA 5FJUA 3ABKB 4JFPB 4BR1A 1NGXB 2Y72A 1G7IA 3EYFB 5FWQA 4PJXA 2MEJB 4ZB2A 3UJRA 3B2VL 3LTYA 4HBCL 2VGGA 4JRYD 4HPYL 3I65A 2DGAA 2NY1D 3B9KB 1GY1A 1T0MB 5KG9B 1COBA 4HYVA 3ZRCC 2AV1A 3WFBH 3NQVA 2FYYB 1U8NB 3W70A 3BZJA 2E4FA 2PXYB 4LLYA 4QJ4B 4Q8PA 5CWSA 2VDNL 1TSRA 3CJPA 1EDYA 4G8FB 3VD9A 3KL0A 5HI3D 1RJRA 5AG9A 1W1YA 3MNDA 3KJ6L 3U2OA 1FNEA 2WHVA 2YBRA 2OEJA 2CLKA 4XCYA 3WL1A 5K3VA 3F7JA 3CFEA 2QAFA 2AQNA 3HR6A 3WG7B 4WO4C 1NGPL 4P2QE 1YMMB 3H2AA 5IJKC 4JNZA 4DVBA 1JHKL 1NFBA 4AMAA 1TO4A 2Q7YA 4MY8A 5D7IE 2NV1A 2NLYA 1YPIA 4CJ0A 2R94A 3GIQA 4Z42C 5LGZA 3OKDA 1E5YA 1KY6A 2E9LA 3LNGA 2VQ1B 4AK1A 3F12B 2IALA 3RZCD 3ARFD 3RGBA 1FCBA 3NZSA 2UZ9A 4TULL 2WQSA 3NCFB 3BTNA 1RIHL 4Z0XA 5D4HA 2ITCB 4UANA 1ZLVK 5CUSL 4PS8A 5D9PA 3OGVA 3TVAA 1JWUB 1VYSX 5EF2A 3H0TB 2COQA 3TFCA 2CDGB 4TUKL 2LFEA 4QHUB 1IT0A 3UGXA 4ICCX 3DHUA 4BK9A 1LBMA 5B38A 1V0LA 3ARDB 3VO0A 4GI8A 5IR1A 2VDIA 1K8XA 3HLAA 1TPC1 3WDRA 3C0QA 4OCMC 3QN3A 2OYLA 3LQMA 3NFSH 3B2XA 3HZMA 4UT7H 1DLFH 1N26A 4PJDF 4MASA 5D03A 1A25A 5KINA 3WXWH 2XV2A 3NJVA 2JGYA 3OR7A 5FESA 3T5WA 1KW1A 5E2VL 3HHMA 3RVUD 1J1OL 1IE5A 1K9TA 3BRDA 4G6ML 2WCGA 3QPKA 4H9TA 2C7UB 4RUBA 1KCXA 5LIWX 2OL3L 3QUZB 2VUKA 3SCMC 5F9WB 2VQ4A 2W61A 4I5XA 2HX8A 3KR3H 1MNSA 1E56A 1JJKA 1U36A 4O02A 2WXIA 5JIMA 2F19H 3J8F7 2R0KL 1YPZA 4X8XA 1FO0L 1U93A 2NSXA 4DBSA 3H7RA 3SN1A 3STGA 1BBDL 3X1NA 2IH8A 1FGVH 2AEQH 3O7UA 4NSKA 1X5MA 3NPSC 3F65A 3PDDA 4QXWA 2NQ9A 4IGNA 4FXGB 4QGYA 1GKEA 3BSHA 1E9TA 2JCCE 4Z7WB 4ZMNA 4XBEL 3L9EA 2O61A 4DQWA 2ZSWA 2HJLA 3WFEH 4PB0H 5F96L 3UCCA 4XN9A 1LK2B 2VOTA 4XZUB 2YEVB 3WNJA 5K33A 4MA3A 2CXKA 3W23A 2Z93B 4EWJA 3ZE0F 3WK1A 3EWXA 4Z17A 3GXPA 4WI0B 5F7EL 3QJFA 1O5XA 4L9YA 3EO1B 3NSCA 3QDMA 4X0VA 5KVGE 4M6VA 5HMDA 2GUYA 4M6PA 5DQDH 1L6WA 2CJSA 4LF3A 2KS0A 2G41A 2IFFL 3G0UA 1F8TH 4H6EA 1G7PA 3D39B 1RXOB 5JW4M 1QNZH 1U8JB 1POJA 3OHMB 2IMRA 4DVRL 3ATFA 3HB3B 1I1AC 3W02A 1UWEL 3FFCB 1GK8A 1O5PA 3CZKA 1JYXA 5DURB 1XLGA 2DT1A 4FQ1L 1HXKA 4XI5D 1WA3A 4FMVA 2AABH 4GFIA 2HKHH 1S8DA 1EPFA 3UERA 4OQVA 4QCIB 1A6AB 4FFWD 1MH5B 4WW2C 1XR2A 1O6TA 5ELIA 1BV8A 4ZUUA 4JTLA 5AYTA 6A3HA 4H01A 2BOCB 2EE6A 3PWNB 2AJUH 3RE0A 2H7WA 3N6QA 2EKCA 5E5MB 3URAA 4ZOCA 4FEMA 5C7ZA 4QRSB 2H3DA 3DX0A 5GRWA 3CLEL 4X0KA 4FKKA 4HIIA 4MB5A 3ULSA 2OAAA 1EZWA 4QOKB 3CPLA 4RWYL 1SDYA 2WWCA 3OP2A 1VHNA 1YNTF 4BCZA 4XN2A 3CAKA 1F90L 2EAEA 2ZCZA 2FZMA 3ZIZA 1NAL1 3SFWA 2XWJA 4X0NA 4Y4FA 3B7RL 5KJRH 1FG9C 2ARJA 2FEEL 3UWYA 3AT9A 3WIIH 1OLLA 5MENA 3QCVH 5CBBA 5E09A 5KBLA 4QLKA 4X9YA 1ONEA 3HLKA 5KSBE 4OUEA 3HB9A 4QXIA 4JLRA 1K7XA 2VKZG 2KUTA 1HQ4A 3EGSA 4XD6A 4AIZB 1I4FA 4MJIB 1LD9B 5DVLA 3RGTA 4J23A 2ATKB 1KM5A 2R2BA 3HBGA 2X4RB 4G8IB 4NT6B 1ECYA 2YZ1A 3PL6D 4BE5A 3RF9A 1QI5A 2PP3A 4ALAL 4U4BA 4Y19D 4B3ZA 9RUBA 1V6VA 3VFMB 2ISVA 3MCMA 2DSUA 3H2CA 4LCUB 1PY4A 3UETA 3VFPB 2CPCA 1XGQB 3EO0A 1NCHA 2Z25A 3PE9A 1UENA 3H2NA 2WBJC 1Z48A 3W7QA 5K1JA 4OJYA 4H9YA 3DZ1A 1I60A 2WBKA 2ZX8A 3HJEA 4M8VA 5A6TC 1SEBA 3M0LA 2X41A 2XWBA 4YHEA 32C2A 1T04A 1ZJHA 4YMZA 3MC5A 2QV2A 3LZ5A 2VDOB 3V4VH 5I15L 3AZTA 3TJEH 4FNLL 2JB6A 4NKMB 5DEZA 5JW3L 5AY7A 4QP0A 1TNMA 4XP9L 3ALXA 2VVNA 4Y9MA 3WD2A 4YLQT 1TYRA 5IUSA 4PE8A 3IFPB 3IJSB 4GQ9H 4M3KB 2HBVA 1U6AH 3SDAA 5LSMA 2HJPA 1NWRA 1JF1B 4XMLL 1X7SA 5GRJL 3NQEA 4F2UA 2VLKD 4OZHE 2CE6A 4PGDA 3MDWA 3CFKB 3VAVA 5IGXL 1FV1A 5E08H 1RCQA 4XN8A 2HS6A 1C9WA 1SJMA 5JORB 2C34A 4XPAH 3N2OA 5HYJE 2E56A 1TRDA 4YQXL 4LV9A 4QTIH 3QEGL 4LK4A 3AIEA 4AZCA 4IRZA 4AEIL 3OG2A 5DRZB 4S3AA 4AQAA 1QMLA 5IB2A 5I73C 4FN0A 4O9HL 2CHRA 3MRPB 3EFDL 3C56A 3MI6A 2PR9A 4HWBL 4PQXA 4ERSH 3EOLA 5I1GH 4AM0B 4GJTB 5JOFB 1NAMA 3UTSB 4N9GB 2V2XB 3ZMEA 4DP1X 1GMIA 2F54A 4R7OA 1RHFA 3QUXB 3CAQA 3IDIA 3AITA 1KLUB 3N29A 4GZIA 2Q86B 3TZVB 1A5FL 2NYZA 1W9BM 5LQBL 4MA1C 3NQIA 2B8OT 2XQYG 3ISWA 3T6ZA 1Q9OA 2AI0H 1JZJA 4ODBD 5JVLA 1OTUC 1IBGL 3JYBA 1FWJC 3NDYE 3HNVH 1MCLA 5GS1C 5TE7H 4Y5YB 4P4KA 4MGGA 4WW1B 3BMXA 4QISA 5LO7A 3KPTA 3W1NA 3G08B 3CC5B 2XPYA 2UZYB 5D8ZA 2QCEA 3DHPA 1M3JA 4EPSA 5TF1L 1BWWA 4ZQRA 1N7KA 3O8XA 4GG6B 2B7NA 3AXLB 1SLWA 1A2YA 1CZ1A 1DTNA 4GUPB 4KKLD 2ADJA 1H63A 2BCKB 1PNCA 3V6BR 2Q8ZA 3KPLA 1IKFH 3DJ9A 3H1ZA 3H70A 2XNAA 4N2CA 1OAKH 5C7XH 3LHZA 5A8NA 1LQAA 4L61A 4Z3EA 5CBEB 3RVTD 3FO0H 2O7QA 5IOKA 3GR4A 4DKEL 4MNMA 2AF2A 4HK6A 3GH5A 5K1VA 4W8BA 1K8IB 5BZXA 3VA8A 1FCUA 2PMQA 2NUWA 2JJVA 3CZGA 3L3JA 4JO3H 3CFIC 3QDGD 3DFPA 3BQ5A 1FWGC 3BK0A 4EE9A 2D9CA 1P7QA 1HHKB 3IJEB 3MP3A 1F5ZA 4US6A 3MRLB 4HGWB 3WBYA 2Z8VC 2JIXA 4ODUA 4NYUA 1N8ZB 2MPAL 4JMNA 3F8UB 3EFOB 3GMNA 5LDUA 1GQJA 3NAAL 5F3HA 3M0XA 1ZXQA 5IHWA 2WXRA 1E9QA 4BI5A 2HSIA 1RUAH 3IARA 4JFZL 3VXRA 1BVOA 2KL6A 5IMKB 2EQDA 4JBSA 4IMKC 1YCSA 2G50A 1VERA 3VZZA 3UPRB 4L1LA 2Y1YA 4PJBB 2ZJSL 3FQTB 4RK8A 3BUBA 1MCNA 4MNHA 5D5MA 4K5PA 2ZCLL 3R7RA 3MROA 2I85A 4K3ZA 3S2JA 2XYCA 4L9DA 1O75A 2EDOA 5C0CD 2FATL 2F8XC 3KWTA 3OGSA 4AIUA 2CETA 4EUPB 3W1LA 1IEVA 4P9HC 3FU3A 2EO9A 2VN4A 2OMBA 4OLUL 1V0KA 2XTKA 3FT1A 2GEEA 1R3WA 3UIZA 4FXKA 3VCLA 4LL9A 3RILA 3DROA 3PUCA 3EH1A 1FWNA 3MRCA 4OAWB 3EMQA 4LVFA 5SWZB 3DX9A 4PGCA 2NY6B 3UGEA 2JJSC 1XH3B 2YQ2A 1TTAA 3B03A 4Z7UA 3BJTA 4LE8A 1KNOA 3SSJA 2WJEA 4HTYA 4IJ3C 5FF3A 1NUDA 3RFAA 4DKDC 3PNWB 1TWWA 3VIPA 4EF3A 5K9KB 3AU1A 1YY9D 5D96B 3CYJA 3K1DA 3SIMA 3ZL4L 4S1SH 2OMXA 4YSQA 2D9QB 4CJ1A 1UOVA 1K3UA 2R91A 1AZNA 2J27A 3U48A 4J4KA 4F2EA 5IWLC 2NNXA 4LHUG 1JGDA 4JS3A 3W2KA 1A6TB 3PWGA 3WJLA 5I1KL 4CVZB 3EG9A 2FDMA 3P73B 1OALA 4XN4A 3ARBD 5F1NB 5AUMB 3T0CA 3ETBF 4Q6YA 1DO6A 1LNUB 2FMOA 2ZCGA 1J9RA 4NQVB 4LSQH 4S2SA 1X5LA 4O2FB 3EJJX 1XD1A 1TPXC 4B9FA 5D1ZI 3HE6A 4QPEA 2ZCHH 3ECBB 5EUOB 2A6KA 3LEYL 3P69A 2BSTB 4H88L 3UMTA 4TLKA 1GVEA 2IKHA 1GCFA 3N42B 1FDLL 1EFQA 1I2NA 4XPHH 2IPGA 3FJLA 3SUUA 3MUIA 4X7TB 1ID2A 2VXQA 2ZRUA 1Z66A 4B9CA 1LO5A 4RGMB 1JCTA 5D7LE 4G1MB 2HVJB 3T4AC 1RH9A 4R4BB 4ZQTA 2IQ9L 4HEPA 2VDML 4C5YA 2WHLA 2PTZA 3WXVL 1BQRA 5JW5B 4EX4A 2XQYA 3A3HA 2WNXA 1DVQA 3U0WL 4KK6C 4YLWA 5FCUH 3C60A 2P8LA 3VFTB 5F9JA 3A6CL 4XX6A 3ZDYB 2A9DA 1Z0MA 3EH5B 1NGYA 3WZ0E 1KBWA 5AYIA 5E9DD 2CLVB 2JKXA 3VTRA 3V1HA 5CS7A 2H8ZA 5HI5C 5FIEA 2DMCA 1OD9A 5AOJA 4L23A 5CJOL 3WUBA 3P77A 4IPJA 1FL6B 4E36A 1EEUA 1F58L 2DKMA 1AA1B 2J5WA 2PZNA 4OIBA 3R1GH 4KZDH 1MY5A 5CJQL 1UCBH 2O30A 3ZS4A 4JUSA 1UXSB 4DEWA 4E9LA 3ULUD 1T1WB 3U46B 1MRDH 3R1ZA 4DTGH 2UVFA 2YQGA 2YR3A 4KK9C 3MLSH 1OIOA 1I0DA 4ABVA 3OLGA 2W07A 4R4FL 2PCEA 3KAOA 1WZ1H 3ZMRA 2OPCA 2C4XA 3ARVA 2PWHA 2VXNA 3OKEB 2X1QA 5IHHA 4MFDA 3JVGA 3ASWA 3QHTC 1EC9A 2NLJB 4KHTH 1AC0A 3QIWB 1S2CA 1P6FA 2O4EA 4YUEL 4JTHA 5E94B 4Q4OA 3T04D 2XBDA 2HLFD 2JJUA 4EKXA 2JKAA 1RZJC 2DYPA 3NRFA 3NJFA 3MRQA 4LVHC 4PWEA 4OTXL 4P2VA 2HLEB 3WQCA 3W73A 1INDL 4MD5A 5I2IB 2G9KA 1Z2KA 4NJHA 3VINA 2ZDRA 3VU1A 2WOBA 4MKSA 4FNRA 1Z9LA 2K6WA 3LCXA 1AMYA 4UOW1 4AQ1B 4DYEA 2QGHA 3IGFA 1D6EB 2YLAA 3HR5B 2ZRWA 3F58H 3OJVC 2XA8L 4P2AA 2VWEC 1XU6A 2VW7A 1EAQA 2J7BA 3CVIL 1QW7A 3TROA 3WDJA 3Q48A 1HKLL 3MV11 2OQJB 3UQNA 4U6XA 3C5ZD 2ANUA 3NQDA 5DLCA 3Q8FA 3VI4A 2EPMX 1RZ7H 3H85A 1JXDA 5EN3A 5E2WL 1D7FA 2R1MA 4ZG1A 4CRPA 5J56B 3ZVVA 4QO1A 4TV6A 4DAGL 1YDPA 2K1MA 2MHAA 1EJRC 3ELFA 2X2YA 5IF0B 5BS0B 2AQRA 2FPTA 4PJGB 3O06A 4B90A 3OKOB 3AO0A 4GBXB 4RMBA 3CO4A 4P5KB 3W9EB 5HHMB 2XFYA 4OJAA 5I23A 4NNXB 1JD7A 4LF2A 3BDKA 2GTWA 2FGLA 1WXJA 5HGBA 1CCZA 4LB3A 4ZNEE 3LRMA 4W9CC 3TO4D 4QRPA 2X1PA 5EMYA 5C0BD 5IMMB 2YIHA 2WZPD 2O92A 4HUVB 1GQNA 3E2SA 4U1GB 5DY3A 2WCSA 2Z0BA 1E1CA 1HTYA 3VC5A 5IJVB 4R96B 1EZUA 3M5YA 2XHYA 4K38A 1PW3A 4ELKA 4C7DA 3ROOA 1GY2A 4X6FB 4HMEA 3GMRB 3DUSA 3VD2A 5LA0A 1BSIA 3WIHL 2WO5A 3SJNA 5AD0B 1II4E 1FVCB 2F5BH 5MP6H 3O45A 5F7HA 1PX4A 3H8NA 4PJ7F 1CGSH 1CFTA 2ATSA 2GG1A 4G7SB 4M7LT 2RFXA 2H32H 3B1UA 1BYCA 2NZIA 1YXDA 3QZAA 5DHMC 2XUCA 2CO3A 2YEQA 3SGEI 1HKVA 5AZ1A 2J9YA 1VP5A 1PZCA 1B9KA 3GNML 2BP5M 4KJYB 4FXFA 3IN0A 2MNJB 3WUWG 5IHBA 1R5WA 2QUNA 2GYIA 3ZZ1A 1H49A 1BX2B 3DEQA 3PAOA 2XVBA 1O5QA 3ULVH 2DLEA 4Q58C 5IUCA 4LVOC 4LP4A 4XC3H 4FNQA 3PQYB 2AXFB 1TJ2A 4Z7NF 4A6YH 3C0LA 2H1LM 1EK3A 3RPKA 3AOFA 4CNNA 3AM8A 4KEUA 4YHML 4KVCL 5CZKA 4JHMA 2HFTA 5T9CE 1BRLB 2REQA 5CEYA 3T05A 5CEWA 3THDA 2YUVA 1CFNA 4X5XA 3OJDB 2ADFH 4M6UA 1NDVA 1IMHC 3W0WE 1HOEA 5A6JA 3VJ6A 1NGQL 4NCC1 5DJ2A 1V6XA 3ETBJ 4X8GA 1XSJA 3CU7A 1XUUA 1QNIA 4XP1H 3B8DA 3JTSA 1DQVA 2FVNA 4QS5A 4K3JL 1U3ZA 1UB5B 3WLLA 1VEOA 1OP9A 3APTA 4JR5A 1KF9B 1XINA 4LSSL 2OXNA 3KGSA 1AH0A 3QZPA 1GOOA 1I8AA 1FCGA 3BT2H 2P10A 4B6ZA 5I1DB 3FGCB 5D38A 3MUJA 1KUMA 1NM9A 2X89A 3SCOA 4FQXC 4A8RA 1JS4A 3I6RA 4RAUB 1KULA 4K3GA 5IFHH 3EYVB 5ABZA 2F7OA 3I2CL 1JPDX 2Q01A 5SX4I 2JKEA 1VPYA 5KTEL 2A6JB 1XIWB 4LAQL 4S2CA 5CD5D 4YVXA 1HZKA 5D2TA 1HOCB 2DY2A 1SO4A 3PV7A 4TNVK 4EZLA 3W87A 3QXAB 2QQLH 3KDMB 1EFXB 3IACA 3QOKA 3C8DA 1KTDA 1QNSA 2H3KA 3ARZA 3REWB 4CCCA 4Q9BA 1SRDA 3WSUA 1KN2H 4ZS6D 5KBKA 4LLAA 2GJZA 3BSZA 2W6RA 4QLJA 1P5VB 2JKRM 3WUFA 4JQ4A 2LE9A 4L8BA 5FV2A 5REQB 1DVYA 1BEYH 2CGRH 1E4IA 5TBOA 3VZYA 1BFVL 2CKSA 1F74A 3R94A 5M1TA 2NUYA 4HWZB 5ESAA 4QIUA 5DDHA 2DBLL 1WDDA 1X5IA 4R85A 2I07B 4TVUA 1OHLA 2RDUA 3BAEH 3IKCA 2Y63A 4WKZB 4RIRB 2AAVA 2NQ3A 3WY4A 4K5MA 3U2ZA 3FO1B 1O9VA 3A24A 4F2MA 1R3VA 4WK0B 1QWNA 4WNJA 4D3CH 5DQJB 5MI0C 4OLXL 1AODA 3MBDA 3OVPA 1TSHA 8FABB 4HCRA 3TW6A 1EYWA 4L8DB 3SE6A 1OGGA 4YNYB 1K4DA 1H19A 2DQUL 4Z7QF 4E2OA 2GQ3A 1KBGH 2WOYA 2WBGA 3TMLA 3AXIA 2JJTA 3MRKA 5FF2A 4KPHL 1EEZA 1VLWA 3E6FA 2QDVA 4RNRA 3QF0A 4GKZB 1IGIH 1L9SA 3GSOA 4YBQD 2PCPB 3MXVL 1UB3A 2E59A 2B7OA 3UFYA 2ETWA 3UXAA 1SZEA 1A14H 2UZIL 3CX5J 4DOHB 4XNYL 1LWJA 3CHVA 5LBSH 5E6IA 5FYJD 3BP7B 5I5JA 9XIAA 1ZLWK 3O9WB 5BO1H 2Q6ZA 2YXMA 2VZ1A 3CFDA 3TV8A 2FH6A 4XNQB 3S3JA 4QG8A 5G4OA 1MAMH 4OJFH 3R0MA 4X4ME 3MJYA 4QYOB 4GAYB 3CFCL 2YZRA 3FC8A 4R7DB 4DPAX 5KVDE 5FC9A 4EPKA 3B3IA 5FO7B 3ZM8A 3U2JA 1D7DA 1U9KA 2WMGA 4A8NA 4UQ2A 1UD5A 4XAPA 4JDEB 3CLFH 2VFIA 5E1AA 1DQJB 4NO2A 3FF7A 1PDKA 4AYFB 3W7RA 3KP0A 4WSJA 1CDIA 2I5GA 1E1FA 4AVFA 4Z2GA 3DJTA 2ISDA 3BLDA 1TQXA 5GGRA 3QDMD 4CKVX 2CJUL 5G4MA 4PJHE 3WUWA 1A0QH 4FK9A 2VN7A 1GG0A 3LB6C 1F7BA 4X6CB 2FJHA 3MN8A 1QSFA 4P9HL 3DYOA 2FX8L 3TBSA 4JTDA 4MNQD 1TZHB 3S3SA 1N8WA 1AMKA 1PXGA 1G0CA 2GJXA 4WSGA 4AY1A 2A1YA 1Q6EA 4ENEC 4S1RL 3NCYP 5FF6A 3WJMB 1SYSB 1OO2A 1PY0A 3C3UA 3PWPD 4OGAC 4P7QA 2BNRB 3IAQA 2GJRA 4NI8A 3ABZA 3UTTA 1U3NA 1OX6A 4GNJA 4Y2WA 4KROD 1LL4A 3W3OA 1V4YA 5JO5B 1W1IE 4IBSA 4NKDB 1IEHA 2GZXA 2DAVA 5EPMB 3N2MA 2DQHH 4K55A 4FQQA 2XVPA 5C7VA 4TR9A 5EU7E 6ALDA 4U49A 2WYZA 1P7TA 2NUPB 4UUJA 2LT9A 2CPUA 1SFLA 1NICA 1I2QA 1KBIA 4BKNA 2W0FA 3KRZA 3GDCA 5F89B 4ODVL 4LEOB 1Q8JA 2QYGA 2WZMA 4X99B 5F4XA 4NI3A 4FFZH 1B54A 4RMSA 1RI8A 4GQRA 2TODA 2A9AA 4QIRA 2GUBA 2E9MA 4JQ2A 1BG1A 3LQZA 4FF5A 1AXTH 4YX2H 2Z1XA 2PYFA 4I0PA 2GJ6E 3VM7A 3WQ8A 4CEXC 2YPLD 1D5BA 3SGJA 4A7QA 2AQ1A 3D48R 3V5FA 4JO1H 5MEND 1W3JA 3ARGB 4IKKA 3P0GB 3V4PL 3X12A 4D8AA 1W6WA 2PAJA 1YN7A 1MLBB 5T3XD 4NRSA 4WHYH 6PTDA 1ZCRA 2F61A 3I7SA 1E28B 4GD0A 1HP4A 1JWMA 3DX8A 3VFGL 5I66B 2P80A 2E77A 1AR2A 5CBAA 4ZPVB 3P4OA 1NCWL 2X6MA 4M6QA 3THMH 2WLZA 3ZLFA 5E8NB 3RYSA 2HRLA 3JSSA 1PD6A 3SE9H 4Y90A 2D23A 3NCJL 2D3VA 2CBQA 1XBRA 1RAMA 1L5GA 2FUQA 3T71A 3BGAA 1GPWA 1FWIC 4J2MA 4L3EA 3MRMB 2YMOA 5HHOE 4F37F 3GVRA 4A66A 3ABGA 1OADA 3UP6A 2O6CA 3AQXA 1YNLH 4G9FA 5DTFA 5FM5O 5A94A 3TPUB 4V2XA 3B0YA 3KPQA 4H7CA 3CUZA 4C91A 3S36L 1UPPA 3BZ4B 4PWIA 2QGDA 4LPWA 2JMRA 1NCTA 5HA7A 2JIEA 3G0XA 5LKYA 2O4QA 3IJLA 3ZVHB 1DUYB 3AVEA 1TTCA 2A9BA 4RCXA 1UROA 4IGHA 2MOVA 3G5EA 3TYDA 3RAJH 3FUDA 4J5NA 1W72L 3W5NA 1UCWA 1UWAA 2X38A 1KCWA 4WI9A 3EIFA 4JQXA 4IJBA 1SFDA 1RVFL 3SDAD 1DJNA 3DYMA 5D1ZC 3BWZA 1I75A 2IH3A 4LH8A 4MS8D 4AJVA 1SU5A 4DGIH 1TZGH 2K3TA 3S5YA 3VFOA 4R5EA 4WTXA 4R2GC 4G8GB 1NFIB 3WL9B 2N1KA 4HUNB 4DGWC 4GY0A 3JV6B 4BH7B 5E9AA 2Q8BL 4HIXL 3PZVA 3T0EA 3LS5L 4UU9A 1TDQA 3HFMH 4IBQA 2OZ3A 3KPRA 2VN6A 5KMYA 1RZJL 5FYLE 3IYLW 3P2VA 1U3HC 4Y2OB 1X98A 4CNOA 3TN0A 4ZUSA 5B38G 1U5VA 1E6RA 5MEQA 4ES8A 3H4HA 5IBXC 1R3JB 3Q5TA 5IB5A 1ETZB 3CSFA 1W17A 1JV2A 4NRYA 2XKNA 4AY8A 2I57A 3IVKB 2IV9A 4JM2B 4KESA 2NY1C 5LA2A 4P4KD 2VEPA 1ES0A 5DT7A 4I2XA 2P24A 3L3OB 3EBVA 1XF4B 2D2GA 5FSEC 3HMWH 4CD4A 4KK8C 3TC7A 1L9PA 3WE6B 2Q6WA 3HEIB 3CL8A 3O8XD 4NQTA 4MQTB 3FL7A 2DZSA 4UFIA 1MHPL 2RH0A 1HQTA 3FF8A 1JN6B 3D2TA 1UH2A 3CTTA 1REIA 3B5TA 4RRPM 3QV9A 1GW1A 3QR3A 3QDHA 3PTDA 5HI3C 2XTJB 3MFFB 2QKIB 3W56A 4X4YB 4DZ5A 1FC2D 2POTA 4HHHA 1UYQA 4BSWB 5DFTA 4M62L 2XISA 5F1VA 4TPRH 5T1LA 4CAGA 5G1TA 3SKUD 3TJLA 2YN5A 3BPOB 2NW3B 2GW5A 4N2OA 1VC4A 3E2RA 2PU0A 4U3XA 2NLIA 3WMSA 5H6HA 5CBJA 2IPTL 5E0KA 4NP7A 3CIQA 3LHPH 5A2FA 1I8IB 5EO0A 1C92A 5EWIH 3W38A 5C9XA 3ZDZB 3AMGA 5IMLB 4HNTA 1AXSA 4YMPA 4G6FB 3GLAA 2DWEB 3V18A 5FSDC 1MEHA 2Z00A 1KGJA 2Z1VA 1KG0B 4O8RA 4XN5A 2ZXBA 3SDXB 2EVFA 2Y0SA 4ZFZB 4OZ4B 3LHTA 4ODHL 3WO4C 2CUMA 2ZOOA 3RZCC 3ARFC 3NQ6A 1S7SB 3JTTB 1MCCA 4WUUD 1CPUA 2X87A 3NAVA 3WX7A 4WK4B 4IRSB 4Z77A 3TQ0A 1KPUB 3CQQA 1CD8A 3ULVF 3DFQA 1SQ7A 3WUEA 3S4SG 2GVLA 3O2DL 4MNGE 4AW4A 5C8JB 3OB0H 1T2XA 4FHKA 3FT9A 4OFPA 3BH4A 3P8IA 4H9XA 4DZIA 1P4LA 3UGRA 5EBGA 4X4XB 1W37A 2OJZL 3VXNA 1IBZA 1YNPA 3VFUA 2YB4A 3RB5A 4JFEE 1U1UA 2QHRH 2VUOA 3MODL 3IDGB 2X7LA 3KPNA 4IBTA 1VRDA 2QZRA 4N0RA 3G3DA 4TX9A 2VAJA 2ASHA 2GHWB 3NQBA 1HE8A 1OPGL 3AQZA 1EZVX 3AACA 1XYLA 4PTXA 1JGVL 4EI5A 4HPYH 3VD0A 3LKPB 3RVWD 2VDKL 1EXGA 1KIRA 5KBDA 4KK8D 3S47A 5HR7A 1XJBA 2H6RA 2Z29A 3VKKA 2CLOA 4KQ4L 3N4FA 1OC5A 2DS4A 1Y0LB 3RVUC 4F80A 4RV8A 4OLVH 1IUZA 1EJ6A 1YY8A 8TIMA 3QUKA 1CECA 5I1JL 3HNTL 4CNPA 3R06B 4A68A 5F21B 4ZMQA 2ZUMA 3O63A 4O10A 3HN5A 4MJ6B 1ZBWA 3KEDA 1XIGA 3PS6A 2H47C 3KJ6H 2Y69B 1MLCA 1XGEA 5D1XB 5EOCL 2IAMB 1UXWB 5D1QB 2HJFA 4C4BA 3NGBB 5L7XL 1TQTA 1Q9WA 4DI8A 2OQYA 5C55A 4HK3J 2GGIA 4DZAA 4H6KA 4O2CA 4N0UB 1JVNA 4BFAA 2KPWA 2X4UB 4ZB0A 1LDPL 5KVEE 2P46B 4JIPA 2Y1VA 3H55A 5GJSH 2CKBL 3ITCA 3HE6D 3ZDXF 5KETA 1G4RA 5L4MA 5HSFA 2CQVA 4H4IA 3FQNB 2AMUA 3W00A 2YUZA 2AW2A 1ZWIA 4BCXA 4A2HA 2PYEB 4F1ZA 3KBFA 3RX7A 5TE4H 1E6OL 5I5RA 1TQWA 5EEVA 1YBQB 4TULH 1SSGA 4BDVA 3TCLA 4A2DA 1GZPB 2FZ3B 4H00A 3HG1A 5CUSH 3EXLA 3S46A 1NBYA 3CXDH 4HA1A 3WBEA 3CVDA 3N55A 4MCYA 1XC6A 3HFTA 3R8HA 1JNHB 3ZHFA 4I0CC 3AADB 5D2WA 1NCDL 4TUKH 4GNKB 3GG0A 4LS2A 1HJXA 4ZMGA 1TFHA 4JUTA 1ZE3H 3SOBL 2WVVB 4XGZB 2JKPA 3R0UA 1DYZA 1CICD 2ZUQC 1UH3A 2A3CA 1FBAA 3VI3A 4PTVA 1MWAB 5DBTA 1J87A 3WO3B 3PZQA 4WR3A 1Z9AA 3C60D 5TH2A 1RPKA 4JN2B 4XI5C 3L5WA 1MELA 3C2EA 1TYJA 4AWJC 5DYOB 2XSKA 1AD4A 3FB7A 4FFWC 2MWCA 2XACC 3P9LB 2Z31A 3PHAA 2C3WA 4KO9A 1AQ0A 3LKRB 3KWUA 5E2VH 4HKJB 5TDPB 3ORJA 2BHYA 4W93A 1A5LC 4NUJA 2R1LA 5AW0B 1XGYL 5EU6A 4JTKA 4ROQA 4OGYH 5DJAA 4G6MH 4JY5L 4XVSL 3VU2A 3UG3A 1N5AA 3X1BA 4YBLB 4FEZA 2OL3H 3SBWC 3URNA 1AQ8A 3NTYA 4KRMB 3DPDA 3DUUA 4ZFCA 1XI3A 3JZEA 4HKPA 5AVVB 2RQ8A 1U8IA 4Z0JA 3UCDA 4ZE4A 5HGDB 3L5MA 4U2ZA 3FSUA 1IAMA 4RNHA 1GTNA 4TN9A 4F7TB 4DCQA 2R0KH 1VCAA 2XRAH 5G1YA 3AALA 4XNZB 3SPHA 3PZOA 3G9VA 4XPBL 3HC4L 2VT0A 3U4FA 1FO0H 1A0CA 2NVDA 2XXFA 3GZQA 4PBVC 3L4UA 3WHXB 4QHLB 3ITLA 1O6SA 6XIAA 2Z1WA 3ECQA 3KVJA 1BBDH 5KBNC 4R0LC 4UFLA 4GAAA 3P0YL 4UTTC 1CI1A 1P0EA 3U6RA 3B06A 2D03L 3EWZA 1RK6A 1KYOK 4XBEH 2VLJE 4JPIB 1MRAA 3BKCL 2BP0B 4ALDA 4KKZA 3HGJA 3WLOA 2XH2A 4TVPL 5E93A 3V4BA 3PL6C 3VQMA 3B2PA 4G43A 3E9AA 4ZTOL 2DUZA 4NX5A 1RPXA 4QI3A 4HOZA 2DDQH 1W1TA 4LYKA 3S4SA 1AH4A 3VC6A 2Z1KA 5HY9B 5I02A 3NOEA 2YD6A 4NQCA 3SDDB 3RJDA 4R5XA 1E4WL 4P2CG 5HNRA 2IGFL 1FHDA 4ZSOB 1EC7A 1CD1A 3DV6B 3FUKA 5JHDB 2AQTA 5I17B 4IOFD 1RIUL 1XAUA 3QC0A 1WUFA 1ZJBA 3IIZA 1UWEH 1QTSA 1P5BA 1HXMA 2XZQL 3FCSA 3NEHA 4IDLA 1N3NA 3U3HA 1FFRA 4C83B 4C6NA 4JKNA 4XXWA 4FQ1H 1I8KB 2X4NB 3CV5A 1PHQA 4FL4B 3EHBD 4K23L 3VD3A 1ZVHA 3V4LA 2BX5A 1E72M 5EU4B 1JDCA 3QR0A 1HL9A 1WWCA 3S83A 1GAFL 4FTVE 1NUGA 3HV9A 1SXZA 2OT1A 2AAAA 1EAPA 4GVHA 4GKSA 4UIKH 4D6IA 3QIBB 3C75A 1O7AA 3UIYA 1TX0A 2HTKC 3W27A 3FQUA 3SO3B 1XCFA 4HKBA 4QRPD 2PBOA 4I6KA 1HL5A 4LKXB 3CLEH 5DUJA 1EPVA 3U82B 5F7UA 3PDOA 4LHUD 1SDAB 1G43A 4QDWA 1WFMA 2VW6A 3NVTA 3BUTA 1BXUA 2UY7A 1UUOA 1F90H 1DCLA 2D7TL 3TE9A 3BH8B 1Y5VA 3PWVB 5HINA 3QIUB 2ENYA 3EOUA 3H23A 3GSRB 4YSPA 2R51A 1H41A 2ONEA 4TF4A 1L6PA 3GW3A 1GYNA 2VE6B 4XQ6A 5DJYA 4GBDA 2AK4B 3VOGA 4AHOA 2DH2A 2N0MA 3WYZA 3BVTA 4CVXA 5BNKA 4IWWA 3GHTA 3FUNA 3P0VL 1E9PA 4L4TD 3LB0A 1TTQA 1FAIH 2A85A 2YN3A 4WWNA 2A83A 5A3HA 1VGKB 1DVFB 3V55A 2D73A 3GIZL 3Q2CA 3IJDA 4R6UA 1LT8A 4YCOA 4DM2A 4LMQE 4ALAH 5F7FA 3EB4A 1TVPA 5AW6B 1JF6A 5J0BA 4EPEC 1H5BB 3PWUA 5C6WH 5JOEA 1UACH 4IOSA 2E8ZA 4UFHA 5HD8D 5HHPB 1FHLA 3D7PA 4MYXA 3GZOA 1XIBA 1V05A 3QRFM 3H9HB 4M3PA 2W8CA 3FT3A 3SY0A 1TUXA 1U58A 4HJ0D 2NMSA 2BIOA 5G2HA 2XKUA 4OD3H 1UJ3A 1ORQB 3EADA 1C29A 1JHLH 1TV7A 4KKLC 3NT0A 5ENLA 4LSDA 5GGSY 1DVUA 2GBVA 2R69L 2QJNA 3M7FB 3RFZC 2BSLA 2TAAA 5CEZL 3RVTC 2EICA 5I15H 1SYTA 1JD9A 3FJNA 3BH9A 2WLLB 4WCYL 1ACYL 3FU6A 5A43C 1M7XA 5DRIA 2PPDA 4XP9H 1ORSB 4FMKA 1CI5A 4P2QB 2X0WA 3GPEA 4I18B 3OMZA 1DEEB 5DZJA 1PLCA 3IMUA 4MOZA 4ZUVB 2UVEA 1K03A 2H1PH 4CADA 1Q65A 2RDXA 4HNCA 2HTKD 1CT5A 5D7IB 4HDIB 3EYOB 2BOBA 4ZPTB 5GRJH 5JLZA 2HCVA 2ATMA 4HB7A 2EIEA 4JN1L 5IGXH 2XA3A 5EMMA 4UT6L 4QXUH 4QHPA 1Z7AA 5JPMA 1G9NC 3QEGH 1ISZA 3K8MA 4Q8QA 3D0CA 4AEIH 5LXGL 4O9HH 4JRXE 3C5SA 4U1HA 3B7TA 2IPKA 5DWUH 4HWBH 4DJMA 5GRXG 4WWKA 3PSVA 4BELD 2GBAA 2G60L 2AHIA 1Z5YD 4HEPG 3SGKC 3LPFA 1A6VL 3O0RL 3KOYA 2FBJL 1SDDB 1EEXA 1UM4L 3MVTA 3HS0B 4CC4C 4PY8I 1R9YA 1WHOA 3URQA 1CLOL 1A5FH 2IGTA 5F72S 4XHQA 5A2IH 2BVUA 2OODA 4HJGB 5F7LB 2AK1L 4B7LA 1BG4A 3F7YB 1JMZA 3DKJA 4WQ6A 2V63A 3UADA 2ZKXA 3UU0A 2C8NA 3MKGA 4NRXA 2FFIA 1YMYA 5I0YA 4RFEB 1OCQA 3K6SA 5IBTL 5JHLH 2VFFA 5GGQL 4AQ8A 3LRLA 3DIFB 5HDWA 1GG1A 3KHDA 4Y4KA 1JI2A 3KZ8A 1ZA3A 4J1OA 4WK2B 1YY9C 1KCSL 3RPIA 3QSRA 3HG0A 5C9JB 4J2QA 2J7GA 2I9TA 4Q8UA 1NCBL 5D7KD 4DKEH 5BJTA 3RVVD 2NY7L 3GSNH 1PZ1A 2PI6A 2FECI 3NSJA 1QNVA 1YAIA 1E9ZB 1KYDA 4EIBA 4K0OA 2CLZA 2YPIA 3ZE0E 1B4LA 4MWFB 5IW1A 3R4RA 4CD6A 4IGBB 3ARBC 4YSTA 3BCJA 2VZOA 1YADA 4ZYKB 3A4EA 3TS8A 3MV8E 5I1IL 3NM1A 5E6ID 2ED6A 2JCCB 2OT0A 1ZT7B 4P5SA 1XBXA 4N0CD 3X11A 2MPAH 5DBUA 4FIQA 2PLMA 5J9PA 3T0XA 3MRJA 4MAZA 2DV0A 3NAAH 4IHCA 2VZVA 3WNLA 4JFZH 3L7EB 5IFPA 4NIYE 3DGDA 2RGSA 1JZDC 4QSHA 3CUHA 2IEPA 3JUYA 4WHDA 3RJXA 4PJ8B 3ZKMD 2AJ3B 3SRHA 4S39A 1FRBA 4DEPB 1JOIA 2GSHA 4C56E 3M0KA 1LGVA 4QE4A 3QAZB 5GS2D 4PYGA 1CG9A 1EP3A 1XZWA 4H25B 1RERA 1ZHKA 3D3VD 3QJHA 2FATH 3U2SA 5LBVA 2ALDA 3IEBA 4AEEA 3UWZA 1FVEA 3L65A 2H0EA 4RPQA 5HHNA 1LXMA 2FJGA 1SZGA 3CHEA 1NWPA 5CD3A 5GISH 4I5UA 1J9CT 1UMLA 3NO3A 2OFQA 2P44B 4ORGA 2KZHA 3LD8C 1PG7X 3L5HA 4HVBA 1VACB 4A7UA 2UWEA 5KSUB 2HXUA 4HWEH 4X5WB 1CO1A 3MLPA 2NY0D 4ATWA 1S2TA 3MNWB 1PD1A 3ANYA 5ISZD 1F3JA 3VTTA 2IKIA 5IV2B 4K8EA 4ZXBA 1K8CA 3ZL4H 5ABTA 2DSWA 3ULUC 2QR6A 1U8QB 3S96A 1BEUA 5MKGA 3LGEA 3NJIA 2NCMA 1H8NA 1KB5B 1L9OA 4P5RA 4KWWA 1I9EA 1LRTA 5A2BA 3UW6A 3ZKXC 2DM2A 3WL0A 5DLLA 3QCUL 4ZI8A 4AD5A 5I1KH 1UURA 3EKZA 4GW1A 4HS8H 2YUWA 3U4AA 3EGXA 2GFBA 1AE6L 4GMSL 5GSRA 5KSBB 2I26N 3L45A 4AY7A 2Q8AL 1GUVA 1N12A 4QJ3B 2EPNA 2YW4A 4KQ3L 4M7SA 1E42A 1PVNA 3HVNA 2HLFC 4I0PD 4M4RA 1HJVA 4R7NB 1SW3A 2RQEA 2MQGA 4LB8A 4M7JH 4FADA 3JWNG 3LRSA 3WBWA 2XHNA 1UMYA 2V7HA 4DP0X 3EZ4A 4HKXA 5DZOA 3S1XA 4LW7A 3WLTA 4UTHA 4A05A 3NPZB 4FJZA 1FKXA 1N0LA 4WDIA 1VENA 4YAQB 4L1TA 3GHBL 4CDHA 1XGTB 1Z9SA 1F76A 1YDYA 2P80D 5AVXB 1KJ2A 2I27N 4KBXA 1OG0A 4KXZI 2HEJA 2VDMH 4AH2A 4W1TA 3H7BA 3HZKA 3C5ZC 3N18A 3QZWA 5KS9F 1KCUH 4DQOH 1SOXA 3HI5L 4UTAH 1U95B 2CRZA 5GGVL 2WZHA 5H94B 4XZNX 1OE2A 4A6GA 4QRUA 3OPZL 4JZJB 2BTMA 3UYRH 2ZAGA 1QEWB 2Z4QA 4LVAA 3WBDA 3L5AA 4ZMTA 3A23A 1PSKL 4AC7C 1KYAA 4Z7VF 4PY7B 4L3ED 1A5MC 3IK2A 1NANI 3GEFA 3PZTA 2Z9TA 4AD1A 1WB0A 1AKPA 3BKYL 3SGGA 2HS8A 2PWGA 3CDZB 4W89A 3K2KA 2H1XA 3IGAA 4JAMA 3MJ7A 4PTUB 4OCRH 5CJOH 1CDHA 1Q8AA 4IF2A 3WLMA 3WY2A 4OZHB 1F58H 3M64A 1J8HD 3AUWB 4N2YA 3TO4C 1JTOA 1WA2X 1BVKA 2I7GA 2FGWL 5HYJB 2G3ZA 4LOFA 4M7LL 3NJXA 1S7RB 4KBPA 3E1F1 3HPSA 4OD1H 4TUFA 3QJTB 4RLDA 2WMPB 4JFQB 3LN5B 2X4OB 1OWRM 5H37H 1AMXA 1H3UA 1RH8A 2AVFA 3NFPB 2XGBA 4N2KA 3ZTJH 4R4FH 4UWMA 3EX1A 1P7BA 3WEOA 4DNMA 2ZKYA 3AB0C 1V3IA 4BF9A 4N02A 5AOMA 4TYUA 3LZPA 3ARWA 1D5IH 1D8WA 1EJSC 4M1GH 2BNQE 1KTRL 4J6RH 2H9AB 1CFVL 1XBZA 1QSEA 4K7PL 1A5KC 5B7EA 1GEHA 4YUEH 2CBJA 2YMTA 1IBBA 2RUSA 3GDTA 1GQIA 2DQCL 1EGJL 5F0JB 1NFDF 2VIRA 2AXHA 4OF3A 1E3FA 3NACL 3T0ED 5CAKA 4I0KA 5FAJA 5BV7C 1SGKA 3C9NA 2XIOA 3LIZL 3P4LA 3EUDA 3N1PC 1Q38A 2AKRB 1JVOA 4O00A 4PJ9B 3W0KA 1WTLA 4YFLI 3GF8A 5FW6A 2FCBA 3K6IA 1SM3L 4PBGA 2UV3A 3FTUA 1T83A 4ECNA 4DZ8A 3GBNL 2XV3A 2XA8H 3OA5A 1SF5A 1CU4L 3E6EA 2A4ZA 1R2TA 3G6MA 3LGGA 3CVIH 1ICTA 3WMPA 3CSYB 5C09A 2DQ6A 3FTXA 1ZAGA 1HKLH 1JCKA 1BWLA 1JP5A 1JK8A 5IBUG 3GUGA 3TCXA 1YC7A 1H62A 4L4LA 2EXOA 4ELMA 3RWIB 2E40A 4ONFH 1F41A 2YAFA 4B9YA 1IC4L 4CD5A 3UZVA 3E2QA 2ZXAA 3GFYA 1WAEA 4DAGH 4HUUB 1OB1B 4D9RD 1EUUA 1Q0EA 9PCYA 3BUYA 1LO0L 4ILDA 5A1AA 3VXME 4KTEL 3M86A 3C6EA 4NUPA 4XCFL 2YC1B 1N2RB 4OLWL 4NJ9H 5MERB 3DVNA 1PNDA 3EJUA 4K5OA 4OY9A 2IS7A 2VSDA 2CLLA 3IGKA 3C8KA 4XT1C 4FZEL 3G6AB 1OFOA 1HQRB 3MSGA 3KFTA 1IXOA 4LCIH 4GYBA 1S5TA 1X6LA 1E5BA 3Q2WA 2HKAA 4Y1AA 2HPTA 4X5PA 3OXSA 1Q7ZA 3VE0A 5FOBA 4CD7A 2V7NB 5C0GB 2X12A 3UTOA 1CW2A 5T1LD 4FX7A 3BP4A 2O93L 4C7FA 1UADC 4Q9CA 2ZF9A 5AZEL 3WFZA 2NT1A 4N9OB 2EDDA 3PTKA 3VMPA 1F8MA 3O11B 2EJAA 1LE9A 2A6NA 3EEGA 5JIKA 5CD5C 3N50A 5I9QC 4BKLA 2H3NA 4D0CB 1WAUA 4KJQD 2ZXGA 4JHBA 5IB1B 3STBA 2CHWA 3W85A 5FGCE 3X3GH 1KXVA 3SQRA 1X5YA 3H42H 1DIOA 1QLRA 2B31A 1QASA 3B7SA 2DZTA 2ZUYA 4MAYB 4LVDA 4A21A 4LUSB 1DE6A 4ZS6C 1P5UA 3QNXB 4ABWA 4J1UA 2CXEA 5JYLA 1XVSA 1KJMB 5E8DH 1XFCA 3MOBL 4G80A 2R29L 3D8MA 1IU1A 4HHWA 4FP8L 3BZEA 5KEZA 2D31A 3RLVA 1IC0A 2QJMA 5F2FA 4RE2A 4H8WH 1OGTB 3U4KA 4YHLH 1TVHB 5HHQB 2G75B 3A47A 3OTRA 4F8PA 4W9JC 2O0TA 3WLJA 2ZYIA 4M5SA 3FT4A 3KPSA 5BRBA 5FHBL 3FQ4A 4IJTA 3SHSA 2BXYA 3QYCA 5E23A 1BF8A 5HWJA 1HAUA 3HIJA 4HG4J 3WQ4A 4EI5D 3AZRA 2G5BA 4UM8A 4LIQL 4OUUB 4HGXA 5LKNA 2EDJA 3T0DA 1BFNA 5CIPA 4FQHA 4YLBA 1CNVA 2YPKA 2IQAB 4F9LA 3PTQA 1P69B 1E4XH 1YEJL 4YBQC 5GJMA 1NGQH 3WKMH 1XCQA 1E6QM 2NCEA 4KEMA 5E2TL 3E2HC 5DJXB 3S3DB 5LGJB 4AEOA 3CVHB 1SJXA 4BK5C 1KRCC 2OI9C 3HGOA 4XNDA 5C0RL 4J8RB 2F9BT 5C9WA 5FIPA 3FU8A 1FZKA 3GSUA 4LSSH 1QLEH 5DJZA 2TSBA 1WEJH 4F40A 3L12A 1T4KB 4CILA 4UNKA 1MCJA 1MJJA 3QQWA 1RBOB 4H1LH 4G6AD 1K3IA 2O1AA 1E6JL 5GRVL 1MWOA 2ITFA 1FWDC 1R1CA 1HHGB 5GGUA 4F3FB 1MG3C 3I2CH 3NZRA 1ISYA 5E6SB 1H9VA 5KTEH 5D7LB 2GDQA 2BIIA 4FI4A 4UMCA 1G9NL 2NY5H 1MCWM 2ZTBA 3N11A 1MHCA 2PLTA 5EA0H 4R53A 1PZUB 1OAXL 3LHYA 5FCZA 3FSTA 4PB5A 3TA3A 4OQTA 3GZ3A 4N2HA 3WLBA 3A6OA 2AQQA 2PN5A 5CPNA 5HQMA 4RQQA 2AQPA 4AHQA 4EJ1C 3HG1D 3FT2A 3MX0A 1KLFA 4IFKB 4GQ0A 2QGYA 1BFVH 2N3JA 5AL8A 3TLLA 2C1IA 1TE1A 3GJFH 2DBLH 4AUJA 2QCLA 1R3HB 3OEXA 3BANA 1MNUH 3US1A 2PDGA 5CG0A 2DWTA 4ZOEA 4BRVA 1QNQA 3HBPA 3PHQA 2O56A 3LQAH 3CVBA 1SN2A 4MWAE 1KWKA 5BOOA 2N7BA 1ZLEA 2IVFC 1IGJB 3C6LA 1CGXA 3V7MA 1FOBA 3BXNA 3W72A 1ZJIA 1E5CA 2V69A 3OYZA 5HVHC 3H2EA 1TV2A 2IPWA 4D0DB 3SE4A 3FDGA 2FYMA 3L21A 4KROC 5EZPA 1J8RA 4JVWA 3FVDA 5CJ8A 5EMUA 2WP3O 1P7KB 2DQUH 2VXTL 3CZEA 3KM2A 1EEYA 2FWOB 2Q8LA 2X4SB 1GPFA 5F7BA 2CMRH 5GS3A 4D9PA 5DXXA 2PGRA 3R8BB 5K4ZA 1KTKE 2CGYA 3Q4DA 3QEHB 4XNYH 2DZWA 4JZNA 3DX6B 3AWGA 4PJCE 3WHE1 1D3HA 3LNPA 5A6BA 2C9AA 3BO8A 1DPMA 2VC7A 1WFTA 2YL9A 3IKKA 4N2GA 4U4IA 2OTWA 4XBGB 3LEVL 2X0HA 1NFGA 3ZZQA 4FCAA 1M41A 1EXUA 4NZRH 4YYCA 4JREC 1K5NA 3I74A 3NCOA 4PA8A 3CUXA 4NDMA 1K8DA 2W80C 3S98A 1O4UA 5F4SA 4NP4L 2VX5A 2P50A 3T6CA 2X70A 4H40A 3VKJA 3QJQB 3MYJA 3EB2A 1E9LA 1H3VA 3S2CA 3O6DA 2ESVA 1RVKA 5A8PA 1V02A 1JGUL 2CJUH 3AS3A 3I6LE 1HCZA 2BWGA 3O3EA 3HAEB 3BLOA 2GWGA 4NQCD 5C0AA 4K15A 2W66A 2FX8H 4H8NA 5FL1A 2D4DA 3VFWA 2IDTA 5HAOA 2E6FA 4ZBJA 1KJVB 3L6FA 4V33A 3MCYA 1A5BA 4LALA 2PWEA 1IIGA 5DC9B 2O6EA 2BINA 4S1RH 2CBMA 1CFQB 5KSVB 3LCHA 1NDGB 5M5DA 1PCKA 2W88A 2PCQA 4PJ7E 2QL1A 3U9IA 1M1XB 4PYSA 3K46A 5AVSB 4UQEA 1GVIA 1N55A 5ACLA 3ZUNC 1DWHM 1WXYA 1KLGA 3SDAC 1CWVA 2VOMA 4ZL1A 3BHBA 1PEWA 2WMJA 3RDJA 2Z92B 3P5ZA 4MS8C 4H8QA 4MMZA 3QGKC 3NFNA 1U8MA 4H5SB 1JV5A 4ODVH 3Q8CA 1ROCA 4AJYV 1SUJA 5K93A 3D30A 5TGBA 2DBJA 3TH6A 1UR4A 3EJPA 3M9YA 4Y4FD 2VDLL 2CZFA 5DD0H 4XB7A 1AP2B 4JFPA 1NGXA 4YO0B 2XVKA 1S9WB 4Z7NE 2AV7B 7REQB 3EYFA 3FTVA 1SBSL 2BIPA 2ZRVA 2KH2B 4L0YA 1U8PB 2C9SA 1JSYA 3KZSA 2KC0A 3TIDB 3EB3A 4HN8A 3I4KA 5CHNB 4P8UA 4K9EC 3MMEB 1OBAA 3VQ1C 2BWIA 4R34A 3W6MA 3DXAA 1T0MA 4P48A 1WKYA 4C55A 3FU5A 4KY2A 5KG9A 3U57A 3FQRB 1NAKL 2Y25A 4D72A 3QWQB 3GDKA 1RK0A 1U8NA 3OA3A 1QFWH 3VFGH 5FUOL 4MQXD 3GNRA 3ILPA 3W5MA 3TTOA 4UR7A 3LN4B 4IP7A 3FXYA 4M7KH 4EQ3A 2QADB 7XIMA 4XR8C 2CZDA 3F64A 3BI9X 4P4KC 4XD5A 3OQ8A 3VSUA 4K5LA 4CNSA 2ABAA 5AW8B 1AGBA 3W0WB 2J8TA 3CMGA 5FOOA 5MEPA 3O8XC 1E8WA 1F18A 2XPGB 3SE8L 3W53A 2V5LA 1G6RL 3HFFA 4Z3GA 4AF0A 2PDXA 2BDNL 3SI9A 3OXRA 3TFBA 2C6QA 3PGDA 2JI3A 2YSTA 3IMRA 1DWIM 2IDCA 3BWUF 2YPVL 4NKIH 5SX5H 3L08A 5KZCD 1QOQA 1RUSA 3DV4B 3QHFL 3QISA 2PABA 3UBFA 1LWHA 1YSOA 4NN6C 3PFUA 3VYNA 3T8XA 2WMIB 4Y9PA 2JV6A 1FH9A 2AAMA 4FGMA 4IQJA 4UCFA 3QXBA 4R9HA 2YAMA 3H2PA 2EPKX 2PDQA 1RVFH 4YWIA 5EZJA 4PMDA 1IAOA 4WFHD 4DH2A 3N9SA 3GR7A 5C6PB 3I84A 2WLJA 1UPMB 5JZ7D 2DVTA 3DVGA 2CDGA 4GW5B 5TTRA 3IPWA 3DFHA 5AW1B 5EOQL 3A3XA 1IGML 1MAJA 4WV1B 2FHBA 3ARDA 4E5XB 3MKVA 3OBKA 1GS6X 2Q8BH 2IOIA 5JYMA 4HIXH 5E56A 2ENQA 2PW1B 5EMJA 2F54D 4PL2A 3P81A 3MLWH 1INQA 4WWKD 1X5FA 2FTPA 5EN2A 3RPBA 1DANU 4L9ZA 5ACZA 1AD0A 2CHOA 4BQ4A 1JG9A 3NPVA 2OMYB 3I9PA 3GB7A 3ZMNA 3O07A 1HDMB 4OZIF 1UBSA 3MV7E 3FYIB 3ZDWA 2J25A 4NC1C 2C7UA 4LLWB 1OC7A 3OW1A 1CENA 1DSYA 4C4KO 3EYUL 2XZCL 4H8UA 3RVWC 3AWNA 3W9ZA 4NU7A 1QOPA 5D6CB 4XH2A 3VGHA 1XB3A 2JELL 1XZ0A 1NWTA 1WFJA 4NQDE 1P6BA 1T1YA 4Y4KD 3JRKA 4WW2F 1FCQA 3WLSA 3RNQA 1JNNL 4RR4A 5IB3B 4H2AA 5I74B 1SJVA 2J1ZA 1W1PA 4DVOA 3TIEA 1XQ4A 4WI3A 4FXGA 4X6BA 3SPVA 4JEJA 3N44F 3LAFA 5AYXA 1FJ1B 2J8UF 1W6LA 1RUKL 3ENLA 1BKHA 4TO8A 5CCHE 4PRPE 1AZZC 2F8IA 4N90D 4OCWL 4M62H 1QFUH 1P7QD 3WELA 2ZPKL 3R8RA 4F7PA 1LK2A 4ODWA 3STLB 3X3FH 4CN4A 4MMXB 3VD7A 3RX3A 3B04A 2JIXD 4DGVH 4GP4B 3TT1L 4HHAA 4OR1A 3VWJA 3UTQB 1LOQA 4NG3A 3D5OF 1BM7A 5DUBA 2HJKB 3VXRD 4F66A 3HE6C 3FTGB 4IBWA 1S7TB 1NCGA 4WF7A 4GRWF 2DJLA 3KXFA 1WBJA 3N3TA 3L68A