3L4WA

Crystal complex of n-terminal human maltase-glucoamylase with miglitol
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
total genus 270
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4wA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4wA01
2YA2A 2E3ZA 3T08A 1MVYA 1WZLA 3LXAA 1BGAA 4NRRA 1V6UA 1IT0A 1JZ2A 3CMGA 1KTCA 1O6IA 3WL0A 4YHEA 3SCTA 3FXYA 2Q8XA 2V3FA 4TTUA 2OWCA 1E40A 4DO4A 4P7OA 4U5IA 1MYRA 1XD0A 4EANA 3AYSA 4IISA 2D0HA 3ZT5A 1UD4A 4HA3A 2W63A 2BS9A 1CIUA 2PWEA 2BHYA 3HG5A 4AD5A 5BXTA 2DH2A 1OINA 1J0IA 4FK9A 4E4PA 5DFAA 2GJXA 5CG0A 1OT1A 1B9ZA 2RGMA 1ZBCA 3GH4A 3WFZA 4JKLA 2J8GA 4N0RA 3GXNA 3VSVA 1BPLB 3LPGA 4BQ3A 3TTOA 1AQMA 1R75A 3ARPA 1HJSA 1TR1A 1XH1A 1J11A 2BHZA 2AOSA 3L2MA 4J3UA 3VSUA 6A3HA 4H8HA 4BQ5A 2C0HA 2FDMA 4HU8A 3OA5A 4ACZA 3IJ8A 1VB9A 1QI5A 1E15A 2OYLA 2ZUVA 3KL0A 2FGLA 1QI4A 3H55A 5A8NA 2A3CA 1JGIA 7CGTA 1JYWA 2YL9A 1CXEA 2YFOA 3A4AA 5FL0A 4HPGA 2PBGA 1HJWA 4D6JA 4QLJA 2VO5A 1PCPA 4OBRA 3U5YA 1N82A 1GORA 1DWJM 1CGXA 1OBAA 4QLKA 1WCGA 1HTYA 1V6XA 3IAQA 2DPEA 3BCFA 2BY2A 1R8LA 3ALGA 2NW0A 1V3KA 3HG4A 3ZSTA 1DWAM 4QCFA 2W61A 3SCNA 2NSXA 3RJXA 4B9ZA 2ZOXA 4M24A 3NJ3A 1H41A 3A4XA 1HVXA 2BXZA 3CZ8A 1TQVA 3GXFA 1BYAA 2XWEA 2EAEA 2VZOA 2WPGA 4MAZA 2XN1A 4RE4A 5CPSA 4W87A 3EDKA 3WH5A 4J3TA 2ZUMA 5IDIA 4UCFA 1JZ8A 1VFFA 5A6AA 5IFTA 2CNCA 2VX6A 2WKGA 4AISA 4JL2A 1JZ6A 1J0HA 1CPUA 3BC9A 3BAKA 1K9EA 1NARA 2EABA 5CGTA 3GNRA 1UR8A 2CIPA 4TOQA 4LYRA 4CD5A 2YBUA 4TUFA 2WBGA 3SUTA 4MDPA 2PC8A 1MFVA 2D20A 2QMKA 1OM0A 4GXPA 5M03A 5ABEA 5A2AA 1J0KA 2EQDA 2ZXBA 1PS3A 1EXPA 3M6DA 4UQDA 4PMZA 4W89A 1KCLA 1HP4A 3W53A 4RL3A 5D9OA 1RP8A 3WBAA 3B8SA 4UOJA 1UR9A 1E0VA 4ATDA 1W2PA 4CUCA 3MV01 3LPOA 4D72A 1UD6A 3ARYA 3WUFA 1GPFA 3CHCA 2GDUA 2CBIA 2WHLA 1E9TA 3VM7A 3L4UA 1UR2A 2VZTA 1EGZA 1VEOA 3ARUA 1W9VA 5BRPA 5A6BD 4V2XA 2GFTA 4FNPA 1V0LA 3WUBA 3VIMA 4GZIA 2ZUSA 4OZOA 1EHAA 3TTQA 2VJXA 3AXIA 2BFGA 1CXKA 1TG7A 4LXFA 5FIPA 4LGXA 3HG2A 4S3KA 3W28A 4AZHA 4B3KA 3W38A 4HZ7A 3UESA 2B31A 2VZVA 1UR0A 3ZR6A 1CXIA 1UKSA 1C91A 3H53A 3SURA 3EYPA 4AEFA 1R34A 2J7GA 4A4AA 2RGLA 3L4XA 3NCOA 1UD3A 2VR5A 4H7VA 4JFUA 3CZGA 4PSRA 4UZUA 2CITA 1LJYA 3ALFA 3WMCA 4M8UA 1E6NA 3PZIA 3N13A 4JHZA 3CIVA 1JAKA 1PSPA 1TVPA 4H04A 2XTKA 1ISYA 1QW9A 1HJUA 5A6MA 1K9TA 3THCA 1HL9A 1H11A 1R47A 4W5ZA 4TX6A 2XIIA 2DT1A 2CBUA 2DT0A 2F7RA 3VU2A 1JD7A 1HKKA 2WCSA 4M29A 1H5VA 5A6SA 1E56A 3EDDA 4QDMA 4ZXLA 1CLXA 3WF1A 2BXYA 4H8UA 1KXTA 2WK2A 2XM2A 1KQZA 3KZSA 4PMNA 3BUDA 3WKZA 1MWOA 3AHXA 3IANA 3WSUA 4B9YA 1XSKA 5HDRA 5GPRA 1BSIA 5I5RA 1JDDA 1C93A 1LL6A 5BCAA 1V0MA 4J3XA 2JFEX 3CTTA 2D23A 1M7XA 2E9LA 3EBVA 5A8QA 2E8YA 3VX1A 1OGSA 5C70A 3WL1A 1V02A 3N11A 2PBOA 1ISXA 3CZEA 1WDPA 3A23A 1FH7A 2UY2A 1G5AA 1UZ4A 3APGA 1BYDA 1EOKA 4C7DA 1U30A 2XVGA 5GNZA 3CO4A 2VOTA 5AY7A 4MB1A 2Y24A 1EDGA 4FLQA 1GVYA 3LRLA 2VTFA 3A21A 4AYGA 1XSJA 2VVSA 4ACYA 2CCRA 3WF2A 4BZYA 3CV5A 3UCQA 2Y8KA 1MXDA 1A47A 2J7EA 1UYQA 1UQYA 2EPOA 1O7AA 2TAAA 5KEZA 4MB4A 1V0KA 1H4PA 4LX4A 3D5HA 2WVVA 4W8BA 2BY3A 3ZJ6A 2D22A 3CZNA 1PBGA 3T2OA 3EJRA 2WBKA 1JI1A 1TZ7A 2WZEA 2GVYA 3VSTA 1W3JA 3ZR5A 5BYWA 3WD0A 4CN4A 3KEHA 1G0CA 1ZBWA 2QLYA 1XYFA 4B15A 1OWQA 4KH2A 1XSIA 3T2QA 2YA0A 5I79A 3AMLA 3PZQA 2ZICA 5CQ1A 1VFUA 3ARVA 3EJQA 1WE5A 1ZB5A 2J25A 3LMYA 1XD1A 2E4TA 4OKDA 2YKKA 1NWRA 2IXVA 4KGLA 1UKQA 1BTCA 3WELA 1DP0A 4CD7A 3HG3A 3WQ5A 3VD9A 3WH8A 3VD5A 1QPKA 2Y5EA 3PTKA 4MB5A 4F8XA 1B3WA 5AYBA 1BHGA 3EMCA 3PTMA 4ZE4A 2CBVA 5GQBA 1K9DA 1X6LA 3AMKA 2A3HA 2AAAA 2W5FA 2WVTA 1CXHA 3WNOA 4W7UA 1M01A 2X0HA 3UETA 4EAMA 3W6LA 3CUGA 4W8AA 1TCMA 4P8VA 1B3ZA 1UA3A 1UH2A 4GZEA 5D9PA 3ZSSA 5HNNA 3IGUA 2C8NA 1FP9A 4D6EA 4NSBA 3SCUA 1V3HA 2DSUA 3VD3A 4WJXA 3WEMA 2XGBA 3DDGA 3CC1A 2EO7A 3OLEA 2J7DA 5A94A 1CGVA 1J12A 1AQHA 4AD0A 3W27A 2JIWA 1PS2A 1ISZA 5HBFA 1E55A 2ZUUA 4EKJA 1VIWA 2JE8A 3MANA 2JEPA 2CHNA 1E6SM 4MNMA 2DSWA 4WSKA 1GOIA 1V3MA 3ZO9A 3WH6A 5GNYA 4E8DA 1NWSA 4JFSA 4HA1A 4DWSC 2JF7A 4KRUA 2XVLA 3FHQA 2J77A 4PTVA 2WMKA 1V0NA 4V28A 3VDCA 1GQKA 4JFWA 3I3DA 1MW0A 3VUPA 3MSGA 1VEPA 3ARXA 3PZTA 1UG6A 2XSBA 4MNJA 1M03A 4WKHA 1W9PA 1LL7A 1PX8A 1QNPA 4AMCA 3BVVA 4W85A 3DDFA 2WMGA 4PMDA 3FHAA 3N18A 4GQQA 5HPCA 2G8ZA 2X2YA 4F79A 2CKRA 2WM0A 4PMUA 2A3BA 4J3VA 2WC3A 1B3VA 1OIFA 1QNQA 2D3NA 3W81A 2XVKA 4FNUA 4UQBA 2WYSA 2OSWA 3K4DA 5BXRA 3VKKA 1D2KA 1HJQA 4AMXA 1US2A 1E4NA 4YPJA 3ARRA 1E0XA 1KR1A 1HKMA 4UFJA 5EB8A 3RIKA 1PX3A 3VOCA 1Q6DA 1E1EA 4PTWA 4FNQA 4W8LA 1VENA 1VBUA 3MV11 2OW7A 5E9AA 4XB3A 2BVDA 3AYRA 4FF5A 2ESCA 4J3SA 4DWSA 1E9LA 4X9YA 2WCAA 3DX0A 4D6HA 4XUYA 3WY1A 3U7VA 4E2OA 4Z2KA 3U5UA 1SZNA 4GI9A 2O9TA 4AYSA 4CD4A 1JDCA 3OGRA 1M04A 5A2CA 4N42A 1K6AA 2XM1A 2JIEA 4AIUA 4W84A 2UWFA 2FHBA 3VGFA 3KE0A 4OOZA 4P8WA 1GHSA 3QHMA 2OYMA 5LA1A 1EHNA 1QBAA 1RD6A 4PUEA 2IXUA 2VX4A 3QHOA 3AROA 5LA0A 3MO4A 2OWWA 3WIJA 3AS0A 1NOUA 3WF4A 1BF2A 1US3A 3GXMA 3AIRA 1QOXA 1PX4A 1W3HA 3AI0A 1B30A 1ZBVA 1XH2A 3A3HA 3GYCA 1NP0A 1TA3A 2WANA 1KTBA 3L2LA 1EDQA 3SCWA 5IXEA 4P8UA 3GXTA 2W66A 1QW8A 2G3NA 1JYVA 3AS2A 5I78A 4HOWA 3BGAA 4LYPA 1UOKA 3K8LA 2DH3A 3PZMA 2WMFA 2UY5A 3VIJA 3L4VA 2V3DA 2PI6A 3VDAA 2VCCA 3RM9A 3WEZA 2WWDA 3VNYA 1E1FA 3GTNA 2V5DA 5M3WA 4DM2A 2J8FA 4CU6A 4D6FA 3BAJA 1JL8A 1PAMA 3DHUA 3SCQA 5DMYA 1ZU8A 1E6PA 3GXPA 3LX9A 4AD3A 3AS3A 3MMUA 3N9KA 1PPIA 4CVUA 1KB3A 4NZCA 5BROA 2ZUNA 1W9UA 1UKTA 4GO9A 1JZ5A 1GOQA 1EDTA 3MMDA 5DEZA 3CUHA 4NZJA 1HX0A 3CPUA 3WQ8A 3BXWA 3CZSA 2WMHA 3H54A 2ZX8A 4KRTA 2VVNA 2XN2A 1W9XA 1YHTA 1DHKA 1PEZA 4MJ4A 3L4TA 3POCA 3QOMA 2CYGA 1GOMA 1OT2A 3AQUA 3HU7A 3AMGA 1MQQA 5HOSA 3CUJA 1JG9A 4UFMA 3I3BA 5LYRA 1OB0A 3T0AA 4WIWA 2ZX5A 2PSPA 2J78A 1XCXA 2WWCA 4F9JA 1G01A 4BS0A 1FP8A 1WZAA 3GDBA 1OCQA 3K1DA 4WKFA 2X05A 3WQWA 5A8PA 4UZSA 1ISVA 4GIAA 4Q22A 3SIMA 4BA0A 3NSMA 4Z2IA 2DSZA 1UASA 3BVTA 4PSPA 1CGUA 1DWGM 1I1XA 9CGTA 1H09A 4CCDA 1XV8A 1JXKA 2DT2A 2X09A 3SUWA 1ECEA 1MQRA 1H2JA 3BVWA 4EE9A 3ZMRA 3VO0A 4JAWA 3K8MA 1SMDA 4JFTA 3LXBA 3RDKA 1FHLA 2W4XA 1UD8A 1L8NA 3M46A 2VUYA 5E0FA 4B3LA 4M1RA 2D0GA 4QAWA 2QF8A 3VMNA 3T0DA 3OBAA 1PE31 2VX5A 3ARWA 1VJZA 3WF0A 1UKOA 1OD0A 2X2HA 5JIWA 2UY4A 2VC9A 2DDXA 2VI0A 4GI6A 3MUY1 4J7RA 5I2UA 1XHGA 1LL4A 5FCZA 4KGJA 4U3CA 3SEPA 3OG2A 2ZUTA 1LQ0A 4PCSA 4JKKA 3WFLA 4W7WA 3L4ZA 1JXJA 2BVYA 3GH5A 4MDOA 3GBDA 1NWTA 2W92A 3LPFA 4OJYA 2XSAA 3K46A 4M56A 3VILA 4MPKA 2ZIDA 3KLKA 2YOCA 4P7RA 3CZKA 4P8XA 2VRQA 2OYKA 1OIMA 1Q6CA 1JZ7A 3GZAA 3BAWA 3U57A 4OGZA 2Y2WA 3TOPA 3OZOA 4CN1A 2Z1KA 4Z2HA 1B1YA 1UWTA 1B3XA 2J4GA 3POHA 4V27A 3UERA 1XRVA 1W1VA 1YQ2A 3MS8A 1HVQA 2YIHA 2O9OA 4OUEA 2X8RA 1VF8A 3AOFA 1HN1A 1PZ3A 2VZUA 1V3IA 4PTXA 5I24A 3UR8A 3LRKA 2YLAA 1JFXA 5ABFA 1ZS2A 2VNCA 4NI3A 1GOKA 2WMJA 1WAWA 1CENA 2GJXB 3IK2A 2X2JA 3HJEA 2E0PA 1E6RA 3A5VA 4E8CA 5C71A 2CERA 4XV0A 1CYGA 2WMIB 4U2ZA 1WZKA 3D52A 3ARTA 1W9BM 5TD4A 4BQ4A 3O6AA 2WC7A 3VINA 2FHFA 1D7FA 2FH8A 1HL8A 4WKAA 1J0YA 5A2BA 3CHDA 4JKMA 4ACZB 2D0FA 5D9NA 3PTQA 3W82A 2BY0A 4W88A 3NYDA 2QMJA 1I75A 4KWUA 2JF6A 5I0DA 4PMRA 5JUVA 4QFUA 1FH8A 5JBDA 4AD4A 2J7HA 2WVSA 2XUCA 1EH9A 4D1IA 3DX3A 3TTYA 2EPLX 1B90A 1ZJAA 2DIEA 1ODZA 1PZ2A 3A22A 2VMFA 4NXKA 1HIZA 4PN2A 2PWGA 3D4YA 1QHZA 1S46A 3PZVA 3CUIA 4MJ2A 5ABGA 4X0NA 3DX4A 1BVNP 2ZXQA 2VL4A 1UH4A 2J7FA 5CSYA 2EBNA 4MAVA 1KGXA 1QNRA 3KL3A 2GDVA 4WK9A 4AW7A 5M17A 3A4WA 3I3EA 4F66A 4MTVA 3SUVA 5A6LA 3E1F1 1EO7A 4ZEPA 4JL1A 4P7NA 5CSUA 3BUQA 2DGAA 3SCPA 1SMAA 3VIPA 3AIWA 2F18A 3FW6A 3D4ZA 2DEPA 3NDYA 1E72M 3CMJA 2GK1A 3WNPA 4AIOA 1GNXA 1R7AA 2WCGA 3VPLA 4AZCA 3OLGA 3RJYA 3BCDA 1XGZA 1EO5A 4TTGA 3VIIA 3M7SA 3PBGA 3WMSA 2XFFA 1T0OA 1UUQA 5DF0A 3W6MA 2UY3A 4MNKA 2VURA 4AXNA 3L4YA 1E71M 2WSPA 2XFYA 1Q6EA 3DX2A 3F5LA 5EMYA 1GOWA 1VRXA 1BQCA 1GJWA 2VRJA 4C7GA 4MADA 1DTUA 4GPNA 3QHNA 1V6VA 4DUWA 4H2CA 3RM8A 4RE3A 2BV9A 2ZWYA 1HXJA 2WC4A 2Y4SA 4CU8A 4UQEA 5BXSA 3WD3A 3A6OA 3AIQA 1JDAA 3QGVA 4WF7A 2J47A 5IFPA 1UA7A 3CUFA 3VDBA 3BSGA 2F7PA 4PMYA 3AIEA 2ALWA 3RO8A 1GCYA 3CZLA 1U2YA 4M80A 1C92A 1E0WA 2CKSA 3ZJKA 3BMVA 1H1NA 3EJPA 4HMEA 3LXCA 1NOFA 2V5CA 2D73A 3ZT7A 5A6JA 3DYMA 4AD2A 5DO8A 3OIHA 3VD7A 3MSDA 2ZXAA 4DM1A 4ML4A 4TX8A 2VQTA 3W24A 3WY3A 1HNYA 3GNPA 4UR9A 2G4FA 1C3FA 4FLOA 1BYBA 1EOMA 4CN6A 8CGTA 4ATWA 4FLRA 1C7TA 2G41A 4DUXA 4L4PA 3PZOA 1KXHA 3VNZA 2WAGA 3D51A 1KGUA 1BLIA 1UHVA 3B9AA 4UFLA 1TQWA 4PMQA 3WNLA 4PYSA 5D8ZA 1VAHA 1LG1A 4CD6A 1BFNA 3ARSA 2XVPA 5IHSA 2VR4A 1FH9A 3MI6A 2J79A 4L4OA 1BVZA 1Q4NX 3ZJ7A 3DYPA 1BAGA 5E0CA 3BAIA 3WBEA 2WB5A 3K8KA 3CH9A 4UNIA 2YLLA 3VX0A 3CLWA 4HA4A 1ZJBA 2G3IA 4OOUA 2ZXDA 4CU7A 2JALA 1QWUA 1UWSA 1E6XM 2OWXA 3FNDA 1UQZA 3AIVA 3SCOA 1HT6A 3MUAA 4Z2GA 3WD1A 5CJ5A 4NZFA 1E4MM 1QI3A 3WQ6A 4TVDA 1UR1A 4JCMA 3DECA 1TFVA 1LG2A 4CD8A 2WZIA 1JF6A 1BG9A 2O92A 2VZSA 1W91A 4PMXA 1GOOA 1WDSA 2X1IA 2EXOA 2YDQA 4HTYA 1J01A 4U31A 1KFWA 1ISWA 3AHZA 3BLKA 3HN3A 3EDFA 4PMVA 4W7VA 4URIA 5GNXA 3W25A 1E3ZA 3WY4A 3EJTA 2EJ1A 1Q6GA 1GQIA 4OBSA 3WMBA 5E70A 4QLLA 3VM5A 3W37A 1SYTA 2WVVB 2PWFA 1CNVA 1GQLA 3UG3A 3HZ3A 2WNWA 4UQAA 1KWKA 3W0KA 2XYLA 1PJ9A 3AFBA 1OSEA 3VTRA 1CDGA 1C8YA 1ODUA 3WNMA 4AZBA 2QHAA 1RPKA 2AMGA 1UWIA 4MNLA 1M53A 1R7OA 4ZXOA 3T0BA 1Z32X 2W67A 1QI0A 1W3KA 4M82A 2WW5A 1WP6A 2OLHA 4DUVA 1J10A 4HZ6A 4AC1X 3UR7A 3VIKA 2QPUA 2BVTA 3CGTA 3KWXA 2WLZA 4JCLA 1B2YA 3VGHA 3TA9A 3AISA 2EACA 4XX6A 1GHRA 1MXGA 2ZUWA 2YDSA 3UEQA 3WDRA 4NRSA 1UKPA 4DO6A 5FD0A 4UQ9A 1SFSA 1EIBA 1OGBA 5I3DA 5I6SA 3PZNA 1C8QA 4OIFA 2YL5A 3AXHA 1NM9A 4XZWA 1H49A 1H3GA 4ZENA 3AMCA 3VIOA 3BSHA 3VGGA 1EA9C 2BHUA 2XVNA 6CGTA 1JD9A 2F7QA 2CESA 1JNEA 2ZE0A 1HKIA 2V3GA 3N17A 1AQ0A 1KWGA 3GXIA 2JEQA 1B0IA 3AICA 1CBGA 4UFHA 1ZBKA 1RH9A 3ARQA 3EMZA 2E40A 3W29A 3U7BA 1VJSA 1OD8A 2WMIA 4TVUA 1HI7A 1CEOA 1U33A 4H8VA 2WLYA 3VIFA 3PZGA 2VCAA 4D6CA 1QI2A 5EBAA 4AEEA 2W91A 1XCWA 2O9RA 4RE2A 3D3AA 1O7DC 4D6IA 2E9BA 1XYZA 4LQ1A 1GUVA 4C7FA 3OLIA 5JIPA 1BYCA 3CBWA 2X2IA 4BQ2A 3PHAA 3ZT6A 1QNOA 1VBRA 4M81A 2WVUA 1QWNA 4AD1A 3GXDA 1NWUA 4P7QA 1HJXA 3MMWA 2XGIA 1WDQA 1ITXA 3AJ7A 1KBBA 1UZ1A 2YBTA 3SCSA 1KGWA 2GJPA 2VT0A 1QHPA 1V6WA 1KXQA 1W3LA 2GJRA 2O9PA 3BUPA 1G1YA 1A3HA 1KBKA 5E6ZA 2PWHA 3WN6A 4HOZA 3AS1A 5BWFA 1R85A 1W2VA 1UR4A 2GUYA 2F61A 2FGZA 2DIJA 1VEMA 5ECUA 1TUXA 4ZFMA 3OLDA 2X0YA 4DWSB 3EDEA 4KMQA 3QOKA 3AZSA 2EPNA 3GBEA 1CGWA 4TVCA 3VIGA 4PEEA 2ZWZA 3AMDA 4W5UA 1NQ6A 4BF7A 4AIEA 5A95A 2ZX6A 2XPKA 3WH9A 3SUUA 1IZJA 3NIYA 4LYQA 1B31A 3UG4A 2DSKA 2G3JA 3TONA 2EPMX 3N12A 4XZBA 4FMVA 5CLTA 1J0JA 3TV8A 3AIBA 4J27A 4PRWA 1Y7VA 2XIBA 2QPSA 5CPQA 1VFOA 3WQ4A 1WKYA 5DT7A 1J9YA 4IPNB 4FNRA 5AYIA 3MU7A 2D2OA 3S2CA 1DWFM 3EJSA 3LPPA 3TP4A 3A24A 3T09A 1TA3B 4R5EA 1DWHM 3AXXA 4UQCA 4MB3A 4B16A 2MANA 2D3LA 3NSNA 1RP9A 4UFKA 3O2LA 5D4YA 1CXLA 3ZIZA 3WQVA 1JZ3A 2VX7A 2EPKX 4GKLA 1IZKA 3O9NA 3MUZ1 1BG4A 2F1AA 5BXPA 5EFDA 2CXGA 1GZJA 2WHJA 2XG9A 5A8OA 2CBJA 2XFRA 1GJUA 3PZ9A 4H41A 4D1JA 3WD2A 2VCBA 4AZ7A 1UWUA 4P7LA 3T2PA 3SUSA 1QBBA 3DC0A 1J0ZA 3EDJA 4PBGA 3AHVA 2YL8A 1MW3A 4Z2JA 2WSKA 1L0PA 4R27A 3OB8A 1E6ZA 3NSXA 5A6KA 3FY1A 2GSJA 1ITCA 3G6MA 3VMPA 4W86A 5D9MA 1CGYA 3FAXA 3SCRA 5JBEA 2BY1A 3OGVA 4IPLA 4HOXA 2F8QA 2HISA 5C8BB 2J7CA 5M5DA 3WDIA 3ZJ8A 1EQPA 4NX0A 1QVBA 4JHOA 3N04A 2WXDM 4NXSA 5A6BA 4X0VA 1GONA 3ZOAA 2XHYA 4HZ8A 3BAYA 4D6GA 4WSJA 4Q7NA 2W62A 4EK7A 2D24A 3EJUA 2FHCA 1JNDA 1R33A 1HXKA 1WDRA 3S5YA 1HP5A 1AVAA 4AWEA 3VIHA 1LWHA 4CKQA 2J75A 3RMEA 3TTSA 2IUZA 1CECA 1G9HA 3WEOA 1MQPA 4HMDA 4A3HA 1W9DM 2YA1A 2DT3A 5KZ6A 3VGBA 3PN8A 1TE1A 3UG5A 4S3JA 4WLCA 3G6LA 1UH3A 1CZ1A 5HPOA 3WDJA 3ZQ9A 2Y8VA 5D8WA 1JFHA 4J3WA 3VGDA 3B9EA 1NOWA 1E3XA 1CGTA 3CHFA 4D6DA 4A3YA 1BGGA 1J18A 5E6YA 4YHGA 4IUGA 2DQXA 1E43A 4CGTA 2XWDA 1FFRA 3AZRA 1JYNA 4AMWA 4Y7EA 1X6NA 4AZ6A 2F7OA 1D3CA 4QCEA 1E6QM 8A3HA 1WO2A 5IHRA 1CXFA 1C7SA 1NH6A 3MUIA 5EFFA 4CCCA 3B9DA 5HXMA 2J7BA 1UD2A 1PIGA 3FAWA 3MKKA 3RPMA 3KLLA 1XH0A 3WY2A 4F9DA 1CTNA 4GQRA 1KR0A 5E1QA 2VRKA 3RILA 1HF6A 4HU0A 3IJ7A 1V03A 1I1WA 1F4AA 2OW6A 5CGMA 1IV8A 1W1YA 1E70M 1WB0A 1MW2A 1V6YA 3BAXA 5A3HA 1GVIA 1WZMA 2FH6A 3SCVA 4UOQA 1WPCA 3DHPA 3OZPA 6TAAA 1Q6FA 1K9FA 3GM8A 5CZKA 4AZGA 1UWRA 2OSYA 1TMQA 3BMWA 2F2HA 1GQJA 3WUGA 2E8ZA 1DEDA 3AHTA 4AY1A 4UFIA 3S6TA 2C7FA 4U5KA 3THDA 2WZHA 3DX1A 1UD5A 1GW1A 2ZX7A 1VFMA 3KL5A 2PWDA 2OSXA 1HKJA 1V02E 4JZ5A 2J62A 2XN0A 5FKYA 1LWJA 3W4RA 3WH7A 1PIFA 4QP0A 2NT1A 2A3EA 5ABFB 1CLVA 1HWWA 1WNOA 1QHOA 4PUDA 1JIBA 1E4LA 2VQUA 3ARZA 1B3YA 4U33A 2PF0A 1KCKA 1E4IA 1QX1A 1H0GA 4UTFA 2F1BA 2YJQA 3OGSA 3WDQA 4PTMA 3F4VA 5ABHA 3K4AA 1TQUA 1TQSA 1E5NA 1SR0A 3IAPA 1ZL1A 1W32A 1XC6A 5LA2A 2CPUA 3WNNA 1F4HA 2EEXA 1OGGA 5A8MA 3BLBA 1JF5A 3F5KA 3S5ZA 2QV4A 4AZ5A 3D50A 3CZJA 5AC4A 1MW1A 2DSVA 2PB1A 5E09A 4GINA 4U2YA 1V3LA 1FA2A 2FE0A 4BCEA 1HJVA 1V3JA 1NP2A 3VVGA 3NUKA 1FFQA 4DWSD 2WKLA 3BLPX 1V08A 3WD4A 5AC5A 1R46A 5I77A 5CLWA 3L4WA 3BVUA 1EQCA 4PMOA 3II1A 3EMQA 4ATLA 4UOZA 3JUGA 1FHDA 3QR3A 3VDHA 3N15A 7TAAA 3BUBA 2HVMA 2YL6A 2FYVA 4J28A 1JI2A 2CHOA 3J7HA 5BRQA 5JBFA 3W26A 1R87A 1W1PA 4DO5A 2CEQA 2BNJA 2NT0A 4IM4A 1W1TA 1UWQA 2WHMA 2EADA 1JZ4A 3IJ9A 3VD4A 1G94A 2WHKA 3N1AA 5A1AA 2V38A 4TXEA 3CHEA 3BUIA 1CWYA 3BH4A 1LF1A 1QNSA 3VGEA 2D1ZA 4K68A 3LRMA 7A3HA 3GNOA 1AMYA 5FL1A 5CXPA 3DYOA 3PZUA 2J74A 5F7UA 3WF3A 1H0IA 2GK1B 1MFUA 1DWIM 1LLOA 4CCEA 5DT5A 5I23A 3FN9A 4CVWA 3F5JA 1TQTA 4U3AA 3M07A 4AZCB 4GI8A 1FOBA 2XJ7A 2CETA 4JIEA 2E9MA 4HMCA 3ECQA 1C90A 1E73M 4GZJA 3AIUA 1C8XA 3AZTA 2G3MA 2A3AA 4ZE5A 4HP5A 4Z2LA 4FLSA 4LPCA 1E5JA 2YDRA 5CPTA 3ZM8A 3RCNA 3RM4A 4HPHA 3NDZA 3WNKA 1ESWA 4D71A 4GO8A 4W93A 2IGTA 2ZX9A 3WDHA 1TVNA 1R86A 3A47A 3WENA 5FOOA 3GH7A 4PCTA 4NF7A 4AZIA 1JAEA 2Z1SA 4JFVA 1JYXA 1X1NA 3AHYA 3HMCA 5A69A 1KQYA 3BVXA 1P6WA 4YN5A 1KXVA 4FNSA 2V3EA 3VMOA 3WDPP 2YFNA 4FNTA 3WUEA
chains in the Genus database with same CATH superfamily
1IXNA 2XXMB 4PP2A 4RRPG 4K23H 4ODWB 4GK8A 3FXYA 3FQXA 2Q8XA 2VERA 2B81A 1X7IA 4FX5A 4IXHA 4TR9A 3EO9H 1E5BA 4NIKB 1MCIA 8XIAA 1SJEA 3FB7B 4PRPA 1OG6A 5DFAA 3O2DH 4FKHA 1OT1A 3WS3A 2ITCA 1PZBA 3W1RA 1BVWA 4KC3B 3UA4A 4QX4A 1TR1A 3KPTA 3Q45A 4V1YA 4PJ5D 5F96L 3N2OA 1AHWC 3T4YA 1R9XA 3QUZD 1THFD 1R3HB 1CFNB 3TZFA 5K9QG 3VYOA 2AJXL 1U22A 1SJCA 2NRDA 2J73A 3D8MA 4P2QA 1ACCA 4MWFB 5EZJB 5RUBA 3BGFC 3FTWA 1XIDA 1HGWA 3VI3E 4IYKA 1INDL 2VXUH 3N6JA 2BNQD 2P3EA 3DVNA 1I8IB 3B7TA 4K7YA 3GTVA 1ZA6A 1CLYH 4RFNB 4P4KB 5F7EL 3U83A 4B9ZA 2O61B 5DVNA 4GABA 3PP3K 2ZOXA 3UWWA 4P2OA 3PQYB 5CMAA 5EC2A 1M41A 1QT1A 5GGTH 2CHWA 2XLLA 3LQLA 1JZ6A 4OCXH 2VKXA 1NFPA 1BX2B 1P1MA 2GJ6D 2RDTA 2OTUA 5E1GA 2NUPA 3GNRA 4MXQD 1UR8A 4QAIA 1CD1A 1ONQB 2V5YA 4TUJA 4JNMA 3GPSA 3TBSA 5B22A 4YOKA 1GS6X 4WO4A 1EFXB 1G1KA 3RPIB 5EF1A 2V2WA 1SLXA 3CDZA 4WFEE 4PMZA 1X5KA 4ATDA 3L5LA 4OZFH 1IGTA 2YB4A 3CBKB 1P1XA 3A13A 4PJAE 2A7PA 4MD5B 5AZEH 5KVFL 5BO0D 4LLUB 4K5PA 3UBGA 5BRPA 1E0TA 3H6JA 4XWUA 3SGGA 1DL3A 4GZIA 2YD6A 2EC9U 1NAMH 3FSZA 3VKAA 4I13B 2DQCH 3PULA 3GC3A 5IB2A 3F84A 4IBZA 4JM2C 1HNFA 3F4DA 3BRFA 3LA4A 4LPVA 2Y6TE 4PSRA 3N06B 4AVHA 4XPFH 1XKJA 5EOQH 4FXKA 3OVQA 4E5XG 1GY2A 1IFRA 2DW6A 1U8IB 4MNHB 1AHMA 5IFJA 2DT0A 1OLLA 2BODX 1Z9SA 3NCJH 4XKYB 3HS0A 1O9VA 1I1RA 5FA3A 4ZT1A 1EB3A 2C3ZA 2E1DA 4PLKD 1XZ0B 1KFCA 3HIZA 3SDOA 1D6EA 2UVFA 2WB1A 1I2PA 4HZLA 1DQJA 2COQA 4YVVA 3ITXA 1TZHA 3WN5C 2DJXA 3QXUA 1I1FB 1U41A 4DW2H 1MRQA 2AI0H 5LDSA 1FAKT 1MY7A 4PV1C 4AYGA 1YEEH 4Z76B 4NC2B 4XBMA 1SM3L 3CEPA 3VXMB 2Z7WA 1EZSA 3UXIA 1G7LB 5FM8A 4CC4C 2YWZA 5K9DA 1KACB 1RSCA 3H22A 3ZHFA 1YTEA 5DJCB 1I1AD 1Q1JL 5HANA 1KDIA 3UQNA 3KTCA 2QLYA 2NUTB 3TH4T 4KX9A 1OP9A 1A7NL 3PG8A 3AMLA 3GFYA 3B4NA 4J1UB 2AZUA 3IDXL 2ESVA 4FZIA 4QRTA 4HB7A 3EBIA 1UKQA 3QG7H 4X98A 2YC1A 1K4DA 1XU6A 1B4EA 1S5HB 4KTYA 1Q6QA 5IB4A 1LO5A 3PTMA 1HKFA 3WUZA 4KNUA 2CHRA 4RDYA 4QXWA 4E5XB 1ZAJA 4RZCB 2H8PB 2XG5B 4I3SH 2FNWA 3OJMB 2YR1A 1NGYB 1XIWC 1N68A 4ZW6A 4L9XA 1S7QB 2P24A 1TYEB 1F42A 3H6AA 2BH0A 5FM5M 2P4AB 5LNWA 5CLZA 2YEVB 3WFCL 2EPHA 4ICNA 4P4RB 2L04A 3TN3A 1QZNA 3ZVIA 3O7UA 3N19B 3CK5A 4WI8A 6FABL 4PGCB 3ZO9A 4RAVB 3W7NA 4RNJA 4DJDC 4YN3A 5I5JA 5T1DH 4C4KT 3QV7A 2JF7A 1YJDL 4HSCX 3ZDXB 3MHZA 4HLZG 1JZDC 4QR7A 2CH8A 4OFCA 3G1YA 3E74A 3PHSA 4GQQA 2IANA 2YYUA 3M4HA 2G8ZA 2X2YA 5HQEA 1QPOA 4PW3A 3W87A 1Y0EA 1EL3A 4FCAA 1Y1DA 1J5OL 1DJXA 2OELA 2HJLB 4QJ5B 1E9YB 5EB8A 5I3GA 3W1AA 1AZCA 4JRYE 4MDIB 3B06A 4US5D 1A0EA 3MR9B 5E99L 2ZRZA 4K7PH 4OB5L 5H4YA 4GI9A 1I4NA 4NN6B 4ORZC 3KVDD 4GXWA 4LEOB 3BZ5A 4TPRH 1JCNA 2ENSA 1GHSA 4RRPA 5T33L 1IEAA 5JDSA 5F2MA 5T3XE 3QHOA 2VMEA 4Z6AT 2E76C 1I9RL 2QT3A 3WLHA 3GLDA 2ZWKA 1G7IB 1BJ1J 3NL2A 5ICYA 3DUHA 1WJ3A 1NGXB 3RWCB 3TR9A 1U6AL 1P7TA 3LNFA 2UY5A 3QM3A 2OXGB 2PI6A 3R4RA 3DROA 4MHHI 2OQYA 3G3MA 5CZ0A 3E96A 3MW7A 2X6MA 4TULL 3PBYA 1TMCB 3TJIA 1JL8A 4XP5H 3KWSA 3DURB 4MAUL 1IQDA 2FZ3B 4KS0A 2X16A 3IN2A 1EUNA 4QKXB 5EMKA 5AAWC 4ZTOL 1RBAA 1HKLH 2Y1HA 1W9UA 5DEZA 2BS71 3DKJA 3CUHA 1HX0A 3CPUA 1A5FH 4ZUTA 1JGLH 4ZQCA 2QDVA 5C08B 1AGFA 1LQAA 3MHGA 3L4TA 4MJZA 3MRNA 1ZHKA 3S98A 1NWOA 1SXSA 3FH8A 3APDA 3BT2H 1XCXA 1CD8A 1DJIA 2XSKA 1YKWA 2QR0B 4RK8A 2F6AA 1Z7JA 2VN4A 5FS5A 1NOAA 2OEJA 4FC3E 5E8NA 1GTHA 1OYBA 3ZO0A 4PSPA 1V54B 4YO0B 1H09A 1XV8A 2UY7B 3SUWA 4OZHF 1I1FA 2OMXB 3UF9A 1SMDA 1SO5A 3APYA 5AAPA 3RDKA 2W4XA 4DAFA 4M48H 5EO1B 4B3LA 3VXMA 3NM3A 4P3CH 3QFJD 1IC4H 1RPXA 4MJIE 3PV6B 5I2UA 4QTGA 5FCZA 3CXOA 3HF3A 4CSPA 2HFTA 4PCSA 4EF8A 4ADJA 3RY6A 2ZXWB 4NASA 1E6OH 1FY6A 4G1KA 3K46A 2DFAA 1BIIA 5DMKA 5HPMB 3ETSA 4TNWF 5LIKX 3GHUA 1JRHI 3D48R 3DIFB 4DN4H 3EB4A 2I9LA 3IE9A 1UB3A 3HA1A 1S5HA 1QEXA 5EU6D 5F7HA 2HJFA 3TMLA 3MRCA 1RR2A 3SY1A 1KBLA 4E5XA 3W86A 4ODSL 4Y5VB 1X4YA 2H8PA 4U1IA 4DZ5A 5I8CB 3IK2A 2E0PA 1GHFL 2I69A 4F91B 5C71A 5DK2A 2PDLA 4BWLA 3VXPA 2VEMA 5DZPA 1D7FA 2ZCKL 2AEWA 2GABA 3C6LA 4D8PB 3ZE2E 2AW2A 5F7WC 5C0QA 3C2YA 4P4RA 4CQAA 4CADA 3BYYA 3MRGB 1RAMA 4DP5X 4NAFB 5E5MB 3UTTB 5FYKE 4KQ4L 3O2VL 3KYMA 3P54A 1VCFA 5TFSL 3JTBA 3S42A 2NYKA 2Q71A 2NQ3A 1YXDA 2DI8A 3KLHC 3VG0L 2OG9A 4HKZB 3KL3A 2DZPA 5KW9L 4Y19D 4QUOA 3C2RA 2ADAA 4M62H 4WX2A 4ZEPA 4JQ4A 2DGAA 1XM3A 2VDRH 1XINA 3CAKA 3RBGA 4PWFA 1TVBA 2J8OA 3BFOA 3WFDL 1XS2A 4JFEA 5CSZA 3FRUB 1ZLSH 4IGMA 4AZCA 3AWEA 1YEJL 4NBXB 4XRCA 1TV5A 4FEZA 1QU4A 3W6MA 2V9RA 4RUBA 1ZHBA 3LN5A 3L4YA 5F1VA 5CC7A 4HUWB 1WBZA 1VRXA 1M7IA 3S3JA 2ICEB 3MJ9H 1L9NA 2LQRA 4ODXB 3H2NA 2Y7FA 4DQOL 2V2DA 1HXJA 2R9HD 1FI8C 1YEHL 4MA7H 2FLMA 3REWB 1HXYA 4UM8A 5I73B 1EP1A 5EH1A 2HKHH 5IQ7L 2F7PA 3ULSB 3GNXA 4OUOA 4AWSA 3DC8A 4I4WB 5ECJE 3KGSA 1H7NA 1BWKA 4UUIA 5FDWB 2VQTA 3ZY7A 5HYJD 1OG0A 3TXAA 2JCCA 2NX1A 2DIAA 4Z5RA 3M1BB 3FEMA 4L4PA 4RFNC 4P4KC 3GVGA 2R2BB 1SZGA 3DURA 4OY9A 1AGCB 4LVBA 1YYCA 3GSNL 3R79A 2XFXA 4LEEA 4PYSA 4L8DB 2QZRA 3TC3A 2UXTA 5FV2A 5HYSG 2FTAA 4R53A 1BRLB 2CXKA 4WJ5A 5DFTA 4HT1H 3QWOB 2VWTA 4FX7A 2DMKA 1G7VA 3RVUD 3DI2B 4DVRL 1OSZA 1TZ8A 4IIFA 4PJIB 5E7FA 2AJUL 4BR1A 2Y1ZA 3PGCB 2ZD0A 3AIVA 5DQ9A 2OX1A 1EJTC 3N55A 3WQ6A 5GSRB 1UR1A 4PBEA 3UBXB 4Y9MA 4OTXH 5T9BG 1TZIA 1TTIA 1USQA 4RISH 3OR6B 1JV2B 4LDEB 6REQB 1HQ4B 1JHTB 2DWEB 5EEWA 4JYFA 4MD4A 1ADWA 5DHYA 2A21A 2PWFA 3L5JA 3OQRA 3L23A 1YEDB 1KWKA 2O6DA 4JM2F 1GGIH 2OMZA 2Q8LA 3KW7A 5DUML 2VDQL 4WZHA 3BHBA 2H47C 3H2FA 3C60B 3WNMA 4G1EB 2J3SA 1L4IA 1VDGA 4JPVH 3KXFE 1AD1A 1UWIA 4JE0A 1I8MA 1RZJH 3U48A 4L4VB 3PWVA 1WP6A 5IQMA 1UM4L 3FUEA 3O6KH 2EC9T 4U1GB 2ITFA 1HINH 1UGKA 4LLQB 3L5HA 4JIHA 1THAA 3G6JA 3SHSA 1R30A 3D2TA 4TKWA 1QUPA 3DIFA 3DJ9A 4R7XA 1H49A 1OVZA 5GRYA 3PWLB 2QVMA 1KFEA 3C2EA 4P5TB 2F54E 2QPEB 4HX1A 1M3IA 2F7QA 1KY6A 3SJVD 3BLEA 2XPZA 5AAMA 1KFGA 3F62A 2AKMA 1ZS8B 4GSDL 1ZBKA 4L0YA 3H56A 4WK4B 4IRJA 3W29A 1VJSA 2JMRA 4AK1A 1FFPA 2C4FU 4H8VA 3LKSA 5DI8B 2QVNA 2IIJA 5ECGA 1DQDL 2P8BA 3L1OH 3MRRB 3E6EA 5BS0D 1XYZA 5J1AB 1NSJA 4GW4B 5AB9A 1JCMP 3QIWB 5E5MA 2PNDA 2AJSL 1RU9H 4QPEA 4M7LT 4DN3L 2YBTA 2IALB 2GJPA 1MJ8H 2VP8A 3OYXA 5GISL 3T7VA 4MG4A 1L9RA 2WO2B 4OZGE 4QISA 4GUOA 4X8JA 4BV1A 5E6ZA 1A1OB 4PJFE 5DQPA 4AM0Q 1GZPB 2F61A 5J7CC 1FH5H 3DX8B 3DBNA 3F04A 4HZMA 4GAAA 2X0YA 2YQBA 3DVGB 2Y7QA 2EPNA 4PEEA 4EOUA 4XG1A 1DR9A 4NI8A 1NTHA 1TEGA 1IZJA 1GA2A 1PU0A 2QDHA 2PYED 3LHPL 5D1QE 4FMVA 3A67H 4PJGF 4E2BA 1GOFA 3WLOA 1A7QL 4FYRA 4YHZL 2DU2A 1DSFH 4WI5A 4ZFOA 1P1VA 3OJDB 1NLDH 2ICEA 3S2CA 4HVBA 1IKOP 4K8RD 2BVOB 1M1XA 3EXRA 3QSTA 1SBBA 2MANA 25C8L 3RI5K 1J5DA 1EZ2A 3LSOB 4IQHA 5JO5B 4OZFG 4S1DD 1UCTA 5BXPA 3PZ9A 2YSWA 3P0GB 3GC2A 3TYAA 1TJHL 3C08L 2X1SA 3T2PA 4AQEB 4OCWH 3S1UA 1UWFA 5AOKA 2B4CL 3AALA 3ZMEA 4IGBA 1QTWA 2OA9A 2IDUA 1XGPB 1C5BL 5JBEA 4PBDA 4LMQI 1QSFE 1TV7A 5CN3A 1RHHA 3WJLC 1AODA 4AWEA 1BRLA 1G9HA 3NCWA 2WJFA 5M1TA 3QWOA 2FATH 4OV5B 2DOCA 1SVBA 1II4E 2Y8VA 4HF5L 4BF5A 4X6DA 3ZVHB 3P67A 5C7VA 4EKXA 5KVMC 4NZUL 4U7MA 1PZ0A 4KNTA 1D8WA 2F7OA 3DPBB 5FYJH 3OR6A 4AT6B 1FHNA 5B8CB 4PYGA 4PJCA 5IUCA 2FX9L 1QR4A 2VXQA 5DRZB 4Z7WA 4E9LA 1U36A 4FEMA 1BVLB 1N64H 1J1XL 1BOGA 1DBAH 4JPGA 2DWXA 1S7WA 3ARBB 2C7FA 3TN0A 2JGQA 1F45A 1OW0A 5T1MA 2LT9A 3LKNA 5D70L 4YL9A 4LLQA 5TF1H 2YD4A 5HHOA 1QMUA 5ABFB 3L95A 3OXSB 4QEGA 1NFBA 4F57H 4UTFA 3TT1H 3W1TA 1TQSA 3MMEA 4M3JA 2VIRA 5HYSA 3MPGA 3GB7B 1JCTA 3BDKA 3BLBA 3R7RA 3N40P 4H83A 1ZS8A 3MRQB 5I30H 3COOA 4P59L 4JDTH 1IILE 3BP5A 2F5AL 1DHPA 3MV9D 2IPGA 5J0BA 2XYBA 3R11A 3UZQB 1O5DT 1LZOA 2WKLA 3DO7A 4UOZA 2Q7YB 4Z7OF 7TAAA 5E00B 4YVNA 2HVMA 2R94A 1ZT1A 1A6VH 2WGXA 1UWQA 5AW4B 2Z4QB 2IG2H 2QAPA 5B4MD 2XWBB 3BJFA 1GAFH 3IMRA 2OQHA 5FAJA 3VXSD 4RNHA 4Z3TA 4N1CA 3NQ6A 3RNQB 1QBLH 5DYFA 2X6UA 4DKDC 4PJHF 4DHGA 1C90A 4JKPL 4TMBA 4HUKB 4K5MA 2F58L 1W0MA 5DA0B 3ZM8A 1XICA 4WAFA 5EUOF 1ESWA 5DMMA 4XNMB 4FOJA 4NQVA 1TVNA 4PCTA 1RXLA 1BVNT 3HIJA 2J6EL 3A5FA 4HWUA 5DR5H 2BRRH 1GGBL 2H9GA 1T1ZA 1WDDA 5JPNA 4X6BB 2ISVA 4PRNA 4NN7B 3CMGA 1O6IA 5JHBA 2I9TB 1YNLL 2MUCA 5G4EA 3CIAA 1J5TA 2UWEA 2BS9A 3VCLA 5C9XA 1K4CB 3MO1A 4YBQD 4O0KA 4E4PA 2YPIA 1PCWA 5IJKC 3KOYA 3O2DA 4OW6A 1IBZA 2JCWA 2DQUL 3GXNA 3BICA 4BQ3A 5E23A 2EYSB 1MCOH 1L6WA 3QDGE 4ACZA 4FQ2H 4UMSA 5FFGA 1H19A 1JYWA 1OAUH 4Y4KD 12E8H 1R3KA 2X4NB 4CVXB 2DV6A 5HVHB 3PBVA 4JVUA 2WYTA 2P52A 3GJFB 2PLKA 3ECWA 1HJWA 2ZAHA 3TE9A 3FMGH 4X6CF 1J8SA 4JUTA 1CN4A 5EU9A 4YDKL 4P2AA 1GORA 3FO0L 3BFQG 1RURH 2W79A 5FJPA 5ELIA 5L9DL 2DPEA 2WQUA 3F83A 5I71B 5IJBC 3S88L 4M24A 5DGQA 4ZFQA 1EX5A 1EEZB 5D02A 1YNYA 3KTXA 2JJTC 5CPSA 5AW7B 3VH8B 5I73C 3DMMB 3GY1A 1A3LL 5GGTA 2CM5A 1RH8A 3QZNA 1P53A 2EVHA 2H3DA 2MHAA 2DLIA 1UXSA 3I9PA 1T0NA 1HILA 1K4GA 2QDEA 3WUWB 1QOKA 2GOUA 4GXPA 3Q05A 4IPJA 1OAZH 4E36A 5T5NF 4GG6A 1MHCB 4U6XB 1AKPA 5CJQH 1HP4A 4RL3A 1RJCA 4EWJA 1SEQL 1VHPA 2O6PA 4OZFA 1UD6A 2PDCA 3UA3A 4OLYH 1ZY9A 4Y4HB 1ECQA 4YCOA 3ARBA 3NFNA 5GGSB 2Y62A 2GFTA 4DNHA 2WSYA 2BNRB 2XWCA 3PWUB 4FP8L 1B2WL 3T78A 4Z0JA 4DAGL 1S5VA 1NAMA 3W2DL 5FIPA 4S3KA 4XHJD 5C09B 2DIKA 3H4XA 3GSOB 2QCEA 2E7LC 2EDBA 3QIUA 4H8WC 3BJSA 3O3AA 4A4AA 3ILDA 5MEOA 1UVQB 3L9CA 3LKOB 2FAUA 4JLRA 4OGYH 1H15B 3PIQA 1YMMB 1CVRA 1IMHC 3CIVA 1FN4A 3NJGA 4G5AA 4JDVA 2V2CA 2A9NL 1A3ZA 4TX6A 1SJXA 5KVEL 1AHKA 4M29A 4C59B 2CDFB 3RNKA 4XN2A 1G9NL 1IC0A 2GWGA 2E5DA 3E6HB 1DVQA 4CBZA 3KZSA 2ID5A 1N0XH 1PZSA 2EKSB 4HNVA 3Q44A 2A2QT 3JZEA 4O8RA 3C60C 4Y9GA 1I45A 1ZNNA 5C70A 1A4CA 4YXLH 1QKZL 4CJ0A 5AZ1A 1L9WA 4U1GC 4FLQA 2ICWJ 5SWSD 2RQ8A 3P3UA 5CBEA 5I8EB 4AX3A 2X4SB 4ZW3A 2FKPA 4ACYA 3SDDB 1LOSA 4UT7H 3G1XA 2IDQA 1AGDA 4FQLH 2GSIB 1V0KA 3GMQA 1YNKH 3LRSB 2E5EA 1A6PA 4P5TC 2J2ZB 1TZ7A 4JPIA 3PBMA 5K4XA 3CXDH 3D39B 3JR2A 3VB9A 1LO2L 3PWPE 3ASWA 1AOHA 2IBZY 5L4JA 2HN7A 1U8JA 1NWRA 1S5NA 5EOCJ 1BXCA 1J9RA 3MOBH 5FHBL 3C52A 1KM0A 1OTUD 3EX2A 4G8GB 3UEZA 1LMIA 4IMDA 3QPQC 1X5AA 3QIWC 5EFIA 1KT2B 1QTYT 3VWKB 3CUGA 2JKWA 1CG9A 4KY1L 2ZJSL 1EANA 3CU7A 4A2DA 3I7RA 3ZSSA 5D9PA 5HNNA 2CLVA 4E0RB 2C4FT 1OFDA 3UC2A 5CPNA 4JN2A 3S83A 1QAWA 4YHNB 4L29A 1RHCA 3RL2A 3CPGA 3KJ6H 5D96B 3W2LA 4J40A 1QABA 1ZE3C 3R2GA 3WBWA 4AD0A 5D2YA 5JQ9A 3HHSB 1VIWA 3MCKA 4CGUB 2NSOA 3MRMA 3ZVVA 1NC4A 3GSUA 2WMPA 1E90A 4X7EC 1L0YA 2C3VB 5F44A 4KRUA 3ES8A 5GS2H 1AW5A 2YRPA 4M8QB 4CVXA 2NQHA 3O8XC 1JPEA 1X9LA 2CZNA 1NGWB 2G2NA 4Q4EA 1QRNE 4WZ9A 4HJJL 3DDFA 1D7CA 4N8VG 2XVBA 2VDRB 3W07A 1CZ8L 1H5BC 3H3KA 5JZ7D 3IKKA 2NNAA 1U91B 3E6FA 3UGUA 1J96A 2PCQA 5J12B 2VFHA 3GR8A 1F6AA 4QOKE 4INFA 1R19A 4KUCF 3SY6A 4X6FB 4QJ1A 3MRDA 4J3SA 4X9YA 1NAKH 3U7VA 3FU7A 2F2KA 4AMKL 4KXAA 3AUOA 4GBXD 4ODTH 4AIZB 4HLEA 2K7QA 1YYLH 1N18A 4AIUA 3IDUA 2UWFA 3X11A 3TPKA 3Q13A 3QHMA 2NR6C 5F0MB 1XRSA 5JPMA 1P4BL 4KWSA 3MO4A 3MJ7B 5H37G 2FGWH 3V1HA 1HS6A 5LNSA 3MRFA 5D7LA 4IMCA 3QWNA 2W59A 4EUPH 4DO7A 3V7PA 1HHIB 3L2LA 4WI6A 5T9CE 2EH8L 1EGMA 1CFTB 4GKZB 4NC1E 1ICSA 1WSST 1P0EA 3C5ZA 2Y36L 3PZMA 3ATZA 3QDJA 3L4VA 4S10A 4AH2B 2V2HA 5KYNA 1MFEL 5FB8A 1XSOA 1ESOA 4WI2A 5KWYC 3V95A 4PTNA 3MGAA 3O3DA 4CU6A 2ZRUA 4KI5E 2AABH 4GVGA 4AG4H 3LKOA 1F1AA 4OFPA 1FRGL 5D6DA 3QEGL 3GXPA 1YMMA 7FABL 3TLLA 5CJNA 2XZQH 3S0CA 1NJ9B 4FYSA 3LZLA 3L9BA 5FYLE 1RY0A 3G5VA 4X80L 2J44A 4B9GA 4UNLA 1Q72L 2ZCLH 1TTPA 1W9XA 2R0WL 3GI9L 2J6VA 1PEZA 4XC1L 3H9SB 2CYGA 3UZEC 3W0WD 2YPLD 8XIMA 3CUPB 5B8CC 2EIDA 5A6TC 5AKTA 1OB0A 5KSAD 2P76A 1QVOB 5E08H 2WWCA 3TVMB 4MNQA 5DD6B 2C6QA 4D0CA 4ETYA 1WZAA 3GDBA 4I7UA 4FJZA 3C9NB 5A8PA 4C6EA 1K72A 3GHRA 5IJDC 5FF3A 2E9IA 4CVZA 3ZR4A 5DJ2B 1KCUH 2MOGA 1ECEA 3EEZA 1Y07A 4GUQA 2CWXA 4IHOA 3QJQB 1FHLA 1E5ZA 1UD8A 4EAEA 4M1GL 3ASOB 1DKWA 1KTDB 5DHXB 3LN3A 1FZMB 4JTSA 1J87A 3DGRA 3LBCA 5LSMA 3LSBA 3FT3B 5HJLA 3TZNA 3OG2A 3WKQA 3KM8A 3SB0A 3U0WL 1ZVYA 1I8LC 4OJYA 5DFVD 4KXZI 1U8MB 2H0EA 4Q6IB 3GZAA 1SYVB 5FW6A 4PP2B 1NKOA 3MCLH 4OZIE 5HD8C 3POHA 3PF3A 4PJ9B 3FQXB 1OV8A 4IIHA 4V27A 5I1EH 3VW3H 3QAQA 3MSYA 3TPUA 1X7TA 1J2BA 2CAKA 1JFXA 3W7QA 5E2TL 1WAWA 1SJEB 4PRPB 4HHAA 3WS3B 3QHFL 1LORA 4UWMA 2ITCB 3NIDF 2P7TA 3QXVA 1F90H 1YQVL 3D52A 3M0LA 5TD4A 2E27L 2A3LA 3HFMH 3T4YB 4LVDA 2X44D 4AAJA 1SJBA 3NCEB 2XYCA 1GGOA 1SDDA 3SW6A 4UTMA 4OKVA 4P2QB 2EKCA 2J7LA 1UT2A 1KRCC 1TNNA 4LHUD 2P47B 5C0AD 5FPIA 3UP1A 5D93B 3F00A 2X4QA 4EDWH 1MI5D 4NNBA 4PN2A 4B97A 4XXCC 3DVNB 3UAFA 4M8QA 3IFLL 1JPHA 5AHMA 1ZA6B 2O7SA 1IZCA 5B7FA 2FWOA 3GVRA 5C3TA 4Y8FA 1PCXA 2EDQA 4P2OB 4MTVA 5TE4H 2QR6A 5L9FA 2EDMA 3BUQA 5CMAB 5EC2B 3T0VA 4IPIA 4TSCH 2GK1A 5SX4H 3O2WH 3OTRA 2V4LA 3VJ6A 3PDOA 4NN7C 2EEFA 5F3BA 2Z91A 2OTUB 2NUPB 1CD1B 4TUJB 3TBSB 5GJSL 1MCWM 3ARGD 2ZTJA 4WO4B 1U8LA 1NU5A 2V2WB 2VXQH 3CDZB 3UMTA 4JRXA 3SCMA 1V6VA 5I19L 3R06A 5D7JD 2VXSH 1FLRL 1RL1A 4R2GB 3CFBA 4CU8A 1IGTB 3MUHL 2YDAA 3FFOA 3CYJA 3QNFA 2VLRA 3R0UA 1C5DA 2ALWA 4A7VA 4GSQA 1E4XH 2GZXA 4ERSL 1HHIA 3B3DA 2ARJA 3CX5J 3PP4H 5HVHC 3G1AA 1GSKA 5IB2B 2PRLA 4DM1A 4MPQA 3BKCL 1P7QD 3C2AL 1K4HA 1C3FA 2YAFA 4DJEC 3ECVA 1YW1A 1TZAA 5I75B 1KXHA 4FXKB 1BLIA 3S5SA 4E41E 1AH1A 2J4WH 2C1PA 1UT1A 5D1ZA 5D8ZA 3B2XA 4N2KA 5IFJB 1Z9SB 2ZKHL 3V9EA 3ABZA 9RUBA 1L6GA 3HS0B 3BKJL 5FA3B 2R1WA 1V51A 3LTVA 2QKSA 4N8VA 4QE4A 1MFCL 4HA4A 4Q7DA 2ZRYA 1A7PH 2YMOA 1P6BA 4GACA 4U4IA 3VGAB 1ZP3A 2WQWA 3EKGA 5MHSE 1D6EB 1UQZA 4LDOB 3S34H 3B83A 1HT6A 3WD1A 3LNMA 4HZLB 2X87A 1DQJB 3ZL4H 1TZHB 5KYYA 2Q3AA 4K07A 4Y9NA 4L48A 2CC0A 1JF6A 4Y4HC 3KWVA 4JR9H 3OAUL 3QJVB 4PUJA 2ZBTA 5DZNA 3EZ4A 3IDMB 5CFAA 1YIXA 3NQDA 4MCMA 4HGMA 3UW6A 1Z42A 4PJIF 3WKML 5H37A 2VOMA 4JN1L 3SPGA 1OY3B 1UC6A 2Z00A 4MS6A 1HK6A 3QIBD 5FKAA 3ECBA 2PRMA 2ESVB 4QRTB 3IPEA 3LIZA 2DZSA 1EJFA 5B1KA 4M82A 4GJIA 5EEUA 5LHDA 4X98B 4HJFA 2YC1B 4FMFA 1AP2A 1K4DB 4MMXA 4M00A 5IB4B 1LO5B 4QY8A 3UPWA 2ZUWA 1FIGL 4L1SA 4KKAD 3FLUA 4PJ9A 1X7QA 4B9IA 4CW1B 1XT5A 1J9QA 1WZ1L 4DJMA 4HNTA 4ICCX 2P24B 2BHUA 3V6OC 1NUGA 1IAIH 1OPGL 4ZXBA 1YY9D 3S1GA 2DQIL 3UZVA 4IQEA 4XC3L 1JUBA 3VKCA 4QYOA 4LY8A 2UZXA 5H1WA 4TQTA 3CU2A 2EG6A 4H0LC 2VCAA 3EJZC 2YAHA 4YNYA 2BP8B 5EMUA 2X0VA 3SDDC 4JYEA 5C2XA 3KYOA 4K94L 3QDAA 4Y9CA 3GSXA 5DC2A 4OT1H 2P5ED 5JHLA 2MNUA 1PDKA 2W38A 2X30A 35C8H 3EYQC 4GVHA 4H5SA 1DFXA 1ITXA 1TTCA 1GKRA 1DVUA 1O5RA 2IANB 4H88L 4LCWE 2BOGX 4IEFA 3PPFA 4L4TE 3SYAA 1IC5L 3H3PL 1TQCB 2F6KA 2Q3XA 3OZ9H 2ACUA 2PWHA 1A4BA 3WLNA 4WENB 2AQ3A 4YZFE 3TUUA 1CU4L 3N2JA 3M0HA 4P23A 1QFHA 3V4PL 2R0KH 3D6GA 4LALA 2X0SA 3FO2A 3HKFA 3VWKC 1ORQA 4KV5E 4GAGH 4U3HA 2DDQL 4LS2A 4R96A 5E1AB 4PRWA 1IEAB 4LVHB 5JDSB 4WNQA 3RR4A 4IIDA 1N7ML 5I6OA 4F9PC 5D96C 1TYJA 1CF1A 4MMYA 1EYWA 4MB3A 4UQCA 5TBOA 4M8RA 5ICYB 3DIPA 1KJ2H 4UINH 3LTSA 5B7MA 4QDPA 5AOZA 3FH7A 3DUGA 1P7TB 3J27A 5AECA 5DUBA 3W1QA 2N59A 4JM2D 1IC7L 3DROB 3VFPA 3WD2A 3RG1C 4RX0A 2WSRA 5CN1A 1G9ML 2DKSA 4GUGA 1UZGA 3AHVA 1IQDB 1BFTA 4C1NA 4JANB 1P5BA 3EA2A 2AK4A 1DBJL 5I1KH 3VMPA 2ATMA 4W86A 1CGYA 1OAKH 2RCSL 2J7CA 4U6VH 2GSGA 4ZUTB 5J12C 3N04A 1IBYA 4F0HA 1AGFB 2AQNA 2B15A 3ALWA 3MRNB 1ZHKB 2BLFA 3RMEA 4HIPA 2PDGA 5FEBA 1VA9A 4NQDD 3WNIA 5F7KC 2WSDA 3W1PA 2NV9A 5E8NB 4ZTPL 1F4YH 3CZUB 1R0AL 1J18A 4ANXA 5A7BA 2YN5A 1GKPA 1E43A 4WEUD 3K72A 3CM4A 1V77A 1JYNA 3ULVE 5JW3H 4QCEA 2FPVA 2HQAA 1SFHA 1KC5H 4GH3A 4RPQA 3QC5X 4ZZKA 4Q4MA 5C6PB 1A6ZB 3IDMA 1BJMA 2WHVA 1EXBA 4L1XA 4X8CA 3KYKL 1LLWA 3O4LE 4HU0A 4RFEA 4M1DH 4W9LC 4PJBF 3KBEA 1I6NA 5J1TC 3IGAA 3MUGA 4BRVA 2IQAA 1QSED 1BIIB 5DMKB 2VO8A 1E4JA 2OSYA 1UPPA 1DXIA 5EZOL 1NGQH 1GQJA 2E8ZA 2NXZB 1U92A 3IRPX 3MBXH 2QHLA 1IJ9A 2I9LB 5T1KA 1BD0A 3BG9A 2HJFB 5DS1A 3MRCB 4O4VA 1GPOL 1YE4A 3WH7A 4Q8MA 3GLEA 2A3EA 1H51A 4ZD3H 5J11C 4U1IB 5SX5H 2VQUA 2BIIA 1QX1A 4CW1A 3G0UA 3HRZA 5DK2B 4XMLL 3TVMC 1UACL 1W32A 1S7VA 1OGGA 4WRLA 3VXPB 1CUOA 5CPOA 3MNZB 4NHVA 5TGBA 3C6LB 5AC4A 5HDQH 4UV4H 2FSEA 3LEPA 2R2HA 3EFDL 1V3LA 4CADB 3E38A 4UB0L 3VVGA 5IFHL 3HG0A 2EE6A 1R46A 5GSVA 4HFWA 2R1KA 2EIMB 5DEFA 2BP8A 5F9WB 3EA1A 3SFKA 4BSWA 3KYMB 5FF0A 3X2QB 3J7HA 1K3ZA 2VC7A 4GYPC 4N0CC 1CB4A 5CCHE 5HI5D 4S1RL 2PGEA 2CA4A 3T81A 4IUOA 4FABH 5D1XE 3GMMA 5HDOA 3GNOA 4XPTH 5T5FA 4OHQA 2ADIA 4Q6IC 3W2UA 1TVBB 2LABA 4XXWA 2J74A 3QO0A 5AEAA 4JFEB 1LLOA 5CSZB 2DBLH 4XKMA 4B5XA 2I5GA 4AZCB 3QORD 4JPSA 4IOTA 4XRCB 3SOTA 1MMFA 1SY6L 4ILSA 1OEZW 4FTDA 4GZJA 5C0BE 1ZHBB 3LN5B 5IRPA 2R69L 4GW5A 1PKMA 1WBZB 1M7IB 3X3FH 2ZX9A 2R83A 5FXCH 1DBKL 4K3JH 3A47A 3KZPA 5FOOA 5E1AA 4I9XA 5EULV 3WYRA 1HXYB 3O0RL 5IJVA 4A6YL 4UM8B 3UBPC 1AJ0A 1MVYA 1WZLA 3HNTL 2EUXA 2AJVH 4FQCL 4OM0L 3PL6A 4FXSA 2OQJA 4QNEA 1KMGA 5D93C 3AYSA 2FB3A 3RN6A 2JCCB 4EUPG 3CUZA 4Z5RB 4GAYA 3ET9F 5EBUA 3BJ91 4XZIA 1Y5WA 4BDVA 2EDOA 5D7SL 5EOCH 2ZZ6A 4AX6A 3CVIL 1XQ4A 2X89D 2XFXB 4JANA 3WAKA 1MAML 3UGXA 4TVPH 1FWGC 3NPXA 1QI5A 3AG3B 4MKTA 4WJ5B 1YZZA 5F88A 1OSZB 2X42A 3TDFA 1T99A 4WO4C 5TJWK 3IETA 3B2PA 5DQ9B 2CALA 4KJQD 4YBLB 1XIFA 4XODA 2ZP8A 1GMIA 4RBPH 3PGDA 2R1LA 4R2GC 4JFFA 4JIQA 4UCGA 1TZIB 1I31A 2WBJA 4WDWA 1JP5A 3NFPA 4MAZA 4WTXA 3BWWA 4HSHA 3A4EA 1R3LA 4AISA 4MD4B 1J0HA 1S9XA 4N2YA 5DHYB 3GHBH 2H41A 1AUSL 4M7TA 5LN4A 2OMZB 4H00A 4XNXH 4LU0A 4LLAA 3BHBB 3N9GL 1A6ZA 4TF4A 1FNSL 5KJ7E 1O12A 5IB3A 1I8MB 5I75C 4FXKC 3W53A 3PWVB 2J9YA 1URIA 1W6TA 3ZDYB 4EXKA 4FX6M 3BPLB 3WUFA 3AY2A 1NFAA 3G6JB 3HS0C 3RL1A 4QQ3A 3R1ZA 3TTQA 5KZCB 5CC3A 4RGND 3W28A 4ELMF 1PWLA 4HX1B 1AIFA 5HAOA 1A3RH 1NMAL 4JFUA 1X9RA 2VEIA 4BK8A 5DRNA 1TENA 4IRJB 2YYTA 4AC2A 1FFPB 4XIAA 4H04A 3R7MA 3LKSB 1A2YA 4UAOB 5GGQH 3MNZA 2P5NA 3K6SA 1KKOA 4KW2A 4C56E 2VW6A 4XE0A 2PDJA 3WF1A 1ZTXH 3NXLA 4DJFD 1BZOA 2XM2A 4M1BA 1BAFL 2VDGA 3V9CA 4BWWA 1E9ZB 2E6DA 4W70A 4ZVJA 1Z8AA 3KLHD 3CEUA 1SOKA 1LEGA 1VCAA 1I7ZA 1PKQA 3G1HA 5K9QI 5ISZE 5L8KB 4Z3HA 3NQIA 1E51A 1BYDA 4X8JB 1D6VH 4AX7A 3I50L 2PDHA 1KRAC 2VDNL 1XDLA 2RIKA 3HFFA 3MVSA 4JEGB 3ORJA 4BZYA 2HROA 3QAZB 5JVLA 3S8HA 2R6OA 1A47A 3G5XA 4NP9A 2Y7QB 4Q0XH 2CSPA 4MB4A 4A8NA 1PZAA 3QCVH 1VLWA 3MJWA 3BAEH 4O02L 5C5YA 1DVYA 3BGJA 1JI1A 2QJGA 3B2UD 1IYXA 4GOSA 4FNLH 4Q14A 3AXMA 1CI1A 3P30H 4ZFOB 4KT2A 4LUYA 1OHLA 1D2OA 1M1XB 3KWWA 4LAQL 2B1AL 5DZAA 2AJZA 1SOSA 5CZRA 3MODL 3V5DA 4DP4X 2Y5EA 4MB5A 5SX5K 4NQCD 1W3NA 1W17A 4ADSA 4IT1A 4BK4A 4A37A 3WNOA 1Q9WA 1M01A 1F8TL 1JMZA 4KVNH 3URNA 3PAYA 5IF0A 3I2CH 1QNIA 4S3AA 5U7SA 1JNNH 4O5LH 3RAOA 3D25A 4XPAH 3NCYS 5L7XH 4IGBB 3PRZA 1TQCC 3W27A 3FBKA 3SO3B 4CMMA 1VS1A 1JHLH 3T65A 2L5HA 1AJ7L 1RHHB 2XN9D 2EUZA 1L0QA 3QZLA 5CR8A 2IQ9L 3SBFA 2QVTA 2GVLA 5L8LB 1VBJA 1SZRA 4HSNA 4IH3A 1EFXD 3VXUE 1PX8A 5ADOH 4TSAL 5JTWA 1PFCA 4X6DB 4LVHC 3N18A 1S3TC 4LL9A 3ZZSA 5K39A 3HG1D 4J3VA 2ED9A 2WC3A 2BRQA 1URLA 2XVKA 1X4XA 5J5EA 4XO6A 1D5IH 3LLFA 4GIYA 3DHDA 4UV7H 5E9AA 1F3DJ 2ZF8A 3FJNA 3F7VA 4MLSA 1XL6A 1RCXB 3WY1A 3DDMA 4Z2KA 5IW3A 4RH4A 4PJCB 3RB5A 2O9TA 2WNQA 2FGBA 3IDGA 5H37H 4Z7WB 3AADB 3B6SA 2FHBA 3VGFA 1VIZA 4L3FA 5CCGE 1BOGB 1S7WB 3AT8A 5LA0A 4H0IA 3M88A 3TN0B 3LIZH 4XCEA 1FWTA 1F3JA 3B0XA 1WWCA 5T1MB 5AUMA 4EUPA 5I1GL 1T5AA 3LKNB 3EWYA 3RCYA 3TH2T 3JU2A 3QUML 2GTQA 5HHOB 4WUUE 3WGVB 2BC4A 3L95B 3AGVA 2K9FB 3RBSA 2WNXA 2BIHA 4LV4A 3MMEB 2VIRB 5HYSB 1UA6L 3LI0A 3L3OA 5I0WA 4UDTA 4QXGH 4R7NA 1TJ0A 3WIIL 5CAYB 5C7HA 5DMYA 4X4XA 5DQDH 5LBGA 1KEGH 3BP5B 1IL1A 5HQLA 4QGYA 5BROA 2ZUNA 3FT2B 1Q85A 1U8QA 3DO7B 2BP0A 2XN2A 4F3FA 3MCG1 4UMCA 4GH7B 2L0DA 3ZN6A 2FJHB 2NQJA 3QQ9C 4GHRA 4LGSB 3CFQA 5JMOC 1ZT1B 4RBPK 1I82A 4C8XA 5JHLH 3CUJA 5LYRA 3QF0A 1AGEA 1IEVA 5KOMC 1OSPH 3RY6C 3F03K 1N19A 5GRVL 1LP9A 1LOLA 4UZSA 3BLOA 3CSBA 1JZJA 2QQNH 4WTZG 2WLNA 3O9WA 4CCDA 1DVTA 1FF5A 2NXZC 3LD8B 1MQRA 5U4NA 4EE9A 3TNOA 2OJZH 1FYTA 2XTSA 1TREA 1F1DA 1XMWA 4ORMA 2XFWA 1L6PA 1IAMA 1VJZA 4G3YH 3FQ4A 1RZ7H 1GZQA 3M47A 3CJJA 3FU0A 4KZEH 5KSBF 4UB9A 4U3CA 4NQVB 3Q8AA 4JKKA 4U05A 3M0KA 5F7YC 4ZTYA 1JXJA 3KBHE 4LUSA 4BWLC 3GBDA 3LPFA 4PS7A 1QWKA 3DPDA 3KLKA 2H9GB 1T1ZB 3C6LC 2VRQA 4HEME 5JPNB 3TOPA 3C6EA 3VFSA 3R1GL 4PRNB 4KUCD 2WXGA 2CZ5A 1EMTH 1NIEA 2E6QA 5F9WC 3OOQA 2K6WA 2UWEB 1HFBA 3LSCA 4B3EA 5SWUA 3VCLB 3MO1B 3QH2A 2Z34A 4KWVA 5CEZD 2PETA 3B0UX 1X9QA 4QSHA 1GJIA 1OFOA 2PTVA 4CCZA 1RLCL 2OKTA 4OLVL 1PVHA 4ACZB 4D9RD 1PS9A 3PTQA 2VW4A 1D7KA 1I75A 4FI4A 1M42A 3NQFA 5JOPD 3WIHH 1CS6A 4UUJA 4BELD 1R3KB 2GAZA 4I2XA 4Z7NB 4NUWA 5FHAL 9XIMA 3A22A 5AC6A 4A6GA 3TZVD 4NN6C 1A7OL 2ZXQA 3OTTA 5C1MB 2MQGA 1JNLL 3A4WA 3K2UH 4Q89A 1D9KA 1TPFA 4PB9H 3SQOL 1IGIH 2OULB 3TJHC 3GDMA 3CT7A 5A2FA 2P44B 3N2MA 1HNGA 4B5TA 3ERXA 3PREA 5F2FA 3UWYA 1EO5A 4QRPE 2MHAB 3ABLB 3M7SA 1UXSB 3OL2A 4IG2A 1T0NB 4M5ZH 1HILB 4KVPA 4L64A 2R1XA 1E71M 2XFYA 5CGQA 2HCVA 4AWUA 3TEYA 2NVAA 1GOWA 2YZ1A 4NM4H 3N29A 1TJGL 1UZ6F 4GG6B 4AKOA 2AVGA 5LGHH 2BX7A 4ADUA 3QEHB 4DOHB 6PCYA 3C2VA 4KQ3H 4OZFB 3GSWA 1PY0A 1QQDA 1PKYA 3K2MC 3HC4H 3NFNB 4NBZB 1EXGA 4R3UA 3MQTA 4J6RH 1NAMB 1AL8A 3SZ8A 4FS0A 4F1SA 4F8NA 5DO8A 3QIUB 1T7XA 3O3AB 5MEOB 2G95A 4JLRB 1BWWA 3L1GA 1S7UA 5CH9A 1EOMA 2VLKA 5E0KA 3PIQB 4NJ9L 4YBLC 3T4AA 5TNVA 3C0LA 3PZOA 1FN4B 1UHVA 4JDVB 3H6OA 1EGVA 4Y9AA 4K5NA 3JV6A 1HH9A 4DKFH 1KM6A 3LBOA 3RNKB 3ZZLA 4PY7A 4A7QA 3V5HA 1BVZA 3OVPA 3FT2A 3ZJ7A 5E0CA 3KEDA 4Z1CA 3WBEA 4AY0A 1FKXA 2Y7GA 3T0EA 1X97A 5T3XH 3NQVA 1ZJBA 1UQSA 5ACLA 2GGHA 2FJHA 3N0PB 2R2EA 5H2ZA 3ZHLA 4GSXA 3CLFL 1W37A 4NZFA 1QP1A 2ZG3A 4CC1A 4NBYB 1QUNA 3WQPA 5J3HC 4AJWA 5T5FH 2NV2A 3BPLC 5CBEB 2G96A 5IBXC 6ALDA 1AW2A 1AGDB 3KLAA 4P07A 3GMQB 5BOOA 1PCSA 1OK6A 2HRPL 1BQLH 4WFFD 1FYHB 2CBMA 2EXSA 4PJEE 1CF8H 1HEHC 4L9ZA 4JPIB 4H9VA 4Y5VC 5AAMC 4H20H 2P46B 4GQ9L 1CE1H 4IK6A 4IRJC 3MTWA 2IBBA 2HN7B 1U8JB 4ZXOA 2WW5A 2KDYA 4YYCA 4UAOC 2QPUA 2RHGA 3WQGA 4WWPA 1E5AA 3TA9A 3CN2A 1TTQA 4LCIH 3UBXI 1WTLA 3LRGA 1L6YA 1UWXH 1WITA 4KK8C 3IACA 1N4XL 2FEDC 2Q3RA 1OGBA 2OX4A 5EFIB 4GGHA 4XTRD 3AMCA 1CG9B 1J5CA 3V35A 4KZDH 4YWIA 2CLVB 3R12A 5I3KA 4KXCA 3C2OA 4DP2X 1NCOA 3OF6D 2CUAA 1SPDA 4JN2B 3AVEA 3H2MA 4QQUA 3L21A 4UFHA 4L29B 3GZOA 3RL2B 3KVJA 5DCCA 4X5LA 4PBVC 3IFNL 2FB2A 3HGOA 3MCKB 5HHVH 3GRBA 3D3AA 3MRMB 1NC4B 1NCCH 3GSUB 3IMUA 2WMPB 4NO0A 3QAZC 1HIMH 3P0VH 3F58L 3KPRA 1FC2D 3SQMA 1T2QL 1QNOA 3BOLA 4J5NA 1T66C 3HGRA 3N73A 3GXDA 1NMBL 4WTZA 3IJ6A 2X9ZA 3CFUA 1OK4A 4P5RA 1AG6A 5CD3B 2XACC 2XGIA 5CZVL 1J8KA 1LO4H 5A3IC 4HSAC 3TFKC 1KXQA 2ICEC 3M7OA 4P5MA 4NILA 2NNAB 1XXFC 3WTXA 3E6FB 1W2VA 5HHMB 4MJMA 3UY8A 1OIOA 1F6AB 2VR2A 4PB4A 2H0PA 2I1OA 3Q8FA 4PFHA 2H1LM 2GY7B 3MRDB 2DICA 3EPMA 3FU7B 3V0WH 1PG7X 3NZGA 4TVCA 5C2GA 5BZWA 4NNPH 3X11B 1DLFL 4XZBA 3QUKA 1WICA 4K7PX 3ME3A 3P74A 1X44A 1MQ8A 5JPMB 4G8IA 1YLBB 3QEHA 3MRFB 5D7LB 4JPKH 3SO3C 5IVZA 2RTTA 1M1SA 3NSNA 1KJ2A 4GFTB 5D4YA 2VX7A 1OXYA 1RJZB 4G6JH 3C5ZB 4I5XA 2F1AA 3B43A 1R5IA 3QDJB 4HQQH 4K3EL 5C0CD 1UWAA 2CJUH 5FB8B 1L9TA 2ODOA 4LASL 2ZDSA 3WD5L 1GJUA 4E8GA 3B8DA 2VCBA 3AG2B 1ANUA 3O3DB 5D72L 1MCWW 6XIAA 1MW3A 1RK0A 2R24A 4BFKA 3RY4A 2HP4A 2Z0BA 2JJSA 3NA9H 1BJ1H 3G5VB 5MI0B 1FKWA 4NX0A 4JHOA 2WXDM 1FO0L 1FVCA 4EK7A 4K1WA 3OBKA 5GHWL 1R33A 4QHNA 3T8XA 5FUZL 2PDWA 2D3VA 1MUJA 4ADTA 4UAHA 1IAII 1WVZA 2B77A 3PNWB 4TUOB 4MNQB 2Z0IA 4D0CB 3G3LA 1HUVA 4Y96A 4AVFA 3VGDA 1NOWA 1DQWA 4HCFA 4DGIL 3O07A 2IGFH 4CVZB 4EMZA 3SGUA 4LVNB 1SQ2N 4IHOB 4O57A 2QL1A 5FF6A 4JS3A 1EGJL 4P2RA 3D3VA 1ZAIA 3BP6A 1CTNA 5H2BA 4PCFA 3IJLA 1I1WA 1FX6A 1WZMA 4Q6YA 2PMQA 4C6LA 2IFFL 3SE8H 4DGYH 5C0RL 4U5KA 4HPYH 2XKUA 1BOYA 3GW3A 4MD0A 3D85D 3OV6A 2E59A 1V02E 5LXVA 4A2RA 3TPUB 1VBGA 3DI1A 3B2VH 1HWWA 4QBXA 4TV3A 2CLZA 2PF0A 1E9OA 4LSVL 4JE4B 4HHAB 2F1BA 5E4IA 1T40A 4O1BA 4HKPA 2P7TB 3U4BH 5C6TL 1TZZA 2X41A 1SR0A 1XC6A 3UWQA 4K8HA 4LO9A 3S5ZA 4EPKA 5DD3H 1CC3A 2PDIA 1KN4L 1I3UA 1KYUA 2D7MA 1SDDB 4N8CH 1HEJC 4OKVB 2I07A 4DCQA 4GRLA 1NDWA 4XVDA 5I77A 2GVJA 4PUMA 2EUVA 1A4MA 4OFQA 3H2OA 5EO0A 4Y9BA 3GQFA 3O8XD 3Q8CA 2X4QB 3MLWL 2PPCA 2E6YA 4OJDH 4U49A 4PJ8A 3R8RA 3AWOA 3QMSA 4YUEH 2Q09A 3NQ7A 2CKBH 2FWOB 4XSMA 2IFGA 3GZQA 5CD3A 3K74B 4AGMA 2BZNA 1B4JH 4PCKA 4M7SA 1UUSA 1UWEH 5FL1A 1ACYH 1MZZA 3O0LA 3DJSA 4M7LH 2LE9A 1T1YA 1GW0A 3NR0A 2BW5A 3BJTA 4MHBA 2GK1B 1AQKL 1MFUA 5JPNC 3ZE1B 4FZEL 3CAFA 3VJ6B 3PDOB 2NLYA 3M07A 5DUPL 5JYMA 5F3BB 2Z91B 3CQHA 4O1DA 2ZZ3A 3ECQA 2I27N 5LJYH 3D69A 5DJDA 4FKKA 2QHRH 3NN8A 5KSUA 2DJUA 1U8LB 3ZDXF 2WXRA 3MZGB 2NR6D 4GO8A 2Z8RA 4W93A 4JRXB 4OLWL 3SCMB 4O1FA 2MQ0A 2Z93A 3R06B 5CINH 3CFBB 3AQDA 4Q8OA 2ICWA 1UWXK 5IQ9A 1AQFA 1OF2A 2VLRB 5BRBA 3Q6FA 3AXKA 1SHWA 4WW2A 1C5DB 5HGGS 2NPLX 3T08A 2INZA 1IEWA 1IT8A 3VE7A 1S2VA 4TTUA 4NPYA 4P7OA 2ARJB 4NOBA 5IVXE 4N86A 4ONVA 1A4JA 4Y2DA 4G9FD 1RJZA 5IM7A 3GHPA 1LT8A 4AV0A 2OV0A 4KJPC 2PWEA 4WXZA 5FR3A 3NPVA 2GYIA 4N0RA 4ES9A 4AXWA 2E67A 4OD1H 4S39A 2C1PB 5D1ZB 5T3ZE 4ODHL 4I7WA 1K2DA 2AGJL 2YGYA 3AU1A 4XNYL 3H55A 3KBMA 4C5YA 2GEQA 5HJDA 4WOQA 4KQNA 2R1WB 4Z0BH 4LEBA 4N8VB 3TQKA 2PBGA 4PCNA 4AQAA 4OFIA 1RD5A 3NQAA 1ROWA 4LAMA 4WY7H 2WXFA 1JRHL 1BFSA 1I9JL 2VLJA 3PNWA 4NUGL 3UG8A 4TUOA 4Z17A 5KYYB 3GE7A 3P1VA 3EBGA 3BQVA 4BH7A 4C54A 3ARBC 3ARDA 3HOGA 4XVSL 1XG4A 1VP5A 1VFFA 5A6AA 2FFCA 2XU2A 3PDDA 3VXRE 2FPTA 3ITTA 4LSUH 3B1UA 4IBLT 1ADQL 3QIUC 2XTJB 5BMFL 5F1IB 2OZ0A 1P9MA 2QMKA 1QG3A 3QUYA 1S7TA 2Y7LA 4O15A 4HK3N 1IARB 2IOMA 5D38A 2JB5H 5FKAB 2AQWA 3ECBB 1BWVA 2PLMA 2O0TA 3B0PA 2OCCB 3B8SA 4HG4J 2EDKA 3V0TA 1W1A1 4LSTH 1PV8A 1AP2B 4PMEA 3AC0A 4MMXB 3FFCA 5AOUA 4QY8B 1S1PA 2DZAA 1V0LA 2W3ZA 2QPDB 4JM0A 1M6JA 2HH0L 4LP8A 3V18A 5KVGE 1X7QB 3GO1H 1YDVA 2FDSA 1J48A 2H6RA 3VNDA 1OVDA 3QQNA 1X96A 4OF8A 1XX1A 4ZXBB 4OIBA 1ZUAX 3CZGA 3UZVB 1N6QL 3FH5A 1E4KA 3KLSA 2OTPA 5MENA 3PCYA 4QYOB 3QHZL 2UZXB 5MEQA 5KAQG 3ZDYF 1H11A 3K80A 1NUFA 3QW3A 3BIKA 4YNYB 3NTCL 1RZIA 3KYOB 4Z0SA 2MWCA 2N7AA 3DFTA 4YHYB 3EDDA 3GSXB 1IXPA 3RVTC 3UPBA 1PDKB 2IJ0C 1V7YA 4B9YA 1AO7E 4H5SB 1MAJA 4ZUSA 3CSYA 2AK1H 5ALBL 2IOIA 2OTWA 2D23A 2GW5A 2OLDA 4IEFB 4PUNA 3T9WA 1G5AA 4X4YA 5TQ0L 2XVGA 5J57B 2R15A 2Z1BA 1HL5A 3KS0J 4NZDA 2C5DC 2VSKB 3LKRA 1T1WA 1TPXB 3LOTA 3GRGA 3CV5A 4P23B 5KG9B 1MNNA 1MXDA 4Z7UE 3MROA 1G67A 3L12A 2IPUK 3FO2B 4RMSA 3TH6A 1ORQB 5MP6H 3EJRA 4XWGL 3AQYA 4MA3A 3RLSA 4AGLA 4R96B 4ONHA 2NY0B 4B15A 3UDWA 3MLSH 3T2QA 4WNQB 3EOOA 2A83A 4HC1L 4L3EE 3RZWA 4JG1L 1JFQH 3UJTH 4MMYB 3HN8A 4M6UA 1WAPA 3TH3T 2ED6A 4M19A 5AKVA 2PF8A 2AMUA 3BIAX 1NY1A 2PTXA 4GIPD 1WA0X 4ZG1A 4YXGA 2X4RA 3GHTA 4ZSOE 4PP1C 5DUBB 2ZRVA 1G4TA 4NKOA 1XF2A 3UETA 3VFPB 1FZKA 4GKTA 4NRZA 4DJED 5AWNL 3V0IA 1F1GA 3T77A 1RCOB 3IGUA 3JUYA 2C8NA 1PCKA 4C1NB 2RMNA 4ZMOA 2W9DL 1PAZA 2AK4B 1MDLA 3PAUA 4XVJH 5I1IH 2NDFA 5I71C 1FZOA 1FV1B 4PRIE 2JIWA 2GSGB 2CHNA 5I15H 4YTRA 1IEBA 3WQDA 4WSKA 1MG3C 2WIMA 3DMMC 5C92A 3B1TA 2X0WA 3W7DA 2XVLA 3IMSA 4WHYH 3UJIL 1H6EA 5CEZL 1MW0A 5E8DL 2BXVA 2FO1A 1QNVA 1F2JA 4FFTA 2ZUQB 4TNEA 1A5CA 4Q8WA 4PPTA 1INEL 2GJJA 1OP4A 2CLHA 1KTRL 5JPMC 1MNZA 4JICA 5AD0B 1KIQA 2PC4A 5K5YA 4Q9RH 3IGFA 3IN0A 2KLSA 3K72B 2PTYA 1Q6DA 5F4XA 4AU0A 3NPWA 1LDCA 2Q6ZA 3IMTA 2ZOOA 4GXVL 3CLEH 3DX0A 3C5ZC 3ZL2A 4ZNEE 5D32A 4DZBA 4WSHA 3P8IA