3L4WA

Crystal complex of n-terminal human maltase-glucoamylase with miglitol
Total Genus 270
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
270
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 270
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4wA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4wA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4wA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4wA01
2QPSA 1FP8A 5KZ6A 1AQHA 4P8UA 4AZGA 1JYNA 3KL0A 4HPHA 1V6WA 1CGWA 3FXYA 3AHYA 4H2CA 3L4UA 2Z1SA 2BV9A 3BAKA 2EBNA 2XPKA 3AXHA 3BAIA 4JCMA 1VENA 3W4RA 1BYBA 1XH2A 4NSBA 1PBGA 3S2CA 3UESA 1XV8A 3AIRA 3SUWA 2EEXA 4AZCA 4PUEA 1JZ2A 3BAYA 4P8XA 4BF7A 4NX0A 2PWEA 3VVGA 4Z2LA 3PZVA 2EABA 3WFZA 4GZIA 5EBAA 4J3VA 2ZUTA 1BVZA 2EADA 5CZKA 1JF5A 1TVPA 1K6AA 1UWRA 2EQDA 3AZSA 2YA1A 1WO2A 1DWGM 3CZ8A 1TQTA 5E70A 3CZKA 2E3ZA 4KRUA 3BVWA 3AQUA 1TFVA 1KGXA 2EPOA 2J7DA 1AMYA 3WF0A 5FOOA 4ZE5A 1QX1A 2YL8A 4AWEA 3BVTA 4TUFA 4FLOA 2VUYA 1R86A 1PX3A 3D3AA 1M01A 3TTOA 4ACZB 2HVMA 4EAMA 5D8ZA 2ZXDA 3BVUA 2FDMA 4UFHA 1OM0A 1CXHA 1VFFA 4CN4A 5DFAA 4Z2HA 3VDAA 5A2AA 2A3BA 3EDJA 3WNMA 5DT7A 2BY3A 2WMFA 2DSKA 3GXFA 1SMAA 4AD1A 3AYSA 1PIFA 2CETA 4DUXA 1HVQA 5JBFA 2F7RA 3W6LA 4W7UA 1V0MA 3PZTA 5A69A 3WENA 2WPGA 3AS2A 1LWJA 3GBDA 3UERA 5JUVA 3FHQA 1VB9A 3W25A 2YLAA 1UA3A 2E9LA 3CMGA 3L2LA 5IFTA 2WBGA 1HXKA 2GK1B 2WC4A 4NXKA 2OSXA 1MFVA 1NWUA 1HKIA 3N17A 4Q7NA 2G3JA 1US3A 1J01A 3BUQA 4NI3A 4GZEA 1GOQA 1J0IA 4PMYA 1H11A 2WBKA 3OZPA 4IPNB 4GQQA 3CLWA 4A3HA 3N13A 2YBTA 3QHMA 1GVYA 2RGLA 5D8WA 4UZUA 4UFLA 1QWUA 1PX8A 1F4HA 4MNJA 4W5ZA 4JIEA 1U30A 2WM0A 4M24A 1XD0A 1CNVA 3LRKA 3VU2A 4B16A 3A3HA 2PI6A 1TA3A 3WELA 3OLGA 2CYGA 3AS0A 4L4OA 1W1YA 1E0XA 1X6LA 3NSNA 4PMRA 1C92A 4B3KA 4PMXA 2EACA 1R7OA 4D6EA 4FNSA 4W86A 3WD1A 2VTFA 4AMXA 3GXTA 4X9YA 1V02A 2JEQA 3CBWA 1CZ1A 3GNOA 3L4ZA 4UZSA 1ZL1A 5LYRA 3VOCA 4OZOA 4MB3A 1ECEA 3BGAA 2ZUWA 3CZNA 4KH2A 2W67A 2WCSA 3GDBA 1BFNA 4JZ5A 3DX0A 4UCFA 1QI3A 1QNPA 1CEOA 4PEEA 4AXNA 1L8NA 4AZCB 5CPTA 4HA1A 2V5DA 2VCAA 5GNXA 4CCDA 3AMCA 4PMZA 3HG5A 5HXMA 3ZJ8A 1OSEA 3A24A 5M3WA 4ACYA 3WD3A 3WDQA 4A3YA 2WB5A 3SCTA 3T2PA 1E3ZA 4K68A 3GBEA 1OB0A 4H04A 1W3HA 5A6SA 3CZEA 3AS3A 4JFTA 1UZ1A 1AQMA 2X2JA 4IM4A 2JFEX 2WMIA 1B3VA 4UNIA 1E72M 2OWWA 4MADA 5BXPA 7CGTA 1FOBA 2DSVA 4HU0A 1DP0A 3KZSA 3OZOA 2CHOA 4IISA 1J9YA 1JD7A 1UWSA 3BVVA 5KEZA 4URIA 1WZLA 5AYIA 3CH9A 3AHVA 2A3HA 4JFWA 3LRLA 3NCOA 1JI2A 3EJQA 1W91A 4OBSA 4H8HA 3T09A 4LQ1A 1XSIA 2ZWZA 1QOXA 1BAGA 3LXAA 3EDDA 4CN6A 4W87A 3WEOA 1E56A 1V02E 1UD8A 2Z1KA 4XZWA 4FNQA 6CGTA 4AD4A 3H53A 4FNPA 3TONA 4GKLA 2E4TA 2DH3A 3WD4A 1UD4A 1NWTA 3LPGA 1HNYA 1ODUA 1HKMA 2X8RA 5DT5A 1G01A 3SCUA 2DT1A 3WL1A 3WH5A 2DSUA 4D6IA 3D50A 1E6ZA 1IZJA 2VNCA 1KXVA 3VD5A 1PZ2A 1OIMA 1AVAA 3VGFA 2E40A 3SCRA 2YDSA 1PS3A 1GHRA 2AMGA 4PN2A 4PSRA 1JGIA 2ZWYA 3I3DA 3G6MA 4NZFA 2PWDA 1Q6CA 2OLHA 3ZO9A 2WSPA 1BYAA 1XSKA 4H8VA 3AXXA 3GH4A 3HMCA 4DUVA 1UZ4A 3W82A 1LG2A 1B3WA 4H8UA 3VMOA 2CBJA 3PZIA 2WVTA 1E40A 5HNNA 4U3CA 3S6TA 2C7FA 3N11A 3SIMA 2F1AA 5BXRA 4M1RA 3IAQA 5A94A 5CGMA 3WY1A 2PWGA 4UTFA 3WF2A 3QR3A 3CZLA 2GK1A 3WD2A 3IJ8A 1OCQA 5ECUA 3WBEA 2VVNA 1OGGA 1CDGA 4J3UA 4U3AA 3FAWA 4LX4A 2ALWA 4TOQA 3BCFA 4OIFA 4KRTA 4OBRA 3AXIA 1XD1A 3WH9A 1Q6FA 4TTUA 1C93A 6TAAA 3SUUA 1NOFA 2O9OA 3F5KA 3T0AA 4CU7A 1A47A 1BHGA 2W66A 3AIEA 5BXTA 4PCSA 1UKPA 3OBAA 1JNDA 1G5AA 1TG7A 2F18A 3K8MA 1VBUA 2UWFA 2AAAA 1K9DA 3BVXA 2V3FA 1F4AA 3ZQ9A 1WP6A 8CGTA 1BTCA 1J0JA 4KWUA 3PZUA 2XSBA 3OB8A 5CXPA 3HU7A 2ZUUA 1E6SM 5C70A 3RPMA 3W81A 1WDSA 3L4YA 5M5DA 3W0KA 1E1EA 3L2MA 3EMQA 4CD8A 2VZTA 5A2BA 4BS0A 4FLRA 1PCPA 3T08A 3ALGA 2YOCA 2JIEA 3L4XA 3CTTA 2BHUA 2QMKA 2E8YA 1V3IA 5CQ1A 5FKYA 3VD3A 4R27A 4AYGA 3THCA 5TD4A 3EYPA 1T0OA 2OYKA 4S3JA 1IT0A 2YL5A 4UQ9A 4CGTA 1QNRA 2ZICA 2XN0A 1C3FA 2A3CA 1E1FA 2CCRA 2JF6A 5CSYA 4YHEA 5FIPA 3VIHA 2O9PA 3A5VA 1ZJBA 4MAVA 3OG2A 2XUCA 4V28A 2WC7A 1ESWA 1PAMA 2WLZA 2EPMX 2WXDM 2DIJA 1E5JA 3FHAA 4IUGA 1FFRA 3T2QA 3ZOAA 4GZJA 2GDUA 7A3HA 1BGGA 1Q6EA 2F7OA 2VR5A 2ZX5A 1KB3A 3O2LA 1HKKA 2BHYA 1PS2A 1KQYA 3WIJA 4D6FA 1BSIA 3L4TA 3WNOA 1J0HA 2YKKA 3MMDA 3OGRA 4MNLA 2XTKA 1OIFA 4W7WA 5M17A 1MXGA 1EQCA 2ESCA 4JFSA 5GQBA 1E15A 5A6KA 3FY1A 3VIPA 3W53A 1OINA 3EMCA 3LPOA 1VBRA 3WDJA 1ZBCA 1QHOA 2C0HA 2QV4A 4W84A 3J7HA 5AYBA 4CN1A 5JBDA 1JG9A 3GXIA 3LRMA 3LPPA 1ZB5A 3W26A 1VFMA 3KLLA 1B2YA 1W1PA 2VX7A 3WMSA 4P7LA 1WDQA 3W28A 1E9LA 1B1YA 2DT3A 2W91A 1D7FA 4A4AA 4UQBA 2Y8KA 3U7BA 3LXCA 4MB1A 2A3EA 3VD4A 1Z32X 3TP4A 3HG3A 1W2PA 1ODZA 2XVKA 3DYMA 1LG1A 4MNMA 1GPFA 1W3LA 5FL1A 1GQIA 4TX8A 3IJ9A 2FHCA 4F8XA 3AJ7A 3EJRA 3BLPX 4WKAA 1GONA 4PTWA 2OW6A 4IPLA 4LGXA 4WK9A 3PTKA 2WLYA 3IAPA 1R34A 4QFUA 1B0IA 5CLTA 2PBOA 4CD6A 1JYWA 1UH2A 5BRPA 3RJYA 4HMEA 3O6AA 4OOUA 4LYPA 1B3YA 3RMEA 4JHZA 2D0FA 3NDYA 2WK2A 2WZIA 1UH4A 5GNZA 2YA0A 3L4WA 3ZR5A 3WF3A 1CENA 3AMDA 1HX0A 3T0BA 4HP5A 1UR0A 3PZ9A 3U57A 1G1YA 1W2VA 3MMUA 4EANA 2JIWA 3VGGA 2PB1A 1K9FA 1QNOA 2X2IA 2WANA 5D9PA 1HJWA 3F4VA 3BAXA 1XCWA 5AY7A 3SUTA 4F79A 2ZIDA 2WC3A 1HT6A 5A8NA 5A8MA 4JCLA 5JBEA 4CD4A 4CU6A 3VM7A 1VEMA 3AHZA 1MQRA 3HZ3A 1PPIA 4KGJA 1G0CA 4Q22A 3IJ7A 1ZJAA 3SCOA 2AOSA 1B3ZA 1ZU8A 1E70M 2VURA 5ABGA 4M56A 2JE8A 1UG6A 3KWXA 4GQRA 2WYSA 2DIEA 4CUCA 4MDOA 2WAGA 5ABHA 1EHAA 5CJ5A 4PCTA 2DQXA 1SMDA 4ZXOA 3OLDA 4D6CA 4X0VA 2FHBA 3I3BA 3MKKA 1H41A 4HOXA 1QI5A 2V3GA 3SURA 4JKLA 4AZHA 1HF6A 1RD6A 3QHOA 4P8WA 1NQ6A 2NW0A 1J11A 3EDEA 3BLKA 4AIOA 1CBGA 4MB5A 3WUFA 1TQWA 1W9BM 3BC9A 2E0PA 1K9TA 2YFNA 1KTCA 3B9AA 4QP0A 5CPSA 3BLBA 2C8NA 1LJYA 5EB8A 3WQVA 1QBAA 4N42A 2VX4A 1VFOA 3WH7A 4B3LA 4HMDA 3VNZA 5D9OA 3N18A 4CVUA 1WZKA 3DYPA 2ZOXA 4B9YA 3BAJA 4OOZA 2BNJA 4XX6A 1C7TA 2GUYA 1CECA 5GPRA 1PSPA 1KR0A 3AIQA 2QLYA 1BVNP 5E9AA 2WHMA 2BXZA 4JKMA 4PUDA 4QDMA 3KL3A 1VF8A 2W92A 3U5YA 3OLIA 4HA4A 3UCQA 3ARPA 1XC6A 3BUPA 1JL8A 1RPKA 3VIJA 2V5CA 3UETA 4D1JA 2VJXA 4HZ6A 1XGZA 1B9ZA 4YHGA 3D4ZA 2DH2A 3IK2A 4NXSA 1XCXA 3PTMA 1QWNA 1KCLA 4U33A 2J74A 1KFWA 1DEDA 3ARUA 4AISA 3POHA 2W61A 2XM2A 1GJWA 3UEQA 1E73M 1KXHA 2DT0A 2FHFA 4AZIA 3MV11 4U2ZA 1B30A 1KBKA 3MUIA 4MPKA 3VMPA 4E2OA 2XIBA 2G3MA 4JAWA 4RE3A 2E9MA 2VCBA 3PHAA 3SCVA 1JF6A 5JIPA 1TQVA 3NYDA 4AD5A 2GFTA 1QNQA 1H2JA 3WNPA 5E6ZA 4ATWA 3AZRA 3N1AA 5E6YA 3DYOA 3WUEA 4GI9A 3BSGA 1HJQA 1KTBA 1QNSA 1HIZA 4FF5A 5I77A 1NM9A 1SFSA 5IDIA 2XM1A 3AYRA 5BRQA 1GQJA 1JZ7A 1HJXA 1WPCA 2G3NA 1O6IA 1JXKA 3N9KA 3MI6A 4ZXLA 1PX4A 2GJXB 2X05A 2XFRA 2XN2A 4OGZA 1H09A 4GO8A 4QLLA 1JAKA 3A6OA 1XH1A 4AIUA 1JIBA 2FE0A 2A3AA 1Y7VA 4AMCA 1JDDA 3BXWA 2PF0A 4J3XA 1EOKA 5CGTA 2XFYA 4BZYA 2ZE0A 4UFJA 3WDIA 2WMGA 4BQ3A 1CYGA 1JYVA 1JZ8A 4W8BA 1KWGA 1UD2A 3G6LA 4MNKA 2GJRA 3II1A 3ARSA 3GM8A 5F7UA 2IGTA 2XIIA 3NSXA 1QVBA 3AI0A 1U2YA 2OWXA 1PEZA 3ECQA 1R8LA 4GPNA 2BVDA 2VO5A 5E0CA 5I0DA 1W3KA 5BCAA 3TV8A 1OGBA 4MTVA 1MQQA 1WDPA 2EPKX 4FK9A 1CXEA 3CHCA 1UR9A 1UQZA 1JDAA 3BUBA 4ATDA 1GQLA 1HWWA 1VEPA 5A6JA 3WEMA 1KCKA 1HL8A 1D2KA 4NZJA 2XYLA 5I2UA 1CXKA 1SZNA 2VX6A 5CLWA 3B9DA 4M29A 1LL6A 3KE0A 1DWIM 2D2OA 4TVDA 2DT2A 1E4NA 5HDRA 1V6XA 4D6DA 4BQ2A 1M7XA 1TA3B 3ZJ6A 4CVWA 2VI0A 1E9TA 1W9UA 2O92A 2XHYA 1QHPA 2JF7A 1EH9A 2BS9A 1OBAA 2J62A 3AS1A 3W37A 1X6NA 5ABFA 4ML4A 2J7GA 2MANA 1SR0A 2NT1A 3HG2A 1EXPA 3BSHA 1NOUA 1B90A 3DX1A 2VC9A 1MXDA 3K4DA 1UR4A 2PBGA 1NOWA 5D9NA 1FP9A 5I3DA 4PMVA 3O9NA 4WSKA 4NRSA 2VRKA 2D3NA 3PBGA 4MAZA 4W88A 2ZXQA 1J10A 5A95A 1BPLB 1IZKA 4UFIA 1UUQA 2X09A 3KL5A 2IXVA 2V3EA 2Y2WA 4PMNA 4AD2A 3PZNA 5CPQA 3RM8A 4GINA 3ZSTA 2VX5A 3CIVA 3OGSA 4LPCA 2UY3A 2V3DA 1UA7A 1VJSA 1RP9A 1HKJA 4CD5A 3THDA 1E4IA 1H1NA 1TE1A 2ZUSA 1I1WA 1HI7A 4FLQA 1N82A 4F9JA 5I79A 2CPUA 2XJ7A 1JZ6A 2CXGA 3A23A 2PC8A 1LWHA 3GNPA 2J75A 1WCGA 3CMJA 4AD3A 1V3MA 1WKYA 3I3EA 4TX6A 3ZJKA 3PTQA 2BY0A 3CUGA 4FLSA 1GOWA 1J0KA 1LL7A 3ARWA 3ZM8A 3DDFA 1EIBA 1TQSA 1PZ3A 4FNUA 4AZBA 2D0HA 1D3CA 3VGBA 3CPUA 3M46A 3DX3A 1KR1A 4D1IA 3UR7A 1BYDA 4NF7A 4XB3A 1LL4A 3N12A 3VTRA 1JI1A 4EKJA 2OYLA 4QLJA 2VRQA 4E8DA 4TTGA 1UOKA 4NRRA 1UQYA 1VJZA 2G4FA 4AZ7A 2D24A 1US2A 4PSPA 5GNYA 4P7OA 1E0VA 2Y8VA 2YL9A 4P7NA 1CGVA 1GQKA 3WH6A 2WHJA 1R87A 3BUIA 4DO5A 3MUY1 2DSZA 3SUSA 3RJXA 3AOFA 3WN6A 1J0YA 4UQEA 3CHEA 1KQZA 3WH8A 1TCMA 2CBUA 1XYZA 5EMYA 3VSUA 4LYRA 2VZUA 3QHNA 2CITA 2WZEA 3U7VA 1PIGA 1KWKA 1FH9A 3AHTA 4X0NA 1E55A 1Q6GA 4QAWA 3CUFA 1CPUA 3ARTA 2J7CA 2OWCA 2VR4A 3PZOA 2YDRA 3RM9A 5BXSA 1Q6DA 4PTXA 4TXEA 5EFFA 1NP0A 2YJQA 1C8YA 4W93A 2D20A 2X1IA 5A6BD 2WCAA 2CKSA 3N04A 1KBBA 2QPUA 1GNXA 3AMLA 1WNOA 2RGMA 3MMWA 1ISXA 2CEQA 2F2HA 4AEFA 4JHOA 3W29A 3WQ8A 2J78A 4MB4A 4OJYA 3H54A 4W8LA 3ZIZA 1QBBA 3T2OA 2XVPA 3B9EA 3RDKA 4B15A 1IV8A 3WL0A 4R5EA 1WAWA 5DMYA 4PMQA 2G8ZA 3TA9A 4TVUA 4C7GA 1V3JA 2JEPA 2WMKA 4M81A 1W1TA 4MJ4A 2XN1A 1XRVA 3VUPA 3FAXA 1V0KA 3VDHA 3CUHA 1YHTA 2GDVA 2ZUVA 3WNLA 3ALFA 2ZUMA 2CNCA 2EAEA 2DSWA 4DM1A 1BF2A 2VT0A 1HJSA 1V6VA 2CBVA 4Z2GA 2O9TA 1E4LA 1AQ0A 1E4MM 4AW7A 4HTYA 2WNWA 2D23A 3VIOA 1VRXA 1H0GA 5AC5A 2X2HA 3GH7A 4UQAA 3AICA 1NWSA 5A6AA 2NT0A 4WF7A 3F5LA 1X1NA 1UKTA 2WKGA 3VGHA 2ZX7A 3UR8A 2FH6A 1QI0A 4JFUA 1FH7A 2D1ZA 1QW9A 3CV5A 1UASA 4FMVA 1O7AA 3AMKA 2X0HA 5DEZA 3ZSSA 2VOTA 5FCZA 2BVTA 3EMZA 1QPKA 1L0PA 4M80A 1E3XA 4AZ6A 1FHLA 5A6LA 1PJ9A 4J3WA 3RILA 1E6XM 3FN9A 2D22A 3WNNA 2J47A 3VILA 3ARRA 4DO4A 2XGBA 3BUDA 1R7AA 1ISWA 2J79A 5ABFB 2WHLA 3PZMA 1LLOA 3ARXA 5HBFA 4J3SA 5HPOA 3VSVA 1UKOA 1C90A 4HA3A 5A6BA 2W63A 3EJTA 4DUWA 2CIPA 2EPLX 2J7EA 1KXQA 1MWOA 3VO0A 2VL4A 1M53A 1V0NA 4PBGA 4HOWA 2WKLA 3VX0A 2ZXAA 2VRJA 3VD9A 1UKSA 3SCPA 3LX9A 3K1DA 5JIWA 3WQ6A 2VVSA 2ZXBA 4QLKA 1ZBVA 4Z2JA 1WB0A 2YA2A 4ZENA 3BMVA 1JAEA 3LPFA 4RE2A 4RL3A 3NUKA 1DHKA 3D51A 2W62A 1RH9A 4H7VA 3GXMA 4PMOA 4E4PA 2IUZA 4F66A 4UQDA 8A3HA 3WF4A 2XG9A 2GSJA 3VIIA 4UOQA 1W9VA 3GZAA 1TMQA 2VQUA 1UD5A 3VDBA 1R75A 4AIEA 1BG9A 4ZEPA 3DHPA 3N15A 4DM2A 3AISA 1R33A 5I6SA 5E1QA 1H0IA 3F5JA 1EO7A 3VSTA 3ZT5A 2IXUA 3GXDA 2YDQA 4XV0A 1U33A 4U2YA 4MJ2A 3SCSA 1G94A 4UFKA 3W24A 2OYMA 3IGUA 2BXYA 2WMJA 4DWSB 4DWSD 4HZ8A 4PTVA 5A2CA 4UR9A 3VGDA 3CC1A 1KXTA 4HOZA 4NZCA 3W38A 4PYSA 5HOSA 4FNRA 2Q8XA 3B8SA 5I78A 4V27A 4AY1A 3A47A 5C8BB 1JD9A 1CGXA 3K4AA 4UQCA 3WKZA 1DTUA 1MQPA 3NSMA 2G41A 4WJXA 5IHSA 1MYRA 2OSYA 4PMUA 1OT2A 3WDHA 1HXJA 4YPJA 3CUIA 4J7RA 4M82A 1CXFA 1XSJA 2YLLA 2Y24A 3TOPA 4CKQA 2V38A 4LXFA 1JNEA 5I5RA 3ARYA 1V03A 4DO6A 2WSKA 3UG5A 2WWDA 4PTMA 4RE4A 1JFXA 3ARZA 3VIMA 2WMIB 1JZ4A 1MW0A 3A22A 1NH6A 3EJPA 3CZSA 1HJUA 2J25A 2QHAA 2PWHA 1TUXA 2GJPA 3W27A 3ZJ7A 3DECA 4GI6A 2J7FA 5HPCA 3RIKA 1JFHA 3NIYA 4FNTA 4W8AA 2EO7A 1EOMA 3MS8A 4YN5A 3POCA 3CZGA 2WVVA 4UFMA 3WUBA 1A3HA 3SCWA 3WUGA 1DWJM 3WMBA 2XWEA 1JZ5A 1GZJA 1H4PA 7TAAA 4J28A 2YBUA 4JFVA 4TVCA 1UD3A 3HJEA 3DX4A 1UR8A 1CWYA 4U5KA 3SCQA 2VZOA 1CGUA 4S3KA 4P8VA 2J8GA 1TQUA 3ZT7A 3OGVA 4Y7EA 1NP2A 3TTQA 1UD6A 1M04A 2EJ1A 3GXPA 3CO4A 1BQCA 1TR1A 4JL2A 4CCEA 4P7QA 2F61A 3ARQA 1MW3A 5LA0A 3L4VA 1I1XA 1XHGA 1W9XA 2YFOA 3CZJA 1CXLA 2FGZA 2W4XA 4D6GA 3CHFA 3S5YA 3WBAA 3VMNA 2Y4SA 2VQTA 3DX2A 2GJXA 3RO8A 1KGUA 4ZE4A 3FNDA 4F9DA 3QOMA 3JUGA 9CGTA 5D4YA 3VIKA 1ISZA 1LQ0A 1WZMA 2J8FA 1EDQA 1HN1A 1HP5A 2D73A 1W9PA 1GW1A 4CD7A 4OKDA 4LYQA 5BYWA 2W5FA 4M8UA 1VFUA 1R85A 4B9ZA 2XWDA 3WNKA 3DC0A 4U31A 3WDPP 1E6QM 2D3LA 1GOIA 6A3HA 3MUAA 3PZQA 5FD0A 1HL9A 1V3LA 1GCYA 4C7FA 1HP4A 1TZ7A 2X0YA 1R46A 3WFLA 1B31A 2XGIA 5ABEA 5A8QA 3EDKA 1GOMA 3VIFA 1V6YA 2B31A 5AC4A 2VZSA 4BCEA 1E43A 2CESA 4AZ5A 2YIHA 1J18A 3CHDA 1V3HA 3VIGA 3HN3A 4UOJA 5M03A 2D0GA 5A6MA 2XVGA 5BWFA 1C8QA 3EJSA 1G9HA 2PWFA 4DWSC 1CLXA 1UH3A 1HVXA 3MANA 5EFDA 2VCCA 2J4GA 4WIWA 4AYSA 1QHZA 3ZR6A 3AHXA 4GIAA 4J27A 1MW2A 1UWQA 4AEEA 2F7QA 1UWIA 1EA9C 1XYFA 3MV01 4D71A 1HTYA 2CHNA 2QF8A 2BHZA 2DDXA 3WF1A 2WVSA 3BH4A 3MO4A 2XVNA 2CERA 3AMGA 3AIWA 5C71A 1CIUA 3MU7A 3LXBA 1OD8A 5E0FA 1EO5A 4AMWA 1J0ZA 3AFBA 3PZGA 2ZX6A 3GNRA 1JDCA 4GO9A 1GOOA 4U5IA 2EXOA 1Q4NX 1J12A 4OUEA 3WQ5A 5FL0A 3KLKA 2DPEA 2OSWA 1CGYA 3WY3A 3SCNA 3WD0A 1KGWA 4JL1A 2UY4A 2HISA 5LA2A 3UG4A 5I23A 1GUVA 1UWTA 3LMYA 3WEZA 4E8CA 1H5VA 3OA5A 4XUYA 3VX1A 3MSGA 3D52A 5IFPA 2WVUA 3NDZA 3AIVA 4KMQA 2YL6A 2WWCA 2PSPA 1BGAA 3VPLA 1E6PA 4V2XA 3APGA 2BFGA 3TTSA 2GVYA 4ZFMA 3IANA 2ZUNA 2F8QA 3K8LA 1V6UA 4CCCA 1B3XA 3A21A 2EPNA 3QOKA 3AZTA 2E8ZA 2BVYA 4Z2IA 1WDRA 4WLCA 3CGTA 1EDGA 3WMCA 1ITCA 1R47A 3GXNA 4GI8A 3K46A 1W1VA 3VDCA 2FYVA 5A3HA 1GVIA 1LF1A 3E1F1 3M6DA 3WQ4A 3OLEA 1OGSA 1VIWA 1C8XA 3VM5A 1GHSA 3GH5A 4J3TA 3H55A 1WE5A 1FA2A 4DWSA 4HMCA 4GXPA 2WHKA 4ATLA 4EK7A 2G3IA 1CLVA 4PRWA 1K9EA 2UY2A 1V3KA 5I24A 4WKHA 4BQ4A 1M03A 4H41A 3VNYA 1ISYA 5IXEA 1W32A 1C91A 3KEHA 1P6WA 3FW6A 4D6HA 3SUVA 4HU8A 1DWHM 4W5UA 2WW5A 3WSUA 1BYCA 1PE31 2XVLA 3A4AA 4XZBA 3WDRA 1JZ3A 1H49A 1MVYA 2J7HA 1E5NA 1NARA 1CGTA 1FHDA 3WQWA 5A1AA 3NJ3A 2DEPA 1EQPA 1E0WA 1VAHA 4WKFA 1GOKA 3U5UA 4W7VA 2E9BA 1UR2A 3SEPA 4PMDA 4UOZA 2ZX8A 2FGLA 3ZT6A 5BROA 5A8PA 1EGZA 3MSDA 5D9MA 4W85A 1QI4A 3AIBA 1QW8A 5E09A 3OIHA 3RCNA 4W89A 5CSUA 3ARVA 1O7DC 1MW1A 1HJVA 1UYQA 1FH8A 1H3GA 1BG4A 5CG0A 3T0DA 3EJUA 3WY2A 3AIUA 1SYTA 4AD0A 1ZBKA 3D4YA 3CUJA 2Y5EA 4QCEA 5LA1A 3BCDA 3S5ZA 3PN8A 5DF0A 4BQ5A 2X2YA 2JALA 4JKKA 1ZS2A 3M07A 2UY5A 1E6RA 4BA0A 4CU8A 1ITXA 1UWUA 2WVVB 3BAWA 5DO8A 4D72A 1DWAM 3VKKA 4EE9A 2VZVA 1OD0A 1E71M 2VMFA 1RP8A 2F1BA 1UHVA 1FFQA 5A8OA 2WZHA 4MDPA 3VINA 1NWRA 3A4XA 5IHRA 1WZAA 3W6MA 3BMWA 2CBIA 1W9DM 1I75A 3VD7A 4KGLA 4HPGA 1CTNA 2O9RA 3VGEA 2WCGA 1EHNA 1OWQA 1ZBWA 3AROA 1DWFM 2CKRA 4N0RA 2F7PA 2J7BA 1BLIA 1JYXA 4P7RA 4C7DA 3GYCA 1VEOA 3M7SA 1TVNA 1CXIA 3EBVA 4QCFA 1GORA 3QGVA 3D5HA 1EDTA 3ZMRA 4Z2KA 3RM4A 2TAAA 3MUZ1 1MFUA 3K8KA 2DGAA 1S46A 1UKQA 2QMJA 3DHUA 1V0LA 4ACZA 3GTNA 3A4WA 1C7SA 3HG4A 1YQ2A 1E6NA 2FH8A 2ZX9A 2J77A 4HZ7A 3WY4A 1GJUA 4WSJA 2XFFA 3UG3A 3TTYA 3EDFA 1ISVA 2OW7A 1OT1A 1XH0A 2NSXA 2BY1A 1UR1A 4AC1X 2BY2A 1W3JA 2WMHA 1V08A 4L4PA 1JXJA 4D6JA 3DDGA 1QI2A 2XSAA
chains in the Genus database with same CATH superfamily
1FP8A 1IEBB 2CK0H 4ECNA 1AQHA 3TLRA 4IM8A 2VFFA 2COVD 4P8UA 4Y4FD 4MS6A 4X2UA 5F89A 4PRDA 1LEKA 2JJSA 1V6WA 2ZRUA 3QGAC 4MWAB 3UT0A 4HFUL 4HIJA 5D4IA 2OB3A 2JKJA 2NY5H 4H1LB 2C1PA 3WS6C 4KX8A 2Z7GA 4ZYKA 3W7CA 3LOTA 4M5YL 1VENA 3K13A 3GJEB 3N41F 3G2GA 1IBHA 4QHMB 4X98A 3UTSB 2UXFA 5C09A 1Y5XA 4J6IA 3AIRA 2NW3A 2YPLB 5F9JA 3SUWA 2QEJA 2JIXD 5CJMA 3D39A 4LQFH 3MV8E 5L8KB 4NDMA 1EFXD 5JHLH 1X6UA 1E65A 1MFEL 1X5YA 4Y2DC 1A25A 4JPWL 2EDQA 5B80A 5KANI 4NX0A 2UXGA 4PJXA 1WAEA 1ZEAL 3IF1A 5JXED 1NBVL 4LPVA 4W6YB 3TBWB 4DJDC 1HDMA 3MRHA 3TN0A 5HK4A 4C55A 3VA2C 5JOFA 1O66A 1RZPA 1TZZA 2EABA 2YAMA 2EKSB 4XXWC 3P5YA 3ZIYA 3BPCA 3WFZA 3AWEA 4GBXC 4M6NH 4J3VA 4PVNA 2CIIA 3KLAA 4J8RB 2ZUTA 2C4XA 3ZXAC 4AI7A 4BKTC 4X5WB 2ITDA 1A0CA 1I0BA 3UA3A 4L8BA 3CN3A 5IHBA 3TKFA 2Z28A 2BOCA 2C91A 3GAKA 1JRHH 3AZSA 2EQDA 1S3HA 1TG8A 3EOTL 4JFHE 3GDMA 3T4CA 5IBTH 2BRQA 4ZO9A 5TAOA 2GK2A 1IQWH 3OAYH 3BW9A 2D31B 4DAGL 5C8JB 5ITBL 1DQJA 2PE4A 3GSVA 4RMVA 3DVIA 4DKTA 3AQUA 3UBXI 2O5XH 3C6LB 3WO8A 4JAMA 5E8NB 1DJSA 4ONFH 4OI9A 2BVQA 2KC0A 2XWXA 3BW4A 4B0MM 1SHWA 1VCGA 4UUIA 2Z6JA 1MFCH 2JWYA 4LLQA 4IZGA 4UC5A 4ZE5A 3A6CH 3BVTA 3MLTA 2EICA 3HEIB 3F6LA 2PDIA 4FLOA 3T9WA 4ACTA 1R86A 4OAWB 3UZZA 4GFTB 1M01A 4ACZB 4PB9H 3V9FA 2X4QA 1Q9OB 2F8VA 1RPUA 5DGQA 4U1HA 5I6OA 3D34A 1U0QA 1FIGH 4KEUA 1VFFA 4PJ5D 1G9NH 4QNWA 3EIFA 2ATKA 3FFCB 1L5GB 4AKPA 2A3BA 3EDJA 2YOAA 3K1KC 1ZVNA 2J6WA 2MIZA 3WNMA 5DCBA 4BSWB 1H6FA 4OV9A 4RDQF 1HL5A 3FB5B 3SDCD 1LQSR 2H0PA 1VLXA 3DURA 1EERB 4H0LC 1JGUL 3GXFA 43C9A 1SMAA 3T0TA 2CETA 2XH0A 3VFNA 2EF9A 4BQBA 1KYOK 4K8EA 2QVMA 4G7VH 5HHOD 2DMCA 2F7RA 3N91A 3WN5C 5CLYA 2Z8WC 1S2TA 1SSDA 5TE6H 5C5YA 3IDIA 3LKPA 2P1YA 3LY0A 2CLRA 1I1FB 3LH2H 2NLYA 2XWCA 2WPGA 3CHQA 4KCUA 5HJ3A 4MA8H 1KBJA 4WO0A 3H7RA 1EEZB 1GZPA 3NA9L 4XP6L 3SN6N 2VDRH 2J9XA 5ELIA 1CICA 3W25A 5HUPA 3CMGA 3RZCB 2E9LA 1FZOB 3L2LA 4E8GA 3HG1A 2PDMA 4BFNA 3NQIA 3LB0A 2WBGA 2YYUA 4ZUTA 2GK1B 2DKSA 3DCPA 1L0QA 4UV7L 4H9UA 1WWCA 4ICXA 5ENWA 5TTRA 1MFVA 3C6EA 2PW1B 4U3SA 1NWUA 3N17A 4KXCA 5IIEB 4JYDA 4FZEH 1J01A 4FI7A 2P49B 3IKKA 5CN1A 4M5YH 3W9EB 1J0IA 5L2KA 1VLWA 3EFOB 4PMYA 3AO0A 2AANA 4W9CC 3GR7A 2W59A 3B5HA 3S96A 3PL6B 3OZPA 4DP8X 4QS5A 1AI1H 1PY9A 3IDMA 3MRDA 3RUGF 4LBSA 3R0KA 4IHCA 4ENLA 3W7HA 4A3HA 4JDTL 2GK0B 4XAKD 4RV3A 2WWKO 5T8IA 2YBTA 3UEZA 1MLCA 2FQIA 3PWLA 4KO5A 2PCPB 1D5IL 2RGLA 4OQTA 3UJRA 3I6TA 4B5XA 3DN5A 1J8HD 1EAPB 2ISWA 5A2FA 1Z7JA 5FUOH 5D9SA 4PVLA 4K8RH 3KCPA 2VABB 3GJFK 1OAUL 4OSUH 3CXDL 1S78D 4YPGA 3V6OC 1F6YA 4AXKA 2PP8A 2DQDH 2VW4A 3MNZB 5J5RA 2B16A 5I30L 5M7QA 3SGDH 3JXAA 1OGTA 1TTBA 4ABWA 1VCBC 1OC7A 2F9RA 5CG7A 4B16A 3A3HA 3N9RA 2GTWA 3M1OA 2ZJSL 3EOBA 3P0VL 3CLEH 4FXGB 5EOTB 2GITB 2BVWA 1DFBL 1EF3A 5EO9A 3ZR4A 3S35L 4X6CA 5MP6H 1IAOB 2BSCA 2GCYB 3AS0A 3EO9L 3OWEA 3QQ4B 1T1XA 4OF3A 3ZKND 2CYGA 3E3QC 4NQCB 1E0XA 1O1HA 3LY6A 3JUZA 3VRIA 3GKAA 2NZ1A 2PYFB 4MASA 4RR4A 4HJEA 3CQIA 3FT1A 1GGIL 1C92A 3BWUC 3C5ZB 1OLLA 2EACA 1OCZB 4OB5H 3VH8B 4B3KA 4U1GC 1BZDA 2OQJA 4PJ8B 4GACA 4FNSA 3GG7A 4PJCF 1N67A 1UCBH 5L8LB 5KZMA 4HZMA 3WD1A 3VXUB 4JOMA 3CL7A 3H2OA 1UADC 2JCCA 3TSMA 1ADWA 2EDHA 3LH9A 1WV7T 1UM5L 4YO0A 1NWOA 1AKPA 1A7RH 3HHSA 4GUGA 1ZOXA 4I0PD 4U3SB 1YY9D 4ZD3H 5LYRA 1CJYA 1HKFA 1RUKL 2HX7A 4MB3A 1QLFB 1ECEA 3OC5A 4JRXB 2W67A 1HHJA 4NX5A 5LO7A 3RZCD 1OALA 1ZAHA 1VFBB 4I6VA 3B2UC 1EEYA 4QTIH 3MHFA 4IJRA 4DQWA 5CJQH 4WW2B 5B8CC 2I60L 3UIZA 1O94A 1CBJA 5KYXA 2QGCA 1TLKA 1T7VA 1WH0A 1A7PL 3PWLB 4MYWB 1M7UA 1IGJB 4PJDA 4PTTA 3SSGA 4BWWA 1NF0A 3AMCA 3LERA 4CCDA 3OHXC 3PIQB 3BIAX 3QWRA 1PZSA 2XBZA 3VVVA 3HG5A 4YSRA 4X5XB 5HXMA 1KM0A 5D7JA 4JQIL 5JHBA 2A6LA 2V0AA 3LI1A 2VLJB 2XA3A 3UYRL 5C54A 2Y7MA 4WO4D 2P8CA 3LNHA 4G6JL 3GYEA 5TQ0L 5HI3C 4XPAL 4XAWH 2PGFA 1B3OA 1LK3H 2QULA 3IM1A 2VR9A 4P4KC 4NBYB 3ARBC 1G6RL 3P02A 4J3BA 4AV5A 4P23D 3K2UH 5H91A 3GNML 4L3EB 3GBEA 1UQSB 1OB0A 2FB4L 2WO3B 5I8EB 3E49A 4IQDA 2EDRA 3CZEA 2Y7QA 2EVIA 3UBXB 1LEGB 3PRZA 4JFTA 1RJRA 1NLDH 2BW5A 4QITA 3UWEA 3W7JA 1LBMA 4IM4A 4M02A 5TJWK 4H20L 1P1VA 2A3CA 3D3VD 3D47A 3B9KB 4HIEA 2X70A 4NGHH 4R97C 3G77A 1O9WA 3F3HA 4RGND 3GKWL 4UNIA 1B3VA 5HJGA 1DIOA 1EBAA 3QJFB 1X96A 1PYMA 2P5NA 3B9OA 1EEXA 3V35A 2R14A 3APDA 1QWKA 3VNLA 2OU4A 1HYRC 2DSVA 3N9SA 4DUOA 1G7MA 1DP0A 3KZSA 5HHNA 5HJXA 8XIMA 1B0RA 5JW3L 2CHOA 3S88L 3S9ZA 3FULA 1QKZL 1JD7A 4NO3B 5C0AD 3RVXC 5HHQA 1UWSA 1WZLA 1L9QA 1X5KA 5DVPA 4WI6A 1OT4A 5AVNA 1IM3A 3GQFA 4WCYL 5FYLH 3P4MB 3PV7A 3ARFB 2E7LA 3AHVA 2R0KL 3VXPA 1ZT1A 3GTVA 3RWIA 3OJ2C 3WJJA 1OX5A 4LHUB 3ABOA 1JI2A 3PJSB 3E8UH 4G8GD 4P5TB 4JRYD 5CLZA 3VFSB 4M51A 3T09A 2Q10A 3I4EA 2Y36L 3RFZA 4RRPA 1B9BA 4B6ZA 3LXAA 1XF5A 4LNVA 3ZTNL 4CN6A 3P77B 1AGEA 5EF0A 4XN1A 1XVSA 1J7VR 4W9KC 3C2VA 1GPWA 5SWQA 3QRFM 4RISH 2ARWA 4JRXE 3WOVA 1J93A 1FO0B 3CCHB 2NCEA 4FSAA 3D46A 4F33B 2OOFA 3LQLA 1LILA 3QORD 3MYPA 3OKOB 2FWOA 2R1YA 3QJUB 3EO9H 4LCYA 4GG8B 4KFMA 4N68A 3TN0C 3WHXB 4ZS7H 3P14A 4PRPA 4R88A 4ONGH 2A0LC 3P0VH 4PV9A 4MMYB 1B4KA 1YTEA 3SGUA 3QISA 4WJEA 5J3HC 4F1SA 4WHTB 2J6VA 4BFRA 3TONA 3MKVA 4PGDB 3L3OC 5C0JA 5AKSA 3N3EA 4RZ4A 1F5WA 3AT0A 3QDJE 3WFBL 5IROD 1LORA 2NVDA 1UEYA 3WD4A 1JZIA 2HB0A 4V33A 4PRDB 3WUBA 3AXMA 1HNYA 2W81C 4S1DC 1ODUA 4JMNA 5AD0B 2YX0A 1HKMA 3FFOA 1HEZB 3ULUE 5LGZA 3QUMB 5DEJA 3PWNB 3MUCA 3JVGC 4ORIA 4XGZB 4PD4K 4RIRA 4Q8UA 3QIWC 1G01A 3SCUA 4NO5A 3WL1A 2V2TA 3KPSA 1SJBA 1TO3A 4D6IA 2ZQ0A 1QFEA 5AVUB 4B5UA 2WXLA 3E74A 4GRWF 5EWIH 1E6ZA 1TPC1 4BSVA 2CGRH 4FD0A 5EOCL 1O5XA 4L6HA 3WBDA 3GJEA 4WHBA 2X4QB 4LVBA 1OIMA 2R56H 5LG6A 3VGFA 4KQ0A 3HC4L 5C2GA 4WNSA 2E40A 4LBRA 2QZ5A 2YMOA 4FNLL 3CH1B 1EMTH 4IIZA 4RGNB 3SCRA 3B1UA 1XF5B 1WICA 3CXHK 3TZVA 4OFKA 4NZFA 4MLIA 3QDMA 5JHDB 2WN2A 5IMMB 3MJMA 4MAYC 4AX3A 2GQ9A 3WLIA 3Q5OA 5JDJA 2Y5JA 4IEFB 3LH2L 1FWIC 4KIEA 1SJXA 4S3BA 3HMCA 4HQQL 1QBMH 1ETA1 1EO8L 3VWJC 1CFNA 1GWJA 4YVXA 1DUZB 5DC0A 4EIGB 3OF6A 4DQOH 1RI8A 4X5WA 4Q8PA 3EYOB 3H56A 5KANG 4ZTPL 4ZBCA 4EBQH 2WVTA 1E40A 2NY6C 4U3CA 4KW2A 3QO1A 2WUCH 2VD9A 1RK7A 2C7FA 3K0YA 3QQ3A 5IUSA 2XH7A 3N11A 1UWEL 3SIMA 4IYKA 1LDSA 2F7FA 1XDTT 3LZQA 5AAMC 3IAQA 4PUNA 3W2JA 4Z8FH 1XIFA 5AD0A 4JHVA 2PWGA 4LLQB 4Z7VE 5IIEA 1R30A 3L5WA 1WKFA 4F80A 3WF2A 1INDL 4PFEA 2W80C 3BLEA 1I2RA 4NN7B 2BVPA 4XVEA 2GHZA 2B59B 3CZLA 4R53A 3PSWA 1I1YB 4N2NA 1NCAH 4QM1A 3MNWA 5C0IA 2OSLA 4MDJA 4O4YL 1S5NA 1DQIA 4AUYA 4FL4B 3AWGA 1RUML 3IJ8A 1VBJA 4YTQA 4R83A 1M7IB 1WEJH 4KK9C 2QGEA 4J3UA 2NYYC 2ALWA 4D0BB 2YHGA 3L0NA 3AXIA 3DRTA 1U8CB 3UTOA 4GRWH 4JE4B 2V2WA 1XZ0A 4LPTA 5MHSE 1TIWA 3LN3A 3QGKC 3I74A 1TQBB 1UVQA 3KZPA 1HO1A 4PG9B 4TTUA 1ACCA 3SUUA 3WG7B 3LNPA 2ZWNA 1B88A 5C0BB 4EUPA 3AABA 3B03A 3QH2A 4E3VA 4GZ7A 4F2MA 1L2QA 3IMBA 1LLZA 4F27A 2DJLA 2AF2A 3T0XA 2XZCL 1YPIA 4X6FB 2ZCLL 1G5AA 2NYKA 4HHMA 4PUKA 5GZNC 5L88L 4MMWA 2Y5SA 3S1XA 3MXVH 4GEJA 4LSRH 3MRIA 3THDA 1LP9F 2WMPB 1NGWA 3V9CA 3FOMB 5G4HC 4PL1A 3REQA 1PZ0A 1G6VK 1WP6A 1YYMH 1FDJA 3QWOB 3GS6A 5LBSH 3SBWC 4LY4A 4W4OA 1BTCA 3L3KA 2LU3A 5JNYA 2Y7SA 3EHBC 1BF6A 3S7GA 3G3MA 3DVNA 1BYPA 1SVZA 2XSBA 1J8HB 1UA6L 4I3RL 1E6SM 1TO4A 4BZ2L 1I7UB 3W81A 4D9RD 1J5OH 2X7WA 3IJ6A 1TNMA 4AJYV 3VCCA 2V5KA 4XCFL 1TEYA 3SO3C 3M16A 3UPMA 1MCWM 3QUYA 3L2MA 4F7KA 1EAPA 3PABB 3FB8A 1G43A 3B3IA 4LNRB 5A2BA 2PDHA 4P4KB 5L6YL 4BS0A 4FLRA 4OCWH 1AGFA 3ILDA 2AJUL 4GZEA 4KMLB 4MJJA 4KZDL 3ALGA 2BHFA 4KRPC 3KPLA 3QWQB 3T0EB 8FABB 3L4XA 5KBLA 1AMKA 3NA4A 1YXCA 3G08B 1HFBA 2E8YA 2FPTA 2QADC 4A38A 2WNNA 4GKSB 4KAQH 3CFCL 1IGFL 3TWBA 1EZUA 4BSJA 3MX0B 1NGQL 2GITA 4ZW3A 4HWBH 2OYKA 3CDYA 3IVSA 4YDKH 2X3AA 5AZEH 1XLEA 4WHCA 4IRZH 1E28B 1MRFH 3FTUA 2V9QA 3NGJA 2A77L 3SDAC 4W81A 2XZCH 5HVHC 1C08B 2YD4A 3FUFA 3OSKA 4S3DA 1CE1H 1TO5A 4UTBA 3GG8A 3OMAB 9RUBA 2PABA 2Y25A 3TYCA 3ATFA 4L4TB 3PPEA 5FIPA 5IBLC 3A6BH 5L9DH 1JV2A 2ZKHL 3II2A 1EFZA 3B4UA 4X6BA 4X80L 4WGXA 1ZJBA 2B0SL 3KBPA 3CDCA 3STBA 2FBRA 3OG2A 3BP6B 2YJLA 2XUCA 1VACA 4QT5B 2E1WA 1KIUB 1W1IE 3K2IA 1WC7B 3QFJB 4XN2A 3WJLC 1V4YA 2HTKD 1NCBH 4XX1E 3VFOA 3WFAA 5M2FX 4AZ8B 3QJZA 5I82A 5FXCH 5EBMA 3QJFA 2IPKB 1WTGT 2WLZA 2QDWA 4WEBL 3V6ZA 4LEEA 1GH7A 1R3IL 2IALB 2NLIA 2WXDM 3T78A 5F7MC 4IT1A 2WP3T 1P7TA 1PLGH 1FFRA 4KX7A 4X6CE 3QY8A 4LUTA 3ZOAA 4F8TA 4DPBX 3BE1L 4RZCA 4S2SB 7A3HA 1BX2B 5ANHA 2JKNA 3C6LD 3GSUB 1PKMA 3ZIMA 3HNTL 1PS9A 5H2BB 2I69A 3JS3A 1KFKA 3EOAB 3W11D 5BNXD 1RUPH 3IMTA 4FFYH 1NEYA 1E2ZA 3WK0A 1RIVL 2BHYA 4I4WB 4D6FA 3DOIA 4ROPA 3WNOA 1U8OB 3MBWA 3KOZA 4MNLA 1AGEB 3JZUA 1NC2D 2XZQH 4YHMH 2FTAA 4RMRA 3RIAF 3WMQA 2WZTA 1MFAL 5EC2B 4OVUA 3IXAA 4ZAKA 5CCKL 4O8RA 4P57A 1TV3A 4KFOA 2H2SD 2R39A 4ZB2A 1EQCA 3QZNA 4LOUC 2AQOA 3BAEL 3GBNL 1Y18B 5FSEC 1WGOA 4PCNA 3V0WH 3Q3GB 2GVLA 3F4WA 1V8HA 5EEZA 3W1QA 3W7GA 2VLJD 1PKOA 3VIPA 2X6UA 3PPCA 4N4PA 4C4KO 3TZVD 1MJ7H 1XIJA 3ILPB 3LVTA 3VFPA 1QHOA 3KFTA 3R0UA 1MI3A 2I7GA 1OZTG 2UX6A 3RDTB 1B57A 3ITYA 1IAKB 5DMIL 1TJIL 3ZDXF 4NQ1A 4CBPA 3MACL 2MNUA 4YLQT 1JG9A 4CN1A 2ESVE 1ICQA 3MUHL 3IIOA 1SXAA 2VEFA 3SYQA 2OXGB 4ZZFA 2OMAA 3LRMA 4AGPA 4MJMA 4JQVA 3CMOH 4YOKA 3KYOB 4H5SA 1IU1A 3WN5A 2CCLA 3W26A 2J8UE 1RUMH 4PB5A 2H2PD 3KLLA 3W7KA 1FTXA 4DYEA 2FO4A 1E8XA 1N8WA 1MHHA 5CPNA 3SPGA 1P4LA 1M2OA 2GQHA 4G1MA 3ECUA 1WDQA 4L56A 3W28A 5BS0B 5IFAL 3M0YA 4NQTA 4PJDF 1JF1A 1E9LA 4E3TA 3BT2H 5SWQB 1B1YA 3PWVA 3M88A 2DT3A 1K2DA 4QO1B 3NWRA 2ZXCA 4GUJA 4P46B 4JIHA 5EBUA 1NLBH 2NY0B 4A4AA 4DPQA 3U7BA 1GVSA 4GY0A 3SSJA 4E0RA 2HRGA 4G9DB 1G7QA 2WN3A 1TTPA 4KRPD 4WWID 3TP4A 1W2PA 4FEZA 3S3CB 3SQRA 4Y4KC 4MWFB 1GZGA 5JW4Q 5FUCC 4DGYH 1W3LA 1YXYA 5ECJE 1QNZH 4WI0A 3R4DA 4GJJA 5FJUA 5FL1A 1NIAA 1QSEB 2L4OA 5IM7A 3B37A 3ZDYB 4F8XA 2JB6A 1G0YR 3AJ7A 3Q44A 2GJZB 3AACA 1PZCA 1X4XA 3ABSA 4DX3A 1I3GL 4DCQB 4XIMA 4IPLA 4LGXA 1GY1A 1LWRA 3Q8CA 4DGYL 2UZXB 3L7FB 4MZYA 5EF1A 2POZA 5I06A 1R3LA 1UUNA 4YX2H 2OEJA 1R34A 1AOZA 4QFUA 5DRZB 2NY5C 1RIUL 3KBFA 4DF0A 1N4XH 4EVNB 1A6WL 3O2DA 4RFOL 2D03H 2WSRA 2OZNA 4NO5B 4PCYA 5CLTA 2PBOA 2OFQA 1A4JA 4D8PB 1TB3A 4HMEA 3F7LA 3H9ZA 3QQ3B 3RJYA 4HUVB 1PTDA 5TBOA 1E90A 4CCZA 4ZMLA 4OOUA 3RMEA 2MTAA 3BISA 2R0KH 3NDYA 1DR9A 2Q76B 4C6IA 3BSZH 2WK2A 2A85A 1P2CA 3QUYD 2ORBL 4UQ2B 3RLSA 4NQCD 1DQWA 2WZIA 4L37B 4NILA 4EVZA 2A6KA 2YA0A 2IV8A 1N68A 3QH3A 1UTDA 2OV0A 3L4WA 2HVKB 4GP5B 1I1AD 3E6HA 5TE4L 3KWWA 5DUJA 5L0QB 3AMDA 3RVUD 1I1RA 4IU3B 1CDCA 2OMUA 5SWSA 3QIBD 4X7FC 2OCJA 1W2VA 3W83A 2CO7A 2Q8BL 1P7KA 4TMCA 2VYOA 3L13A 1DSWA 1NAKL 4OGYL 4PWKA 1F4WL 2PB1A 1RK6A 1ANUA 2H26A 5I1KL 1QNOA 3C6LC 4L1SA 3IVTA 4K3DH 4RX0A 4TKWA 3F2BA 4MVBC 4OCYL 1HJWA 1A1OA 3EH5B 1OP5H 1LO2L 1NSNL 5DUBB 3TPKA 4YQXH 4ZTYA 1AXTL 1KCBA 4DESA 5LUMA 1LEIA 4HG4J 4DKEH 4NDMB 4AGLA 2HT4C 4HALA 2RIKA 3IGXA 3F04A 3KYKH 1QFWH 4CD4A 1E8ZA 2BIIA 3VM7A 3RTQA 3VXRA 4YK4C 1FCQA 3KWUA 5I0YA 1MQRA 1C16B 4PJEB 3HOGA 5I17A 2CXEA 2Q87A 3A3WA 1W5NA 4PGBB 3XINA 4UM9D 1ZJAA 3ZUNC 4KNQA 1JCYA 4RDVA 3M0ZA 4JREB 1ZU8A 2NVAA 1U8NA 2JE8A 2YBVA 2YUXA 1ES0A 1PSKL 1ZIBA 3B6SB 3LKRB 1UG6A 3UZJA 5I75C 2DQTL 3PXLA 4ODBD 4MUPA 4I8DA 3FCGA 2AKZA 4XBJA 5KSWA 2R24A 5TDOA 1HQ4A 4HD9A 2ZA2A 4KEZA 3WLQA 4C6OA 3QUXA 2FSEA 3MNVA 2QQNL 3DXAA 3GUFA 3O2DL 5ICUA 4PP2B 4E9YA 1TVLA 3T6ZA 1REQA 2NY0C 4O17A 2QNEA 5JW5B 4AIZB 1SMDA 4ICMA 1SLUA 1LHZA 2GSGB 2YBRA 4KK8D 3K74B 2P5WE 2FHBA 1H41A 4QRUA 2BFVL 5D1ZA 2OZ0A 2HG5A 5E9DE 2QCMA 3QUYB 4Z7WF 3SURA 3UVAA 4JKLA 2R56L 3CN0A 4LBUA 4AZHA 4DLMA 2PP1A 4JFDD 1QSFA 2ODIA 4JD4A 3GS4A 2G5WA 4MY1A 4NWUL 1YRRA 2RFXB 2YRPA 4N2IA 1TJGL 4LESA 4AT6A 4V1XA 4DBUA 1UATA 2F84A 2JK5A 1TZAA 4D0BA 5FW8A 5FO8A 1CYXA 2HTLC 2BIPA 1J11A 1HQRB 2VCOA 5DD3L 3BLKA 2ISSA 4LVGA 5AYYA 4MB5A 4UTHA 4NJHA 1JCKA 1O6TA 4N0CC 1KY6A 1YADA 3LMZA 4YMZA 4KESA 2EXYD 3BC9A 2PO6C 5T91A 3UZ5A 3MRFB 1JQXA 4MBRA 1TPDA 2AQ2A 5EU9A 5CEXB 4ZFZB 4GKZB 5LDUA 2FO1A 3RGBA 3GZPA 2O55A 3CK5A 4HSQA 1XEDA 3VTAA 4MHBA 1EX1A 1S8DB 4OY9A 5KVGL 1IBGH 4L1HA 1SN5A 4Q89A 5KSAB 1QLRA 2YD1A 1NBYB 4N2FA 2R2EB 2AEWA 3HI6H 3WIHH 3TYFB 5CBBA 5D9OA 1TFPA 2EIDA 2A9BA 2MCMA 3J2PA 4ZUUA 4B9YA 4KFNA 1MI5A 4PL2A 1BOGA 3W1MA 4X63A 1OIOA 1ZZMA 2BNJA 1E8YA 4XX6A 5DMLA 1G4RA 2QZQA 5FESA 5KS9A 4KKBC 4A8NA 3VXTB 1CECA 2PDNA 2MJWA 2AXJA 3FNKA 3BOLA 3LCGA 3U8GA 3QF0A 5DRWA 4KRNA 2O4MA 5FF7A 5AZ2L 4Y8DC 1XS2A 2OT0A 4TVSa 1M6OB 5LKYA 2HVBA 2KDGA 4F2TA 2BXZA 5E0QA 2XH4A 2AJXL 2QT3A 3CAVA 2WQXA 1EV2E 3BT2L 4ODXA 2AK4D 2QDHA 4NQQA 4ZUWA 3ZLQC 1TVHB 3FZUD 2ZBTA 4FFWD 3PJUA 4P59H 1A49A 1F4WH 5LXEA 3ECBA 1RULH 5DS2A 5IJBC 2XG5A 1XC6A 4HH9B 4IOFC 4GUQA 3NO3A 3ME0A 4QX4A 3QSKB 3HAEH 3T6XA 3E3QE 4WNQA 5F7KC 4N4YB 2RAGA 2V5CA 3HPZA 4FZIA 2VJXA 1HNGA 4GWEA 3O6FD 1FXPA 1F07A 5AW3B 4AM0A 3EWZA 3D4ZA 2DH2A 2CKBL 4LCWA 3D9AL 4NXSA 4PJBA 3UTTB 3IN0A 4E41E 2ZCLH 4ELMF 2OLAA 3PTMA 5JH1A 2OXHA 1KCLA 1QFUH 2HT3D 1SEQL 4YLBA 5FWRA 3TCTA 4J5NA 4NC1E 3N1QC 3HI5L 1A9BB 1SDDB 4U33A 2J74A 4R7LA 1DQVA 1R4XA 1T03H 4Q7DA 1SUHA 4TPRH 3PQYD 5BZXA 2WJDA 3P2VA 4AX6A 1QPQA 1MJ7L 1GJWA 4J3OF 1E73M 1WWWX 2A9CA 1KXHA 4B7LA 3T8QA 4GAYB 2FHFA 2WNZA 4EF3A 4ZX4A 2P0IA 4AHPA 3L7EB 2E5EA 4U2ZA 3MUIA 3IETB 3O2WL 3NCFB 4Q2ZA 3R79A 4R9OA 1U8IB 1G4PA 3SDAA 4PMJA 4CNSA 2PP9A 3BDKA 3ALXA 1QVOA 4AEHH 2G3MA 2FGBA 5F7DB 1HH6B 2GFBB 1QBLL 3EOYG 5C07E 3RHWK 1CBVH 2VCBA 3KAOA 1ZLDA 1MAML 2MPVA 4QY8A 1SMOA 1JF6A 3VCLA 3SCVA 3T2NL 3NYDA 5BVPH 3GWJA 1P43A 3U2EA 4YSQA 4YE4H 3RWGB 1OFOA 2PD5A 1QNQA 1XIEA 5J6HA 4FIRA 4PMEA 1H2JA 2Q01A 4YWGL 2PCQA 3BIKB 5B3JF 2OFJA 3S42A 1Q9WA 4ATWA 4FQQB 2A9ML 3BT0A 3IMWA 1FV1B 4ADSA 2DEYX 3T42A 3ZHDA 2BVOB 4PUMA 3WUEA 2H6PB 4JVWA 4ZZKA 2DLGA 3NK3A 4RAVB 2NR6A 4YSOA 3T6QC 1QFOA 2X7LB 4TLUA 5EEWA 1KTBA 1HJQA 3PWVB 1HIZA 3CNKA 3TA3C 4FF5A 3HS0A 5I77A 3UTSE 4OECA 3MLYH 1BD0A 3DARA 1FLTX 3RVVD 2Z31B 4XISA 3UP6A 5MEQA 1RA0A 1KEMH 3EGSB 3S4SA 5IDIA 2OMNA 3TH3T 1HWHB 1ZK9A 3WMPA 4F92B 3KW3A 5D02A 3FRPG 4TM9A 5L8JB 2MOVA 3ZTJH 1BECA 2G2RA 2IO5A 4EZMA 1GQJA 3UXDA 5GRUH 2XIOA 2JIXB 5H35B 1LQAA 2P43B 4LYKA 3N9KA 4D9PA 1X7QA 3MI6A 4PIBA 1CLZH 4ZXLA 4FTVB 2GBTA 1KJ3L 1FWHC 1HXMA 1SU5A 2GJXB 3A4JA 2B5IC 3CZFA 1EHLH 4GW5B 2G75B 1N0XL 4HXBH 4NENB 4GO8A 1H09A 4R4BA 4U1JB 3HUJF 3K1GA 3NL5A 2IQ9H 2CMRH 4JHWH 5CP7A 3VOHA 3OG6B 4BDVA 1TQBC 3FB7B 4JFZH 1JDDA 3BXWA 1OD9A 4HBKA 1WVZA 4LOUD 5J6SA 4ES9A 1BA9A 2PF0A 4J3XA 4DETA 2PKDA 4EO5A 1EIXA 2AAMA 1YEEL 4KKPA 5ACZA 4MLJA 5I30H 4XNBA 1G9NL 1KIPA 4BZYA 4GG6F 3D05A 1PKLA 4UFJA 2H8PA 2IKJA 1NBQA 2GCYA 3GEFA 3G5YB 2Z92A 4KK6D 2JELH 5EUOF 3RP1A 1T99A 4WWKB 2R1KA 3R1ZA 4US5A 4M4RB 1QT1A 2CCVA 3UTPD 1ZSDA 4Y1AB 3W9DB 2EDJA 1BAFH 2QQQA 3L9RA 3ZGHA 1A4MA 1ZENA 2VGIA 3ZWSA 1S7QB 2PWUA 2OJZH 2I7OA 3AAZB 3QEQB 2J12B 4XP1H 4JFFA 1JZJA 2G96A 1OAYL 1UD2A 2BWDA 3V6OE 1TPXC 3OQRA 4IIFA 3IF1B 2WSYA 2Z00A 5HYQA 4H1LH 1S9XA 5B38A 5ABZA 5AAMA 4MZIA 5DJ6A 5F7UA 5CC5A 1BFSA 3FRUA 4PJFB 4BUQA 1O7DE 4RW3A 4IMFA 4GCAA 3W7LA 5BZAA 4PGEB 1QLFA 3V7AG 1XWYA 1U2YA 5ID0A 2Z31A 3LDBC 1EP3A 4N6QA 5D7JD 4XZLX 1MJUL 1LO3H 4HS6B 5AVVB 4DZBB 1OCBA 4H0IA 4F7EB 2BVDA 3HF3A 4GPNA 1EEYB 3ATYA 5LBSL 1JK9B 3BFQG 5GGRB 1RALA 3O41B 5I03A 3U25A 4HKXA 5C9JB 3LKSA 1OVDA 3RY4A 1IFHL 3P61A 3P82A 4CQCA 4X6DA 3Q1SH 2DTML 3G1FA 3PSVA 1PE1A 2GW5A 3SSZA 3MLPA 3FOKA 4JANA 4Z1PA 2Y1VA 3BDXA 4N8PA 1I6NA 1UCWA 3CHCA 4AVKA 1KFEA 1UR9A 2IPWA 5AVZB 4R7XA 4PGDA 2I7SA 3P0YH 4BQ9A 5C0JB 1F4XL 3HA0A 3WEMA 1O75A 2PLCA 3HW7A 1TVDA 3H26A 1UUOA 3GJFA 2A79A 1MCRA 2RCSL 4G9FE 1I1FA 4NZJA 1QSVA 4UQ2A 4AIZA 4BQCA 4RDQG 1DPMA 2VX6A 1K4GA 3BG3A 3WLPA 3B9DA 3BH8A 1SUXA 3LCHA 5I8EA 1LL6A 4NM8L 1YVLA 4S1RH 3BUYB 2D2OA 3NPZB 4TVDA 1Z6JT 5IZ7A 2A6NA 4G1KA 1RY7B 2DT2A 4ZPTB 1E4NA 1Z9OA 2IANB 2J4WL 4NCDA 4TNFA 5HHXL 2XTJD 4NC1C 4EZJA 2WZPD 4E9RA 3CHRA 2B15A 3QQ9D 2N7SA 3BZFB 4G42A 4M8QB 5EOQL 5EU7C 1YMME 2E3VA 1WFOA 4M6AA 4MHHG 3GD1C 1BZEA 1SN0A 1R3JB 3IT8D 1EJTC 4QKTA 3QIWA 3QUZD 4AK2A 2RFGA 5KOVC 3FFDB 2WZ5A 4JZOA 4PJGB 1LYXA 1MDRA 3RBSA 1JNNH 4HK3J 3WJMA 3IGAB 1W2KT 4KBPA 4I7VA 1N55A 4FOJA 3W37A 4XNMB 3VOJA 1HCFX 2AJZA 4Y5YC 4MSSA 3NOIA 1QNVA 5AVTB 1IT8A 2R94A 4ML4A 3DO7B 1HSAB 2J7GA 2O26U 4RWHA 2NT1A 5CZRA 4L0ZA 2CCRA 2P5EB 3V95A 3L0KA 1P5UA 3U48A 1DKWA 2EO1A 1E9OB 1XF4B 4WTQA 1HXYB 3DX1A 3HGJA 4D2JA 4YXGA 1JTOA 2YMXL 4BXSV 3O6KH 1NOWA 4LV4A 3QI9A 1DSYA 4WDUA 2KBGA 1D6EB 1CLOH 3WO4B 3VFUA 2ZOOA 4RESB 4XC3L 4E9XA 5CEZD 1XL9A 1NIFA 3RNDA 5D1XC 1R0AH 1TPEA 2X0SA 5LGXA 4GG6B 4QEGA 5DD1L 4A7UA 4PFMA 3GMMB 3RVTD 1QO3A 4FQ2L 4MAZA 3QFEA 1NLBL 2P7TA 3L5XL 4WEVX 1XQKA 3MQTA 2ZXQA 4FQHA 2R91A 3E2RA 1J10A 5F2MA 4P48A 1JN6B 1OB1B 3T4YA 3B7YA 1KCSL 1IZKA 1XGTB 4UFIA 3TJHD 2YPVH 1A4KB 1Z9SA 2X09A 4PJXE 4PRID 1UUQA 4IQJA 2QHRH 3TROA 1IUZA 2A7BA 1HOEA 5DJDA 3GSNB 3HI1B 4DVRH 1QCWA 2V3EA 3AGWA 2XT1B 4YPGB 2Y2WA 3KNBA 3ZZQA 1S5IH 4AQOA 1TPH1 4PMNA 1JRHI 3GO2A 4KJWC 2B7QA 3X1EA 1UW9A 3LKQB 4FQLL 3ZSTA 3NIGF 4XRCA 4A2EA 3MUJA 2ZA1A 2E67A 2UY3A 3O16A 3I4KA 2MPAL 2QKIB 5J6GB 2W0FB 3ZKXC 5JU6A 5K59E 3FVDA 1VJSA 3MU3A 3MODL 3U1PA 5CC7A 2OMBA 4Y2NA 1K85A 4LSVH 1F8TH 5KVFE 1A5SA 1INEH 2AJZB 2DIBA 2IANE 3BV7A 1ZANL 3VXSD 3CFIC 2XJ7A 1XIWC 5JIQA 3LEYH 1N3NA 4KRPB 3T0EC 3QZWG 2V9UA 3FT0A 1YEDA 1KO0A 3DBNA 3NPWA 3Q67A 3MJYA 4FOKA 2HFEA 1NKRA 1KNOB 3FQUA 3SQLA 1THCA 1B9KA 4BWTA 2BOGX 1V3MA 4AD3A 4P4KA 4NM4L 4HC1H 1AO7E 1KFAL 2FGWH 2VD8A 4A6YA 3V5DB 3TFKC 5LQBL 1NIUA 3LCYA 2QJGA 4TX6A 3ZJKA 1KZQA 4CNOA 4LLDA 2G3XA 5DBUA 3T8XA 2BNQD 3VFGL 3F2LA 5D1QE 3M0XA 2DJ4A 4GMSH 5D09A 1C1EL 5HULA 1SFDA 4WGKA 1IBZA 3WFHB 1PKNA 2DFAA 2ISDA 2J21A 2KLTA 2OP4L 4CQAA 1MCIA 4G72B 4A35A 2BSTB 1Q9KB 1ZCRA 1TQSA 1Z3GL 2D0HA 4HNVA 1CGSL 3VGBA 1QEWA 1NCWL 4EWND 2ILLA 4IW4C 2FJSA 3CSPA 4LUSA 3PBVA 1NCHA 5AALA 1L6FA 2C18A 3U9PH 1W8SA 3EA1A 4Q4OA 2QUUA 1IIGA 1A0QH 3K81A 3LXUX 2P3ZA 1IAII 3FMGL 5DJXA 5C0NC 1E9PB 5C6TH 1OK4A 1K8IB 5EU6D 3ES7A 4GUCA 1XZWA 2XXCB 2GY7B 4YUEH 5D71H 1D8WA 4JX4A 3FSOA 2RTTA 1LL4A 4AV4A 3N12A 5DXXA 5J6GA 1NCBL 2MCPH 1P7HL 1Z3NA 3QFDA 4XBSA 3PV6A 1TZIB 5JPNB 3RLGA 3B0UX 1AMXA 2OM5A 5E4EC 1YY9C 2HPTA 4HEME 1ZT1B 2GJNA 2IGLA 4I7ZC 3NPSB 4PZVA 1ORQB 3PHQA 3F12A 3ZDZB 2VR2A 4NZ5A 4ZJ9A 5BVJA 3L5IA 3RGVA 4E8DA 3MXWL 3M5ZA 3O6KL 4PR5B 2DQMA 2UXTA 4H20H 1DVUA 2ZZ7A 1UOKA 3IDXH 4OKVA 4XHQA 2Z29A 4RVBA 1AAJA 5GZND 5C0CD 3FTVA 1PHQA 2AV1B 1Q72H 1US2A 2OZ4L 4XZ9A 2OVLA 2EVGA 4KJPD 5GNYA 3HQ1A 1E0VA 4P7OA 4C1NA 2CLVA 3O3EB 2Y8VA 3VRJB 4QRTA 1ADDA 2H9AB 2YL9A 1FAKT 4K3EL 4JFFE 5J1SC 3CV2A 2QR0A 1CGVA 4A6YB 1JWSA 4OR1A 2Y6TE 1FKWA 1R9XA 5B1KA 1FRGH 4PMZA 5BOEA 4QKXB 1S5MA 1D7BA 5FUOL 4PB9L 2WXHA 2BDNH 2XZQL 4UQEA 3WN6A 4F8LA 4I13B 5ACZB 3MV9B 3BK0A 4HPXA 1KQZA 1AHWA 2BTMA 1TCMA 2GUUA 2CJTA 3QQ0A 3WH8A 3WLHA 4YXHL 5FM8A 2CBUA 2EKJA 3KBVA 4ODWB 1XYZA 3NCJH 4CQ9A 5T3ZH 3O8XD 1JPTH 2G2NA 1MUCA 1NFBA 1UOVA 4FALA 3QZPA 4NM8H 4S1RL 1N70A 1UFGA 5BOPA 2CLOA 4FXTA 2O5ZL 4GABA 3SFWA 4DI9A 3QHZL 2V33A 3U7VA 5H2BA 5G2HA 2GKIA 1WYJA 5IG7A 2X1XR 4A7GA 3GDLA 4Q8VA 4P9HH 4KWWA 2JIXA 4H40A 4W4OC 3W2MA 5JBDA 3V0EA 4EE2A 1N6UA 3MGTA 4LIQH 4QAWA 3CUFA 2AABH 2J88A 4P9HC 2J7CA 2E5DA 3I6GB 3OBEA 3PZOA 3S8FB 3MBXL 3RM9A 2CA4A 3G3DA 5IQOA 5GZNA 4TXEA 1W0WB 3L5HA 1FWWA 4AVFA 1XR8A 3EW3B 1CFVL 4JFPB 1F4YL 4FTVA 3CLFH 3RK8A 1BCIA 3MLXL 5HMSA 5A6BD 1AFVL 2CPCA 3UH8A 4FFWC 3GKWH 2WCAA 5LNRA 3HBGA 1FZJA 1MWAA 2YSWA 3AMLA 4FMKA 3FKUS 2Y0SA 2B4CL 2YMXH 3HLAA 1FYTD 2BZNA 3P3TA 5TQLA 1ISXA 4YLWA 3MRKA 4XAGA 5JXAH 3NNTA 2DM4A 5EU6B 3XISA 3G5YA 4EOWH 2Y7OA 3RRXA 1A9EA 2J78A 3X11B 4HYWA 2WBWB 4YZFF 1JQVA 4X7SL 3Q06A 3GSQA 1U8JB 3MRMB 4AU0A 4X61A 2AXFB 4YVVA 1HAUA 4DWDA 1SOSA 2VC2H 4B15A 3G5ZB 4NKCA 3U4AA 2Y7GA 3O4LA 4MNQB 3G1YA 4ODHH 5DMYA 1NICA 5LNVA 3C56A 4TVUA 5DI8B 3CT7A 1V3JA 5LNGA 4HH8A 1XDLA 4EF9A 4HWZA 3QC3A 4QCIB 1S5HB 2G4GA 4LBEB 2WIIA 1KJ2H 2XY2A 1W1TA 4MJ4A 2NR6D 2XN1A 2V5LA 4G7EB 1W16A 4N6RA 4M43H 1NPUA 3OB0K 2A74A 3MROB 1FL5A 1TWSA 2X4OA 1EGJL 2ZUVA 1DBAL 2BNRD 3CBRA 4P2QB 5DA4A 1S9XB 3ALFA 3ULVH 1GKOA 3K2KA 3CX5K 2GL5A 1E5YA 2BK8A 3QO0B 4UILL 2DSWA 2HK0A 1CU4H 2RDUA 3DG3A 1BF2A 3WK2A 4F2UA 3UADA 4Y96A 1XB6A 3TJEL 1PSCA 4ONOA 5GRYA 4Z2GA 4IJ3B 4I9AA 2Y72A 2YEVB 2VFDA 3G9VA 3WEBA 5IB1A 3SM0A 1FWRA 3QG7H 2VOMA 3HUJA 2D23A 3QW4B 1GS8A 1VRXA 3FEMA 5AC5A 2PDLA 2BW4A 1A1MB 2QJHA 1P84J 4UT9A 3GH7A 1PZ5A 3H6OA 5ANMB 5C08A 2O7QA 5ABTA 1NWSA 3LTYA 3NCBB 1GJIA 3KWWB 2WLKA 5DZJA 4QGTA 1SN2A 2O1AA 2VM3A 1DUYA 3M86A 1QFPA 3SBQA 4P99A 3S36H 3VGHA 4YTUA 1N2RB 4Y5VA 1SHXA 1NPNA 2XV0A 2H3NB 5C0DB 3UR8A 1QI0A 4GAGH 5CGBA 5FLVA 3W72A 3CV5A 1A4LA 1TEFA 3MCYA 1E5ZA 3GJFB 4FMVA 2JF1A 4XNXH 3OPUA 2OTUA 4PODA 4F2EA 3GLEA 5DEZA 4HUVA 4LU5H 4O2EB 2VOTA 5C9RA 4HNOA 3EG9B 3JYBA 4EI5C 5FCZA 1H7WA 5IJKA 4NRYA 4Y5YA 4HLJA 1NGWB 5E8DH 3BRDA 4ZPTA 1L0PA 4OLZL 1JPTL 3O4LB 4MNQA 3QWOA 1E4KA 1E3XA 2AXGB 1U8LA 2ZYRA 4XCCH 1FHLA 1ZPTA 3EB3A 1PJ9A 1U3HC 3BGGA 3TUUA 4YXHH 1HL2A 1AQFA 4N2KA 1EEQA 1AHKA 3LRSA 3GSVB 3QIWB 4YHYC 5AW4B 2EYSB 4OE7A 4A21A 3WNNA 2J47A 1F1DA 3ARRA 1JCXA 3SN4A 4GIEA 1R7AA 3LEXB 2P1FA 3E3HA 3NPVA 2VN3A 4M1BA 5HD8D 2QPXA 3SRHA 4XNMA 3HZKB 3V79C 3VB9A 4O5LL 4A04A 3M17A 2G5RA 2LLLA 3FFCD 3RU8L 2Y1HA 2WHLA 5BMWA 4NWTH 3WLLA 1AI1L 5F89B 1L9MA 3MOBL 1GSKA 4ONFL 5I73C 3VSVA 1VP5A 1C90A 1EEUA 3M1BB 3HGOA 3NZRA 1FZMA 4OT1H 3Q58A 2Z9TA 4HHWA 2W63A 4PJGE 4O02A 1S2WA 2QGHA 3GMPB 3FU8A 1KXQA 3HBQA 3FDKA 1MWOA 4NYUA 3AYVA 1J48A 2VDNB 4G43B 5ERWB 5L4IA 4JG0H 4F9PA 3QFWA 2NXZD 1ORSA 1MNNA 1SFTA 3UJSA 1H5BC 3BRGC 2BB0A 4HUXA 3VX0A 4ZOEA 4HMNA 1ULVA 2ZXAA 2GK0A 3MA7A 3MLUL 3QWRD 5ILTL 1MCOH 3WKNA 2H6RA 2VRJA 3UJFA 1LRTA 3QUKA 4N9EA 3SCPA 3V0GA 3LX9A 3K1DA 2OX4A 4Z1BA 3WLNA 3ZE1E 1X4YA 3GHEL 5TDOB 1G7HB 4PLOB 4AYMC 1IT9L 1A5AA 4CADB 5JQIB 5CD5C 2DLHA 1VYPX 4JPWH 4TNWK 2XN9E 2ZXBA 4OLWH 4TTDC 5JUEL 4ZW5A 4JTKA 1A4KA 4OLUH 2QSQA 4ZENA 1S9KC 4Y19B 3I7QA 1T66C 3E9UA 4G80B 2XIQA 3R4RA 3QSTA 4N8CL 4A2LA 1Q9KA 2GBVA 3QCUL 4UILH 3LHPH 4XO3A 3GLCA 1IEQA 1GYAA 3NZGA 5HHPA 5E6IA 1DBJH 5JR1H 1WKEA 3OR7A 3DPBB 3GXMA 4H7VA 3U2JA 4PVBA 2CLFA 1IAOA 4KJQD 3DXIA 2HJLA 4JPIA 3CG8A 3UL4A 1FLRL 3BKMH 1F86A 4L29B 1EVUA 4HYTB 1QYGH 5C09D 1KJ2L 2PYFA 3GLAA 2QZRA 2AQ1A 3B3BA 5KBPA 1X97A 2GSJA 3VIIA 3C60D 5DSCA 1OAJA 1ZT4A 4PGCB 5M1TA 2P8MB 3TVMA 3MKCA 5FUCE 2HWGA 1NBZA 2VB5A 5CR8A 4F5CA 1TMQA 1TKKA 3FTSA 2ADAA 1X5JA 4LKCA 5JDSB 4KJWD 1R75A 4M7ZB 1NCCL 5HHVH 1RCQA 1KGJA 5SWSB 3OZYA 3SJVA 1TUPA 3DHPA 1BYOA 4NQEE 5FFLA 5FKPA 2DORA 3F5WA 3F5JA 2W9EL 5FYJD 1TJPA 2C16A 3HE7C 5T1KB 4GC4A 2F9BT 4ZPVB 1WCBA 2YZ5A 4GBUA 4H9VA 1ZHNA 1ZLUK 1SDAB 4R26L 3D25B 1D8CA 1ZSXA 4QWWD 1ACYL 3U83A 2HRHA 2N7AA 3ROLA 3OGCA 3HNSH 4RJEA 4NAFA 1GGYA 1SF5A 2J20A 1TJHL 3I02A 5CIPB 3U7YL 3W9ZA 3FU0A 4ZMAT 1RSYA 3MBEA 3QJAA 3QLDA 2J5LC 2NX5D 3IGUA 3BYYA 1YY8A 1FUNA 5H4YA 5AVYB 1ZJHA 2GBAA 5KAQF 1GQNA 3F62A 1YN6A 2FLRT 2I60H 3CFNA 4DFIA 2E7DA 2RHEA 4B3EA 3W22A 4PJ7F 4UR9A 3IDJA 4WWPA 3T4AC 3KBHE 4B53A 4L3CB 2RD0A 1I8LA 2B9AA 3LHPL 3OM3B 4NZCA 2OXHB 2RUSA 3NM1A 3Q8BA 4Q9QL 5DYFA 3ROOB 4G56A 2M2DA 3QFDB 1NUNB 2DQJH 3VXQA 5IROA 2HH0L 3DBXB 4NO2B 4JO1L 2JQXA 4N2CA 4W6XB 4J1UB 3TH2T 4ZAKD 1ZTXH 4UMBA 4HIXH 4DRSA 2UWEE 2V6AA 1CGXA 4R0LB 4F48A 2QQNH 3C6SB 1I1AA 4OLVL 4UQCA 3K6NA 4QGCA 1RFDL 1U8IA 2XDFA 3WKZA 4L1WA 2IH8A 5EA0L 4IP5A 1Q1JL 4UF7C 2FX9H 1HHIA 1JGEB 2UBPC 1B2WL 4Z0XA 5L7XL 4Y19E 3F4NA 5IHSA 4AYFB 4OD2B 4LEFA 4QRPD 3DV6B 4YHLH 1YNPA 3CUIA 4B5TA 3ARED 5C2BH 1GGCL 4J7RA 2PYEE 3VXUE 3P4MA 2YLHA 3SDYH 1CXFA 4XXDB 4MJID 2Y24A 4ZQTA 2YLLA 4S3CA 2X44D 5ESVB 4YN3A 3FH5A 5E2VL 4QRTB 3RWHA 2H9AA 5TIMA 2CR6A 5ANME 2FBJL 5G4OA 5JMOC 3O05A 2Z8VC 4UI2A 1K7FA 3ULUF 4HPOL 2H47C 1GXEA 1V03A 1JFQL 5AYTA 3VYLA 2K6WA 2WSKA 1KCUL 3UYRH 3ARZA 3BD4A 4R7DB 4UNUA 3VIMA 3S6OA 2WTPA 5EU5A 2NY1B 2E76C 2R23B 3B5GA 1TU2A 1WIPA 1DTNA 3CJPA 1MW0A 5FHAH 5CD3A 2V81A 2VE6B 3ERXA 1FGNL 4E9VA 5I76A 3A13A 2UUDK 4FS0A 5ISZE 2E7LC 1H7OA 4GE8A 4JTGA 1TUXA 1IAIH 3GZQA 3LV5A 4RLIA 3E8VA 2DZWA 1EWDA 3C8NA 3TZVC 4PB4A 5DRNA 2K78A 5D71L 2J66A 2X1TA 3H7BA 4LEBA 2ZD0A 4W9LC 5HPCA 2Y5TA 3MLWL 4N8CH 4DEFA 5KJRH 1AZCA 2CJ3A 5IM7B 1XIWD 2G75A 1QW7A 4C56E 4CW1A 2JNZA 3ZBMA 1JV5B 1M2VB 5IMKB 3CB8A 2BSED 4BDVB 3N2MA 3QAZB 1N4XL 1A3HA 1OWRM 4ODTL 4HKJB 2G9HA 5KBMA 2HP4A 1RUAL 3ZDWA 5I19H 1Y5VA 3WMBA 1ICTA 1W0WA 1DL7L 4PJHF 5AKRA 4JVPA 1JZ5A 1GZJA 3TV3H 3WJWA 1A4BA 5DYOA 4WAFA 2LE9A 3F6IA 4JFVA 5G5DA 4WO4A 2VSMB 3DROA 2BXVA 5I73B 4HD5A 3DFOA 1CDBA 5CAKA 3HJEA 2HXTA 3KVJA 2WO5A 5D32A 4ETQA 5FPIA 2GJLA 3HKFA 2PTDA 3FYPA 4PS8A 4ZNEA 1RJPA 2FD6H 4E9QA 3B7UX 1J1OH 4L4JA 1WIOA 5DJ8B 3B9VA 3T3PB 4HPOH 3BI9X 4S3KA 2J8GA 4N5ED 3PB0A 1DE4A 1MIEL 5IB5B 3FT4A 1TZOA 2WBJA 4V1DE 1OP5K 5DX7A 4HHPA 4HIIB 2EJ1A 3GXPA 5IVXE 2E9JA 3CN1A 2YSSB 5H2ZA 1UFUA 4JGUA 4A7QA 1BQCA 1KV3A 4APQD 5E5MA 4CCEA 1P4IL 4FABL 4HUCA 5TQ0H 3MQIA 3DG7A 1IVTA 3L4VA 5I75B 5HI4C 4UB9A 1TPB1 1A7NH 4M7LL 4PW4A 1XHGA 1W9XA 3P3RA 4JIPA 1SM9A 4Z1YA 1CXLA 4F37K 3FOLB 3QQNA 5E6ID 4NNPH 4QEEA 4XE5B 1MFCL 1UXLA 4OTXL 4OJFH 4UMSA 2QCDA 1VKXB 5JW5A 3CAQA 3BN3B 5DBTA 1ASPA 3FQRA 3MBED 2Z4TA 2SEBB 3VXRB 3DX2A 3RIAK 2QLVB 3OXRB 3MSRA 5I1JL 4WFFD 1H7NA 3QOMA 4A2DA 4TSCL 1RSFA 9CGTA 4JGDA 5K7JA 2K3HA 1DVXA 2FB3A 3SDXF 1X7TA 3MV9E 2IH9A 5U7SA 1AQKH 4HEPG 4KDTA 2DW5A 3BUVA 1EDQA 3MMEA 4JN2B 4BK4A 4DIXA 2PCPA 4JY4B 2D73A 3F7YA 1OPOA 4WSGA 4CMHB 2WHMA 1F3DH 4OKDA 4NJKA 2G30A 4TF4A 3KEDA 3TBVB 4JGNA 3VFSA 5B3NA 2W5FA 2VLME 2J44A 1PD6A 2MEJB 5LXGL 2X1UA 3UW6A 2XWDA 1MAKA 1X5IA 1M7DA 3NQMA 4K94L 1FYHB 2B1AH 5AYUH 2GSGA 3RPBA 3WDPP 3QXUA 2WXOA 2F58H 3IJSA 3BQ5A 2FDBP 1RZJH 2GGEA 2Z1PA 1SY6H 4OGAD 1ACYH 4I1RA 4A67A 3VW3L 4LLMB 1UM6L 1MIML 1Q8MA 4MMZB 1OG6A 2Y3NA 1GCYA 1TX2A 4C7FA 1TTJA 3QORA 4BV1A 2XU2A 4O19A 3SGJA 4NJ9L 3N3TA 3F7VB 1JPSH 3BD3A 3JV6A 3QAZC 3EYOA 4NZDA 4Y2LA 3U7WL 2H3BA 1AQDA 3QUZB 4GRLA 1QAWA 4FA8A 3BLFA 3TYDA 2A73A 2PETA 3GSMA 3L16A 1YKWA 2OGYA 3KM8A 2N0KA 4AUBA 1M9WA 2EUXA 2VC2B 4LASH 4Q4KA 5ETUA 1PIIA 3RWJB 3QI9B 1J18A 5LN8A 3U4BL 1SJDA 3RDJA 3MWCA 25C8L 4TUOA 1V3HA 3VIGA 2ZDSA 2D0GA 3DFTA 4PY8J 3KPQA 5D2YA 1NFDA 2CLLA 1EXUA 1YEHH 4G43A 4L1BA 1KLUA 2PUZA 3NCCB 1GYUA 4FFVC 4KKAD 4US5D 2Z3FA 1UEMA 1UJ3B 3ABKB 4O02B 2QVHA 4OZFH 4L0YA 1UH3A 5DLCA 5FV1L 1V55B 4FZEL 3UYOD 2YS4A 5LN4A 2F6XA 4DZAA 4EQ2A 3R43A 4HA0A 2CWNA 5AENA 5CU9A 5FF6B 3TBVA 3V0HA 4WIWA 5FAGA 1V54B 5J8LA 4U1HB 1VYRA 4QDGA 2PDUA 3RWCB 2BWGA 4OLEA 1A64A 4PV8A 3ZR6A 1IT9H 3AHXA 3G1SA 4GIAA 4NHUB 2BMKB 3AUVA 2OCZA 3Q1EA 5E1AA 1YNTF 1GHFL 5I9QC 1UWQA 1U3NA 5B1CA 4NAEA 2XSKA 4DPRA 1BQLL 3ITLA 1XXXA 3ARDC 5B7MA 4OV4A 2VDRB 1JK9A 5DS8A 2QF8A 3IUIA 1U3ZA 4KJYA 5SWZA 1PTZA 4M1GL 3ISWA 4RRPM 1Q7MA 3U9PL 4WFEE 1K3IA 2G5UA 1Q13A 1V5XA 3D2UD 2Q2LA 3SPVB 3P40A 3U4EB 3TJEH 4M7SA 2CERA 1RVKA 2GI0A 4MNQD 2DQWA 4U1NA 3NPUA 1CDYA 1LTDA 4HTBA 1XAUA 2R2HB 1JCJA 4A2HA