3CTTA

Crystal complex of n-terminal human maltase-glucoamylase with casuarine
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
862
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Total syntheses of casuarine and its 6-O-alpha-glucoside: complementary inhibition towards glycoside hydrolases of the GH31 and GH37 families
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase
total genus 274
structure length 862
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3cttA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cttA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3cttA01
4PCTA 3SUWA 4F66A 3U5UA 4LQ1A 2W4XA 3VMNA 1EQPA 3KWXA 4AY1A 1KQZA 1X6NA 4HMCA 4P8UA 1J01A 4D6GA 3DX3A 4HU8A 1JNDA 1H0GA 4EE9A 1B30A 2DQXA 5HDRA 1CXLA 3PZGA 1UZ1A 2DT1A 2XUCA 2ZE0A 5A6LA 2WK2A 2CESA 4MNJA 3BH4A 3SUTA 2PB1A 4QCFA 2VRKA 3ZMRA 1Q6EA 3M7SA 1E4MM 1M04A 1PIGA 1TQSA 4KRTA 3EDDA 3K8KA 5JBEA 4PMZA 4JZ5A 2J77A 1Z32X 3BUQA 4H8VA 2GJXB 1ECEA 2ZX5A 5GNZA 4BF7A 1QI2A 3ZOAA 4M8UA 2G8ZA 2O9RA 4UQAA 1WP6A 1XSIA 3N11A 3CHEA 4YHEA 1MVYA 1DWHM 2DPEA 1W9UA 3WY3A 8A3HA 2QV4A 4W7WA 3D50A 4AYSA 3VD3A 2X0HA 2ALWA 1W32A 1CWYA 1UZ4A 1JXKA 1MFVA 4JKLA 1TQWA 2YLLA 3F5JA 4QCEA 3SCUA 3CUGA 1JDAA 2AAAA 1UA3A 3DHPA 4E8CA 4Z2JA 3S2CA 2BXYA 3ZR6A 5AYIA 4LXFA 2TAAA 4BA0A 2UY5A 3AS1A 4AZCA 1TMQA 1VBUA 3WQ4A 4OBRA 2E4TA 2WLYA 3VGEA 3WDIA 1B90A 2E8YA 3CTTA 3MO4A 3WDRA 2NT0A 2XWDA 3KL3A 1E70M 5I78A 1HP5A 1ZBWA 1K9FA 3BVTA 3VGDA 1BHGA 3L2LA 2BVTA 2OYKA 3QHNA 3B9EA 1HVQA 2E8ZA 3EJTA 4MB4A 5C70A 2ZUSA 3VINA 3WNMA 1J9YA 1PX8A 4J27A 2PWGA 2J25A 1HXKA 4V27A 1DP0A 1ODZA 5A6KA 4FNRA 1E6RA 4HPGA 4MDOA 3FY1A 1UD6A 4HU0A 2J8FA 3W29A 3TONA 1F4HA 3OGVA 3SUVA 4OOZA 1UHVA 3AS3A 1FOBA 4FLSA 1VEOA 3ARRA 4YN5A 4M81A 2CBVA 3HG2A 3SCPA 2UWFA 2RGMA 5HNNA 3SCNA 4J3TA 1LQ0A 2ZXBA 5BXSA 1JYVA 2WMIB 1IZJA 3W6LA 4NZCA 4P8VA 2EJ1A 3AJ7A 2WANA 3CZGA 2X1IA 2XFYA 3LRLA 2CKSA 4W85A 3WUFA 4PMDA 2YDSA 1V6WA 4U5IA 3VO0A 4V28A 2PF0A 1JZ3A 2XSBA 5D9NA 1UD2A 2CYGA 4PTWA 1J0IA 1W91A 3SIMA 1R34A 1KGUA 3AIWA 3SUUA 1PS3A 3G6LA 2Y8VA 1R86A 3AMLA 5A8NA 3WN6A 5BXRA 1VB9A 3RJYA 1W2VA 3U7BA 3G6MA 1WO2A 1TQUA 3LRKA 1NQ6A 3EBVA 1E5NA 1M53A 3IJ9A 1PAMA 4J3WA 3GH5A 3WBEA 5A2CA 3S5ZA 4U33A 2V3FA 1GHSA 1C93A 4AZCB 1UWTA 2YA1A 1BF2A 4TX8A 3VIIA 4AZ6A 4JFTA 3GNRA 1NOFA 4M29A 1J0JA 1V3KA 3EDJA 3MMDA 5FKYA 1JD9A 1ZBCA 1KR1A 3CO4A 2G41A 1S46A 1EOKA 4W8AA 4F8XA 3OZOA 3BAXA 3AZTA 3CGTA 3O2LA 1WZLA 3CZNA 2ZX9A 1HX0A 1LLOA 1GOQA 1PCPA 1GPFA 3WH9A 3MV01 4Q7NA 3GYCA 4AXNA 3B8SA 1GQLA 2WHJA 3N04A 3OLGA 4AIUA 2D2OA 5E9AA 3MUAA 4X0VA 5ECUA 1J11A 4A3YA 4R5EA 4DUXA 3L2MA 1OGBA 3VU2A 3VGHA 1KXHA 3PZOA 3W28A 4MB5A 1YHTA 1UWIA 3PTQA 1FA2A 2EEXA 3M6DA 1BPLB 3MUIA 1GVYA 3MS8A 3ARSA 4PMNA 4W5ZA 3VDBA 2D20A 2DDXA 5D4YA 3WMBA 1HKIA 3S5YA 2Y8KA 2WYSA 1MW3A 1G01A 4W87A 1HT6A 1CXKA 4Y7EA 1US3A 3BMWA 4NRRA 3PHAA 3MSGA 2WB5A 4TTUA 4W7VA 2F18A 4B15A 1W3HA 3ARWA 4GQQA 4DWSB 1V02E 2IGTA 2XHYA 1KR0A 1E55A 1GJWA 3EJUA 3AMGA 2D1ZA 2JEPA 5A95A 2VRJA 1UKOA 3WQ6A 3A4XA 3NDZA 1H11A 5E70A 3AXHA 4PN2A 1BTCA 1XCWA 3AS2A 1X1NA 1HJWA 3AI0A 2J7GA 4OGZA 4CVUA 5LA0A 2E3ZA 3WSUA 4OUEA 1W3LA 1ZS2A 4WSJA 2D23A 1D2KA 2WCAA 1UKSA 3CMGA 1E1FA 3BLBA 3F5LA 5DF0A 3RM9A 3CZJA 3WNKA 2BNJA 4AD4A 1F4AA 3WUBA 3MU7A 3NCOA 1PX4A 3WQWA 2D24A 3CLWA 2EACA 3OGRA 1CIUA 2JFEX 3WF4A 4W7UA 4FNTA 3IAPA 4J7RA 4GZIA 3OLDA 3IK2A 3THDA 2CKRA 2WMGA 3AMKA 4CCDA 5D9OA 1XD1A 2WSKA 4M56A 4H41A 2DIEA 4HA1A 3NYDA 5CPSA 1KTBA 4GQRA 1UR4A 1HN1A 1XH0A 3BXWA 3VIKA 3ZT5A 1V0MA 3PZQA 4UZUA 4JCLA 3NSMA 3UESA 2BV9A 1NOWA 1IV8A 1MW2A 2PC8A 2AMGA 7CGTA 5HBFA 3WL0A 4W88A 3AIBA 1JZ5A 1GOMA 1BLIA 2F1AA 3A6OA 4ACYA 2VX7A 2XYLA 2VNCA 5HPOA 3AFBA 2CBIA 4A4AA 2X0YA 4PMUA 4B9ZA 1UH2A 1UUQA 4AEEA 4GO8A 1VF8A 4XZWA 1HIZA 2WVVA 3OGSA 1BAGA 1K9DA 5IXEA 3LPGA 1KGXA 2WKGA 2O9TA 1JFXA 3K4AA 3ZM8A 1B9ZA 1W9XA 3RDKA 3VMOA 3K1DA 4GI6A 1E71M 3VNYA 4DUWA 1RP8A 3VD7A 1YQ2A 4LYPA 1QHPA 1ZBVA 5HXMA 3II1A 4CU6A 2QF8A 1GJUA 3BAKA 4JFWA 1C8YA 4W84A 2YIHA 4CU8A 4DO5A 2VC9A 5CPQA 2FH8A 3GXMA 3D3AA 3IJ7A 3VMPA 1OB0A 2J7DA 4FLRA 5A69A 3T2OA 3WF1A 1JYXA 4OBSA 2PWFA 3AIRA 3KLKA 1KFWA 2EO7A 1HKJA 2MANA 5I77A 5CSUA 4AZHA 4AMCA 1UR9A 2FH6A 1E0WA 1VFUA 3IGUA 3ZO9A 4D6JA 1LWJA 4CD6A 3M07A 2F1BA 4KH2A 3GXIA 1P6WA 4JFSA 3OBAA 3GBDA 5I0DA 1LL7A 1OIMA 4P7OA 1D3CA 3KLLA 5KEZA 1CGVA 3EJSA 1CYGA 2CXGA 1KXQA 1TCMA 3BMVA 4PTMA 3UCQA 1V03A 2XVNA 1JG9A 3QGVA 3FXYA 3OA5A 4MDPA 4NRSA 1LL4A 4JHZA 1CNVA 4P7RA 1HVXA 2VX6A 4CD8A 3AIEA 4H7VA 1KBBA 2G3JA 3VIOA 4NZJA 3AQUA 5ABFB 2C7FA 2ZOXA 1J12A 2V3EA 3LXBA 3MSDA 5A6BA 1HJVA 4WF7A 2J7FA 5A8OA 3DX1A 2VZVA 2D3NA 1V08A 2ZUTA 2QLYA 3BVUA 3MUY1 3FW6A 2GDUA 5I79A 2EADA 4UFHA 3D4YA 5FD0A 3L4ZA 3BLKA 2GJPA 1L0PA 1HXJA 5DEZA 4UFMA 2WVSA 5ABFA 3W26A 2GJRA 4TXEA 4NXKA 2VZTA 3ZJ7A 3POHA 2WBGA 2EAEA 2DT0A 1OGGA 3VIJA 1EA9C 1NOUA 3GBEA 1B31A 2PWDA 3A21A 4EKJA 3VD4A 1E6ZA 4OIFA 3SCOA 2ZXQA 3KEHA 1DHKA 1EDGA 3TTQA 4IUGA 5A6AA 2WWCA 4FNQA 4IPLA 4BCEA 3CZKA 3VD5A 1UKTA 2EPOA 1CTNA 4PUEA 1EDTA 2VQUA 4EK7A 3RJXA 4MNMA 3EJRA 1TA3B 4LYRA 3LPFA 1WZKA 1QBAA 3A47A 4FLOA 4P7LA 2NT1A 5CZKA 3NUKA 1BVNP 5I6SA 4ZXLA 1J0KA 4CVWA 1UH4A 2XIBA 1OM0A 3VSVA 1WKYA 2XVGA 1FHLA 4W5UA 3WF2A 2BVDA 3K46A 3VIPA 1E4IA 4TVDA 1C7TA 4DWSC 1O6IA 2VVNA 4KGJA 3BVVA 2DT2A 3ECQA 3M46A 2XGIA 4D6EA 4QDMA 4MB1A 4MNLA 1WB0A 4HZ7A 5DT5A 3N15A 3W37A 3HN3A 3VDAA 4CN4A 1J0YA 2OSWA 2WZIA 4X9YA 4MAZA 5IDIA 2JF6A 3LXAA 2WMJA 2F8QA 3BSHA 1H4PA 3W25A 3O9NA 2DSZA 4FNUA 3AYSA 3PZNA 4HA3A 4PMQA 5C71A 3KL0A 5CGMA 4PMVA 2V5DA 1XCXA 1B1YA 4PMOA 4ZENA 3AMDA 2FYVA 1MQPA 4C7DA 2D22A 4GIAA 4MTVA 3KL5A 2VZSA 3NSXA 3N9KA 1UWQA 3WDQA 1KWKA 4LPCA 2WC4A 1E5JA 2XGBA 4AD5A 4URIA 1SMDA 3EDEA 1HJQA 3ARZA 5E09A 5DMYA 4M24A 1QNSA 1WDQA 2ZICA 2D3LA 1UD3A 4PEEA 3MKKA 2XPKA 1R47A 4RL3A 3U7VA 3RILA 2DH2A 5GPRA 3BAYA 2YKKA 3D5HA 4WJXA 4P7QA 1BYBA 2FE0A 1GNXA 3MUZ1 4DUVA 1QHZA 4U5KA 2EPKX 1E0VA 4FLQA 5IHSA 3CUIA 4W8LA 1FP9A 5BRPA 3WFZA 1NARA 1CXFA 3WH8A 4J3SA 4XZBA 2WSPA 2EPNA 4KGLA 1BYAA 3K8MA 3WDJA 1G1YA 3CIVA 1TG7A 5A2AA 1Q6DA 2D0HA 4UQDA 5EFFA 3I3DA 1XYFA 1E6SM 2WCGA 3GNPA 4PMYA 2CHNA 3EMCA 5CGTA 4UQCA 4AIOA 3SCQA 4ML4A 3VGGA 1NWTA 1JNEA 1OINA 2W63A 4ZE4A 3AOFA 1RPKA 2OSXA 1E4LA 5A6MA 3RO8A 4NI3A 1W1YA 1GZJA 3CUHA 3SEPA 4ACZB 1GQIA 1K9EA 4L4OA 1KWGA 1JZ7A 3SCTA 3TP4A 3VUPA 1CEOA 4GINA 3AXIA 1RH9A 1E56A 4S3KA 3WH7A 3CBWA 1CGTA 3KZSA 3MV11 2FDMA 4ATLA 1BG4A 3IJ8A 2WMKA 2CETA 2F2HA 2WC7A 5CLWA 3IANA 4YPJA 2IUZA 1IT0A 4P8XA 2J7CA 1H41A 4C7FA 1W1VA 1XRVA 1SFSA 3I3BA 3U57A 2BFGA 3UG3A 2G3NA 4MJ4A 4D6CA 4BQ2A 1FHDA 1H2JA 1DWFM 2CBUA 5M5DA 1W9DM 3ARPA 3GXTA 3GH7A 5LYRA 1BFNA 3GXFA 3VOCA 1JIBA 4J3XA 2X2HA 1E9LA 1GOOA 3WF0A 3EJPA 4ZE5A 4J3VA 5LA1A 1ODUA 4H8HA 1EHAA 1FP8A 2DSWA 3DYOA 3WEOA 3WL1A 3HG5A 2X09A 1CXHA 5EFDA 1ITXA 1GHRA 2VZUA 3WNPA 1UR1A 2WW5A 3UERA 2YL9A 1V0NA 3W53A 2JF7A 4WKAA 1OWQA 4R27A 4JL2A 4TVCA 2W61A 1BG9A 4HPHA 2ESCA 3VVGA 1NP2A 5DFAA 1XHGA 1ZJAA 1D7FA 5ABHA 1CENA 4DO6A 3WEZA 3QOKA 1V3HA 1XH2A 3GXPA 2OW6A 1E6XM 3WD2A 2W67A 5A8PA 4B3KA 4UFIA 3T2PA 3E1F1 1HTYA 1CPUA 2E40A 4MPKA 1R75A 3AROA 3ARVA 4KWUA 1W1TA 4TOQA 2VR4A 1OCQA 1T0OA 4UOJA 1JGIA 1W3JA 2XG9A 2VX4A 4OJYA 3D52A 4ZEPA 2D0FA 1UH3A 1JZ2A 4B9YA 2J8GA 2J7EA 3CZSA 2Y4SA 2A3BA 3LX9A 5BRQA 1G94A 3A3HA 2F7PA 3UG5A 2B31A 3VTRA 3DX0A 5I5RA 1H09A 3DHUA 3D51A 1M7XA 1VRXA 2Y5EA 5I23A 1E43A 2O9OA 4FNPA 4LX4A 3WKZA 1MQRA 3TTOA 4FK9A 3A4WA 3NIYA 4U3CA 2F7OA 3VM7A 1C91A 4D6FA 1E4NA 1WAWA 1KTCA 4B3LA 2X05A 5CPTA 1NH6A 1XH1A 3EJQA 2XN0A 2PWEA 1JAEA 3CH9A 1LWHA 2DT3A 2J75A 1KCLA 4D1JA 3AISA 1M01A 2JALA 1UD5A 2CCRA 2VX5A 4MJ2A 1KB3A 4GI9A 1FH8A 4MAVA 2J7BA 3BAIA 1HNYA 3T08A 1U33A 2GK1A 1BQCA 2WZHA 4Z2KA 1UYQA 1VBRA 3DYPA 2WAGA 1PJ9A 5CQ1A 4AISA 3WH6A 1CLVA 4N42A 1QBBA 2WXDM 4BQ3A 3WUGA 4AC1X 1DEDA 3ARXA 4GXPA 4IPNB 1TFVA 2OYMA 2GK1B 4DM2A 1MYRA 2QMKA 1E15A 2GVYA 1TVNA 2VVSA 2XFRA 3SURA 1QWNA 1QWUA 4IM4A 3ZJKA 3A4AA 3VIGA 2NW0A 1V6VA 2CITA 1W3KA 2OWWA 1QW9A 3BVWA 7TAAA 4CD4A 1BYDA 2QMJA 1GONA 2WM0A 2HVMA 1JYNA 5FL0A 1FFRA 2CEQA 1BVZA 3H54A 2G3IA 5A3HA 8CGTA 5TD4A 2FGZA 2WVVB 2RGLA 3CV5A 1QNRA 4UFLA 3BLPX 3HZ3A 4OZOA 2XTKA 3WF3A 5E0FA 3UR7A 3WH5A 3L4WA 1TR1A 2F7QA 3EDFA 2ZUVA 1HF6A 3SCRA 1MW1A 4U31A 2X8RA 2W62A 4AD3A 2Q8XA 3UG4A 3AZSA 1JAKA 3T09A 1EOMA 4BS0A 3K4DA 1I75A 6CGTA 4DWSA 1E72M 2V38A 1V3MA 3WDPP 1CECA 4GKLA 4UR9A 5EB8A 2EQDA 1JZ6A 3BAWA 3SCVA 5BXTA 1TA3A 1PSPA 4CD7A 1QI3A 4YHGA 1E3ZA 5A8QA 1EXPA 2QHAA 2ZUMA 5JBDA 1JI1A 2OSYA 1WNOA 1JL8A 1MQQA 5AC5A 3HJEA 1TQTA 4F79A 3GXDA 2A3CA 1LG1A 1JXJA 1E3XA 1HKMA 2YL5A 4LGXA 2XJ7A 2V3DA 5EMYA 4AD0A 3AYRA 1R7AA 3B9AA 1B3VA 2GFTA 5E0CA 4KRUA 1H5VA 1E9TA 4HMDA 1SMAA 2YLAA 1BYCA 5GNYA 3W27A 3VSTA 2BY1A 4D72A 2VZOA 4NSBA 4H8UA 4RE3A 2G4FA 1UD8A 1E0XA 2E0PA 2VCCA 2BS9A 3L4XA 3KE0A 4CD5A 1PBGA 4Z2IA 1UD4A 2IXVA 1JFHA 4AMWA 1BGAA 4AYGA 1PE31 4ATDA 1KCKA 1XD0A 2UY2A 4ATWA 3VDHA 2ZXAA 2DIJA 4JAWA 3GDBA 5JIPA 2IXUA 1V3LA 2DSUA 4D71A 2XWEA 1TZ7A 5CLTA 1VEMA 3I3EA 1C7SA 2V5CA 4UTFA 4IISA 2VR5A 1ISXA 5ABEA 1PX3A 3WDHA 1HKKA 1HP4A 3EYPA 3IAQA 3VIHA 2EABA 3O6AA 1EHNA 2OW7A 1EIBA 1EDQA 2DH3A 1VJZA 4HZ6A 3T0DA 3N13A 2UY3A 3TV8A 2E9LA 2OYLA 2PBGA 3VILA 2W92A 3VIFA 4QP0A 4QLJA 3WMCA 9CGTA 3CUFA 1JD7A 2ZX7A 3ARUA 2WBKA 1GOIA 1GOWA 5LA2A 3GH4A 3ZSTA 1R33A 3PN8A 2WPGA 3PZMA 1QI4A 2XVLA 4CCEA 2G3MA 1W2PA 1E1EA 4UZSA 3OG2A 1O7AA 3FN9A 1Q4NX 4W93A 3OB8A 1I1XA 2CERA 5JIWA 5BXPA 1EO5A 2J74A 1OD8A 1H3GA 3UR8A 3TTSA 5JUVA 1L8NA 2WZEA 1RP9A 1QHOA 5FOOA 2WMHA 1CBGA 2DSKA 3PZTA 4AD1A 1MXGA 1FH7A 3N18A 2YBTA 4D6HA 1B3ZA 1BGGA 3AIQA 1VFOA 2PI6A 3TOPA 3FAXA 2JEQA 1EQCA 3T2QA 3DDFA 2X2IA 3VX0A 2DEPA 5IHRA 4F9DA 1MXDA 1UOKA 4PMXA 2YL8A 3W6MA 1UR0A 2DGAA 3AICA 4GZJA 3WMSA 1AMYA 3QR3A 3HG4A 1A3HA 1BSIA 4PSRA 5BROA 5I2UA 3N12A 4CUCA 4CU7A 3SUSA 1MFUA 1W9VA 2NSXA 3VX1A 3WD4A 4TUFA 3VGBA 3ARQA 2FHBA 4OKDA 3PZUA 3WQVA 4K68A 4JCMA 3CHCA 1B0IA 1QNOA 3CMJA 4XB3A 3H53A 3AXXA 1AQ0A 1O7DC 1E6NA 3WIJA 2BY0A 3SCSA 4AZ5A 3AHTA 4P7NA 1AQHA 3H55A 2VCAA 3EMQA 3K8LA 3BVXA 4J3UA 3AS0A 7A3HA 1R46A 3OLEA 2XFFA 1CDGA 2WKLA 2A3EA 3AHXA 2VOTA 2WVTA 1NWSA 4Z2HA 3PZ9A 5M17A 1VIWA 3VKKA 1QVBA 1OGSA 5DT7A 1US2A 2BY3A 2WMFA 4QLKA 1HWWA 1B2YA 3GTNA 3GXNA 3VNZA 4AZBA 5A6SA 3W4RA 2ZWYA 3VSUA 3T0BA 1UQYA 3SCWA 2YL6A 2CIPA 3ALGA 2ZUUA 2J4GA 3PZVA 4J28A 5D9MA 3CPUA 1B3WA 1JZ8A 3CUJA 2FHFA 4C7GA 1UKQA 5D9PA 1R7OA 2OLHA 1CZ1A 3WD3A 1WZMA 5CJ5A 4QAWA 3AHYA 1V6UA 1LL6A 1A47A 1GORA 3ARTA 1VFFA 2F7RA 3BAJA 4W86A 3N1AA 1J0ZA 1PS2A 2UY4A 1I1WA 4H2CA 1IZKA 2ZX8A 1PZ3A 4UFJA 4XUYA 4N0RA 3LRMA 4M1RA 4RE2A 1CGYA 1XSJA 3W0KA 4PSPA 1C8XA 2WNWA 1UG6A 3DYMA 3LMYA 4D6IA 1OD0A 4A3HA 4AMXA 2BXZA 1LJYA 1E6PA 2A3AA 3AMCA 5E1QA 4AWEA 1MWOA 2ZXDA 1VFMA 3DDGA 4ACZA 1K6AA 3A23A 1GQKA 5BCAA 1VJSA 5AC4A 1CXIA 4V2XA 1CXEA 5CG0A 5FL1A 4NXSA 1SZNA 2ZUNA 2VL4A 1NP0A 2CPUA 4HOZA 2YA2A 1QOXA 2BHZA 1KBKA 4NZFA 1GVIA 3POCA 1J18A 5I3DA 4FNSA 2VI0A 3WUEA 1UWUA 5A6BD 3WD0A 3D4ZA 2J79A 3APGA 1NWUA 3WEMA 2Z1SA 2PSPA 1R85A 2XIIA 4AEFA 3CZ8A 1E73M 3OZPA 1C92A 1DWAM 5M03A 1J10A 4CN6A 1B3XA 1R87A 4HZ8A 2WHKA 2V3GA 3WD1A 3BGAA 4D6DA 3WQ8A 4MB3A 4WIWA 4JFUA 1WPCA 3DX2A 2XM2A 3U5YA 3QHOA 1QPKA 3WNOA 2VMFA 4NX0A 1JYWA 3AHZA 3ZJ8A 2WMIA 3CZLA 2C8NA 5GQBA 4TTGA 1H1NA 4PUDA 3RIKA 3ZT6A 4JHOA 2GSJA 2A3HA 5A1AA 3WY2A 3T0AA 3VDCA 3VM5A 2VRQA 4UOZA 3BCDA 2WC3A 1G5AA 3MMUA 4M80A 4BQ4A 3NDYA 4UCFA 1DWGM 4HMEA 5GNXA 2C0HA 1LG2A 1WCGA 2YFOA 2CHOA 2GDVA 2VURA 2X2YA 4UQBA 5HOSA 3OLIA 1FFQA 1KGWA 4GO9A 1GOKA 4WSKA 3TTYA 1ZBKA 4HA4A 1TQVA 2WCSA 2CBJA 2Y2WA 5EBAA 3ARYA 3LXCA 4UOQA 2YDQA 4BQ5A 3VD9A 3AZRA 5AY7A 4S3JA 3DX4A 2W91A 3PTKA 4XV0A 5JBFA 3WQ5A 1HL9A 5DO8A 1ZL1A 4UQEA 2O92A 3BSGA 1V6YA 3AHVA 1WE5A 1KQYA 1JI2A 1QI0A 5IFPA 4PTXA 4E8DA 3VGFA 3JUGA 2VO5A 2WHLA 4MADA 2YBUA 3A22A 3ZR5A 1PZ2A 4QFUA 4D1IA 2WWDA 4PTVA 1AQMA 2BHUA 3W38A 4DO4A 5CSYA 4TX6A 4NF7A 1OIFA 1UR2A 2GUYA 4Z2GA 5FCZA 4JKMA 4W8BA 1C90A 2OWXA 1E6QM 3OIHA 4QLLA 4UFKA 1UWSA 1XC6A 4CKQA 1EGZA 1ZU8A 2YOCA 2VJXA 3J7HA 3S6TA 2CNCA 1VEPA 1JF5A 1SR0A 1JDCA 1XSKA 1C8QA 1CGXA 2O9PA 3F5KA 4WKFA 2EBNA 3HMCA 3CHFA 2YDRA 5E6YA 2J7HA 2JIWA 3ALFA 3WNNA 1XYZA 1DWIM 5E6ZA 4JIEA 5BWFA 1UQZA 4UNIA 3W82A 4FMVA 3ZQ9A 1ZB5A 2YJQA 4F9JA 1W1PA 1OT2A 3PTMA 2PBOA 5A6JA 2XN2A 1KXVA 4JKKA 2QPUA 1CLXA 1UR8A 2XN1A 1GCYA 2W66A 3GZAA 4U3AA 5ABGA 4LYQA 4JFVA 4M82A 4JL1A 1OT1A 2D0GA 4PYSA 1PEZA 4AW7A 4E2OA 1ESWA 4RE4A 4EAMA 4X0NA 1U30A 1LF1A 1JF6A 3BC9A 3FHQA 1UWRA 2FGLA 3RMEA 1V6XA 3LPPA 3TA9A 4P8WA 1V0KA 2Z1KA 2E9BA 3BCFA 1J0HA 1QNQA 2EXOA 3HG3A 2ZUWA 4GZEA 1VENA 2BY2A 4AD2A 1GUVA 5AYBA 2VT0A 1Q6FA 4KMQA 4CCCA 4H04A 1KXTA 2VUYA 4PRWA 2ZX6A 1WDRA 4UQ9A 5HPCA 1DWJM 1ISYA 2D73A 4U2ZA 2XSAA 4WKHA 4BZYA 1OSEA 1HJSA 4DM1A 4HOWA 1GW1A 2OWCA 1WDPA 2J47A 6TAAA 1VAHA 3L4YA 3CHDA 1HI7A 3NSNA 5FIPA 1W9BM 3CC1A 1ISZA 3L4UA 1E40A 4W89A 1JZ4A 1WDSA 2ZWZA 4TVUA 2EPLX 3MANA 1X6LA 2E9MA 4Q22A 3VIMA 3MI6A 5IFTA 1RD6A 4AZGA 4Z2LA 1H0IA 2J78A 6A3HA 1GQJA 3ZJ6A 1CGUA 2YFNA 3MMWA 4PCSA 1V0LA 3A24A 4AIEA 1M03A 1JDDA 3WELA 3DECA 4HTYA 3THCA 1XV8A 3RM8A 4MNKA 1K9TA 3W24A 1UASA 1NWRA 1AVAA 2W5FA 3GNOA 1NM9A 3QHMA 2WVUA 4OOUA 3BUDA 4DWSD 2GJXA 4E4PA 1QNPA 3W81A 1WZAA 3L4VA 1MW0A 3WNLA 4ZXOA 5M3WA 3WY1A 1W9PA 1TE1A 2WLZA 2VQTA 1ITCA 2ZIDA 1Q6CA 1B3YA 5A8MA 4U2YA 3ZT7A 2VCBA 2PWHA 3PZIA 3GM8A 3WENA 2XVKA 2AOSA 1QW8A 1TVPA 4AZ7A 3RPMA 3QOMA 2JE8A 5A2BA 3NJ3A 5D8WA 2BVYA 4HOXA 3L4TA 3B9DA 1QI5A 1Y7VA 2QPSA 1G0CA 3RM4A 2Y24A 1ISVA 3ZSSA 4PMRA 2X2JA 4WLCA 2YA0A 3AIUA 1CGWA 3FAWA 3FHAA 3UETA 2F61A 3EDKA 1ISWA 3AIVA 2VTFA 4L4PA 1EH9A 3A5VA 4CGTA 1V3IA 5CXPA 4GI8A 2DSVA 3ZIZA 1SYTA 5I24A 4AZIA 1XGZA 2JIEA 1PIFA 3EMZA 2J62A 1TUXA 1U2YA 3UEQA 1UKPA 5KZ6A 3LPOA 4CN1A 3BUPA 2XVPA 1Q6GA 1V02A 1HJUA 4ZFMA 3N17A 1EO7A 3RCNA 5F7UA 1OBAA 1R8LA 1QX1A 3HU7A 3F4VA 3WBAA 1H49A 1HJXA 2EPMX 4B16A 3WFLA 4HP5A 4GPNA 3BUBA 3FNDA 1N82A 2XM1A 3DC0A 4XX6A 1UA7A 1FH9A 1DTUA 4EANA 4PBGA 5D8ZA 3VPLA 2FHCA 2HISA 3PBGA 2WHMA 5C8BB 1V3JA 5A94A 5BYWA 4FF5A 1ZJBA 3WY4A 1C3FA 3BUIA 1PPIA 3CZEA 1G9HA 4WK9A 1HL8A 2BHYA
chains in the Genus database with same CATH superfamily
4L4PA 3RLSA 3UWYA 4F66A 4UAOB 4RNIA 2MOVA 2PTTB 3EBHA 3CDGA 1T21A 3M1OA 5MENA 4HNCA 3VMNA 2A7BA 3HB3D 3RTQD 3QBTB 3V0SA 1F6AA 4N6QA 1KM5A 1KQZA 1LQBC 3OPSA 2QLVB 4M03A 3DX3A 4GFSA 5J8LA 4F0MA 2ZOTA 4HU8A 4L4TA 2XSKA 1H0GA 3C60C 4DXXA 3RHWF 2EEFA 2HN7A 5T5NG 1K6WA 1KBJA 4K7VA 2NWSA 2A7NA 2BRRL 1LYQA 4H6KA 4WUUD 2QJNA 3BGFB 4MFHA 5D1XB 2ZE0A 2P8LB 2WK2A 2H3NA 3B8TA 1SRDA 3RBSA 4HDIA 2CESA 5ALCH 3LCFA 5EYWA 3WBYA 3Q5TA 4DK3A 1GJPA 4AX7A 2GY7B 3KPRE 2Q7NA 5AVHA 4XGZB 5KBKA 1MCEA 3M7SA 4ZUSB 1Q9WB 4JHVA 5CEXB 4X2RA 4Z7IA 1PLAA 4MKMA 1M04A 2EJAA 4OGXL 4U7SA 1QVOA 4WW1B 3N4EA 3K8KA 1V7NL 3HPLA 1K2DA 1ZLVH 4O1AA 5CC6A 2YMXH 4DW2H 4KKRA 1WFTA 1AW2A 1WX0A 1XIFA 4UBDD 3SZ6A 3QTGA 4JZ5A 1JK8A 1U95B 3BUQA 2HVOA 4HGMA 1Q94A 2MKLC 4HNOA 4IS6A 7PAZA 3GDMA 4I9AA 3LS4L 1ECEA 4WCJA 4HCLA 4ZO7A 2G8ZA 5HGBB 4KKAC 5DEFB 3QJHA 1WP6A 4PJ5E 2ZZ1A 3MVTA 2P4AB 4MVAA 2DYRB 4KK9C 1HS6A 1T6WA 1NINA 5I1LB 3S2MA 4GCXA 4P5KB 1I8IB 3TO4B 1W9UA 2DPEA 3H4GA 2QCLA 4QLWA 3CHQA 1KPVB 2DF3A 4ISVA 4AITA 2DQIL 2A9CA 3KLAA 3QY6A 3HLKA 1E65A 3TJPA 4YSQA 4E41E 1BFOB 4DZBA 4ZW8A 4BFAA 1ETJA 1MFVA 2CK2A 3VFNA 5HK4A 3VXNB 4PE8A 1A66A 2JJWA 1TQWA 4Q74A 1J1PL 5HGAB 2YLLA 4YHKH 2V2XA 1GKRA 2P5WE 4QXGL 2HKHH 5E51A 3SCUA 2AAAA 3DHPA 3KPOA 1S5NA 4E8CA 3TLQA 1D5MA 3ECWA 4ANVA 1I1AD 3JUYA 4A04A 2EVHA 2C9PA 3NRPA 2WBJD 2OQJA 1JPFA 1DORA 1B4TA 2XFWA 4MA3B 1QT1A 3HF3A 4D0CB 2C3XA 3AS1A 3B3IB 4QHLB 2VW6A 1H9DA 3H23A 3R6IA 1T21B 5JIDA 1TMQA 1NGXA 1M2VB 2BFVH 3LVEA 4IBSA 4PREB 2YD3A 3RUGB 4RZCA 4A37A 3WQ4A 4EDWH 1UPPA 2E4TA 3HR6A 2CZNA 1B90A 2E8YA 3CTTA 4DP9X 5L2KE 3NCJL 1H8NA 3W56A 4AEIL 3KL3A 1A6ZB 3HI6L 2WLHA 1RK0B 3BD5A 5H8DA 1HP5A 1K9FA 1BHGA 1O5RA 1ZBWA 4GVGA 5C55A 3AAZB 4MD4B 2NDFA 2V2XB 1RJRA 2K9FB 2LAGB 1YXDA 3QMTA 3FCTA 4P57B 2XI9A 4X98A 4YL4A 5C70A 4WGHA 3F85A 4DJEC 4MJ5A 3TBSA 5I30H 4XXCA 1PX8A 4KO6A 3MYOA 3P2TA 4UB0L 1RIVH 5AW5B 5A40E 3UCCA 4J27A 5F7WC 1MCOL 4EN2A 1GK8A 3O3UN 3NABH 4WFHE 1IEBA 4WFHD 3VI3B 1JUBA 4GIEA 4V27A 1XXXA 4JO3L 1CR9L 2XWTB 4LNCA 4L3EB 4IQEA 1LRNA 4O1BA 3T55A 2C4XA 4FNRA 3VOJA 4P0DA 1WC7A 1W0MA 2N56A 2ZXCA 5DHVB 5HI4D 5F4XA 2NZ9D 2R14A 4JO1L 1R9ZA 1BZ8A 3QDMA 1OAZH 1FDYA 4NYYA 4TQEH 5DQ9A 1GGUA 3KRSA 3HAEG 3BZEA 1UHVA 3FQTA 1RCXB 5F89B 1P0EA 1KPUB 3QJHB 3GSNL 1CE1H 2JKSA 5DGRA 2X4QA 3AUWB 5F7KC 4K9JA 4CW1B 2H6PA 3CPLA 5HHQB 1FC1A 4UTLA 1T03H 2Z7UA 5FECA 4YN5A 1F56A 5DZVA 1XP3A 2J8UE 3HG2A 1O5DT 5C92A 3GU9A 3LHVA 3TJEH 4WJ8A 2UWFA 4P5MA 4BEIA 3QZOA 4Y5XC 3ZMNA 1LQ0A 5HNNA 3N50A 3NZHH 4HJFA 5FFLA 1RAMA 3KBFA 2AEQL 3UCRA 4NAEA 1Q0EA 3G5VB 2EJ1A 1U8KB 1NCAL 1UC6A 3IE4A 3LRLA 2CKSA 2MUCA 3NXFA 3IKKA 4KK5C 2YDSA 4WDTA 2DZSA 4XZ4A 4U5IA 4OCSL 3VO0A 1WFNA 1OFRA 2J2ZB 2Q8BL 4KFPA 4IRZA 4EF9A 3QULB 1UD2A 3KBJA 2XG4A 1ESOA 1PCSA 4P2RB 5KG9B 1S7UA 3O6FA 1F6KA 3HM7A 4H25A 1NIUA 1KGUA 2BP3A 3G6DH 4MJIA 3IVSA 4DN4L 3KPRD 2PTTA 1S7TB 3QIWC 4XBGB 3G6LA 1LBLA 1UW9A 1DO5A 3PBYA 4H3DA 1CICB 2EDNA 3ARGC 3W00A 5A8GA 1VB9A 5IZ7A 2CUAA 4KCWA 3U7BA 1IL1B 3G6MA 3IWUA 2IFFH 4XMVA 1B57A 3SBQA 1F90H 5EEWA 1QP1A 3V10A 1SJBA 1TQUA 4CRPA 3MVSA 3OXRA 3FIGA 1TZOA 2Z1VA 3ULVF 3ARDB 4LARL 2F68X 1VP5A 2JB5H 2QDEA 2IWEA 2NXGA 2W3ZA 4HCRL 1A3RL 3LNIA 3GH5A 1N8ZB 2I85A 4NOFA 2VC2H 5JH1A 3C6LD 3Q65A 2XZQH 3WJJA 2GTWB 4ORMA 2X0WA 3MOAH 3PFQA 1UWTA 5INCA 3KPPB 5DT1L 2CZ5A 3HJZA 4BZ2H 1FVEA 1CWVA 5CHNA 4AZ6A 4GKSB 2WJEA 1PZ5A 4FOMA 1CLZH 2R2CA 2V68A 4DGVH 2ZCZA 4KTGA 1NOFA 5IQLA 2PA6A 4TULH 3CAVA 3ZHDA 3G08B 1JD9A 1ZBCA 2PLKA 1Y07A 2CZVA 3GNDA 2CUMA 4PRHB 2G41A 5CPMA 1OEPA 1N26A 2INFA 3ID7A 5DZJA 3BXNA 3UD6A 4N0UA 4YGVB 2VCOA 3KCLA 3E80A 4PRIE 4NAMA 3L5MA 2AJXH 3GJEA 3NT0A 1MCFA 2AK4D 3CHRA 4PW4A 2BW4A 3DVNB 5AAWC 1LLOA 4KFZC 3FFSA 2ZAGA 4KV5F 2QNEA 1VESA 2BDNH 4HUCA 4XTRD 3V4PA 2ZYRA 2A74C 3MV01 2KLTA 5IWLC 1ML0A 5BRBA 2P8CA 1BOGA 4OM1H 5FWRA 3M45A 1YDVA 2YD9A 3MBFA 3EB3A 3NFSL 2LU3A 3CL7A 3N04A 4ACTA 1JGUL 3KBMA 1XWYA 2DMKA 2H7WA 1NBVH 1ACCA 1LO3L 4MKTA 4NZ5A 1ADWA 2HRPH 3SKOB 5LAXB 3T0CA 4GKOA 5TE7H 4X4YB 3WK0A 3V5FA 4OCYL 1HI6B 3FJLA 5FUCC 3GO1L 4G7RB 3MNDA 3FOLB 3VU2A 1AR1B 2AQOA 1A7PH 4L1SA 1UCBH 1HSBA 1KXHA 5BXFA 3V4VH 5KVGH 3FU0A 2NZ1A 1OAJA 1MDAA 3ELFA 4QIUA 4H8WH 1G4RA 4OW6A 1X5MA 1VC4A 3D34A 4ODWB 3T0TA 2DM3A 3VWKB 5I1AA 2YPVL 2PXYA 4UILH 4XOEA 3U1SL 3PPEA 2BWQA 5J3HC 3VFUA 4DKEH 2B8OT 3IDXH 4MXQC 2YCLA 2F54E 5BS0D 1GVYA 3HNTH 4WUUE 2XJKA 4JY4A 2YCEA 5CEZE 5KVFL 2Q09A 4A8RA 4PY8J 3D18B 5MEND 3L3IB 2V37A 5DRNB 4GI4A 2O56A 3I6SA 1NBVL 1LEIA 3I10A 3W71A 1KIPB 3E49A 4QSFA 4C4KO 5GZOA 1VLWA 3QV7A 4I9WE 4B9JA 4GGBA 1N19A 1TXKA 5IQOA 4KROB 1A8ZA 1MW3A 3UTQB 1UIOA 2PCQA 2LLLA 4HIIA 3WE6A 4CJ0A 4NNPH 2H9GB 1MCDA 5CPOA 2O5ZH 4V15A 3NPXA 3PHAA 1F73A 1NSNL 3OR7A 3TZVD 4WEVX 3V5DB 3EGDB 5DJAB 4BWLA 2F18A 1VBJA 3L95B 3TN0A 2EC8A 5CSBA 3GG0A 5B8CC 1BVNT 1FNHA 3IDXL 2EICA 4WFED 2VITB 4X6EA 5CGYC 3TBYB 5L9DH 3S34H 4KO9A 2D3JA 1QHQA 3WD5L 1JFQH 5I1JH 4GIRA 4PD4K 3PUCA 2B0SL 3H70A 1E8YA 3INOA 4QRRB 3AMGA 3SGZA 3TV3L 2VKXA 2RFGA 3MLVH 5HAOA 3V4PB 3O3DB 1IAIH 1YRKA 3NFUA 5E70A 5JDJA 4GJIA 3T65B 3FU6A 1NCUA 1BTCA 1XCWA 3QE5A 3TK7A 3FVMA 2QJGA 5LGYA 1Q38A 3TURA 2G2NA 3IBEA 2I07B 1WD8A 1FZKB 4NT6A 3ZRFC 5ES4B 1S3TC 4GBXC 4K4KA 2PGEA 3UP1A 3QC0A 1FNGB 1KBPA 1U8PB 4MGXA 1K8DA 1TE6A 3SPJA 2P24A 3Q6FA 2XC8A 2DB8A 1JCNA 4DF0A 4IU2B 3DGDA 4NO0B 4LNRA 1Y18A 1OKEA 3T5WA 1H3PH 1KLUB 1THFD 4WSJA 3MLRH 1D2KA 3CB3A 1UKSA 1S38A 3CMGA 5BNKA 1W3NA 1NMBL 3OKYA 2V5RA 3H2AA 3J07A 3TASA 1UUOA 1SDAB 1JFQL 3CQKA 3T8MA 3UWEA 3Q8AA 1P2CA 4AAJA 3W1QA 5BOZG 3QG6B 4BIKA 2X9ZA 4Z7VA 5JIQA 4PI0A 5KINA 3C60D 1NGPH 3ZGIA 4L37B 3UADA 4N0UE 5I03A 1CC3A 3T65A 2HZGA 3QFJE 3NCOA 3BSZA 1DBKL 3CTLA 2G9HB 1PX4A 3MCLH 4IRSD 3MB9A 4K7YA 2Y5TB 5E4EB 4GS7B 5FWQA 2NV9A 4G83A 5RUBA 1QLRA 3H0TB 4Z7NB 4JLRA 5ISZE 3P8IA 3B9NA 2IAAC 3QZWB 4FNTA 3RY6C 3F5WA 4ZNCD 5J0BA 4GZIA 2C1PB 1OG6A 3S35X 3N14A 3RDJA 3THDA 3M16A 2CKRA 4NZ8A 4IIZA 2WQDA 4UCGA 4CCDA 1EKOA 3CH8A 1NM4A 4BI5A 2LTQB 4J35A 1VADB 4OY9A 5AZ2H 2DY3A 2VC2L 3PULA 3P4OA 4PUMA 3PAOA 1KFJA 4LJ3A 2GFBA 5LCVA 1U4EA 1SPDA 3IGFA 1EJOL 1R3HB 1S8DB 3JTSB 2QTEA 3C08L 4F0RA 3B9VA 5KTEL 5IHZB 4XNDA 1TJIH 4YJ5A 1V0MA 3URNA 3LH2H 1EBAA 4N2IA 4JIIX 4Q6IC 3ATAA 4MCNA 2PETA 4PJAA 1F3RB 4LFHG 4JCLA 4KI5F 4X5RA 4B4HA 5EV7A 1RPQA 1UB6B 2DQUL 1FE8H 2ZQ0A 4DF1A 1KIQB 2DLHA 2IBZX 1LO2H 4JDVA 4K5PA 2UY6A 1IV8A 4A68A 4XWGL 3EH4B 3VGAC 7CGTA 2PC8A 5FJTA 5JW4M 3QNYB 1TPXC 2KBGA 4ZDHA 1Q0YL 3SOTA 1S5HA 1WFIA 2C9UA 1PU0A 3CDZA 4N25A 1XIWB 4NZUH 5GXBB 3RLVA 4NQSA 4ACYA 4IX2A 3AFBA 3SDDC 3INPA 4HIJA 3VNKA 4MOZA 2YRZA 2C16A 4B9ZA 1RUPL 2WNGA 2FL5A 3NGBC 5EFIB 1W17A 3QO0A 4WY0A 1UH2A 1UUQA 1A0QH 1EGJL 2PPEA 2PR4H 1OC6A 3F03K 4GACA 5CKGA 5C0IA 4R84A 1VF8A 5H4ZA 4O0KA 4XZWA 4HVBA 3NJNA 4NHUB 1BAGA 2HG5B 4FDWA 4NENA 5IB2B 4I0PA 4JIQA 3ZS4A 4KRNA 3BJTA 5IXEA 3H9SB 3F7JA 4FGMA 3SBPA 1S7SA 1AE6H 1EZLA 2QR0A 4QE4A 1H3VA 1OHQA 4L3EA 3Q8CA 4L1LA 1MH5B 3HMWL 3CD4A 4IRSC 1R5IA 2F38A 3JTBA 3L1GA 3RDKA 2DMGA 3VMOA 3QFJD 3GSOB 3K1DA 4GI6A 1ZLPA 2R2BA 4R9XA 1AA1B 1FXPA 4PJIE 3TPUB 3RPIA 3QO0B 1V54B 2EUVA 2H0EA 3IEAA 4HFUL 5GGTA 4FXGA 3FUKA 3WN5A 4PUNA 1HK6A 5I3KA 5H8UA 2YSWA 5HXMA 2IH3B 3ME0B 4Q14A 2FTWA 3KBVA 3MUGA 1T41A 5ALCL 4CU6A 1X5HA 4HBQA 2MTPA 4TV5A 3UTQA 1AQDB 1G9NL 1N8ZA 1C8YA 4LLQB 3ZIYA 4W84A 5LIWX 1YJDC 5HYSB 4L3ED 4CU8A 1P5UA 4DO5A 2GTWA 5CPQA 1F05A 3MJ7B 2DJMA 3D3AA 4OSUH 2DJXA 3N6QA 3OXRB 3KXFB 1MVFA 1OB0A 3O9WC 4NQCB 3ZJAA 4MUZA 2XQYA 3QEUA 5LBVA 2APSA 1PKNA 4IL2A 1AHWA 1TV8A 3WF1A 5CKAA 1SEQH 1TIUA 3ABZA 4QTHB 5F7MC 1F6LL 4E9XA 3LS4H 4OBSA 2C3VB 1KCBA 2AXGB 2PWFA 4I2XA 4W4OA 3M0XA 2IAMB 3OG3A 3N91A 5I1CL 3AIRA 3V6ZA 2XQYK 1OFBA 2P5NA 2BZDA 3CV1A 1CQKA 4N0FB 4BCZA 3SSJA 2E9IA 2VH5H 4KMTL 1M1XB 5H2BA 3I6KB 4K73A 4OCRH 1Q6RA 5GRVK 2XBTA 4AZHA 1K5NA 1TQBB 2C13A 4D9LL 1YDOA 3GW3A 1U6AL 2ERJB 4GD0A 1VADA 2BSSA 5AVSB 4AWUA 2ZRWA 1UWFA 1H6TA 1T0NB 4F3FB 3PB0A 1VFUA 1N10A 3IGUA 4L8BB 4UDUB 1J8HA 2GYIA 1XIDA 3Q48A 1XQLA 3URQA 1AZNA 4RNHA 4CD6A 1S5IL 3KX6A 3GXIA 3FYPA 2HRLA 2W6RA 1P6WA 4IS6B 4JFSA 4HAFA 4R4BA 3CNYA 3OBAA 1E67A 1MY7A 5IFJB 1OXYA 2H1XA 1GVOA 3O9WD 1OIMA 3FU7A 1Z41A 2XWRA 2JK5A 3NIFB 4FJZA 3U6RB 2DQJL 1FG2A 2DRUA 5KEZA 1ME7A 4GISA 4IQLA 2FBJL 4Q8MA 2QS8A 3EJSA 2V2WA 4DKTA 1GVEA 2B9BA 2YGNA 3FB7B 3IJHB 4IBUA 1ADOA 1YY8A 4AUJA 4I85A 1BJ1H 1TSIA 2JKJA 2I56A 2J1ZA 2NXYB 3B83A 5KUKA 1P2CB 3VXSA 1UOZA 1EUNA 4NRSA 4JHZA 3SAZA 1RIUL 1F3WA 1UYWH 1XYMA 3KDOA 3QYNA 4K5NA 2GCYB 3EFDL 4Y9AA 3M41A 3QYCA 3BOVA 4CSTA 4LUTB 2EILB 2GQHA 3PHQB 1T0PB 2DLTA 3UJJL 2YW4A 1MN4A 1M05A 2DYPD 4FS0A 1MFBH 3QUXB 1DPMA 1GQNA 4LOUD 3O2DA 3L68A 3WIHA 5AOMA 4YNGA 1OCRB 2E46A 4JFYB 4XSLA 1H1YA 4JRLA 2V3EA 4K9EC 4X0KB 4XT1C 3G6AB 5D4IA 1T5XB 4G9FD 4E36A 1HJVA 4W6YB 4ZSOB 5KJRL 5FGSA 3F2DA 1HZLA 1V08A 2QCDA 2LU5A 3BEWA 3ZE1B 1UIPA 1ZMYA 1E0OB 3KR3L 3UZEC 4NAFB 1XM3A 3W1UA 4LCIH 1U8CB 4MAYA 4I5UA 4O28A 5I79A 2IANA 1WD9A 2EADA 3L9RB 4H6RA 2OMVA 5G2NA 1JVKA 3B0VC 4UFHA 2ADFL 1IGWA 1QKZH 3L4ZA 3PWPB 2GJPA 4WUUB 2AK1H 4LCWB 2VEPA 5IM51 2Q9OA 4PB0H 4LFYA 4AIXA 4O00A 3QH2A 5DEZA 4ONHA 3MRFA 1TQXA 3HQNA 1TTUA 3FTYA 2AEQH 2JH2A 1OARL 3TN0D 2CCLA 1HQ4A 4TR9A 4TN9A 2OM5A 3GIVB 3P9WB 4YAQA 3N41F 1QQDA 5IWLA 2EAEA 4F7CB 1SY6A 1NSJA 4ODBD 2XDHA 1VD6A 4H6QA 5FF2A 2ENQA 2CHZA 3W7RA 3C5JB 2AF2A 4RLDA 2DW7A 1OGGA 2R29A 3RPBA 3GBEA 1WA1X 3EEZA 3VQLA 1HDMB 4OGQC 4X8GA 4EACA 3TEUA 4UTBA 5JDSA 2INZA 5EIQA 2YCLB 4EPKA 3T2LA 1RVGA 4O54A 3RR4A 4UV4H 3O0RH 4KTYA 5DK0B 2EKJA 2EVGA 1IGJA 1HKWA 3WLJA 5LJYH 3DVFA 1UR3M 4UT9H 1E6ZA 4F7MB 4DLFA 4OGAC 4LSPH 3SCOA 4QJ1A 4MMZC 3OJGA 2VFEA 3KEHA 5ELIA 1EDGA 1MG3C 3IT8D 4PTTA 4IUGA 3FT4A 3RU8L 3BV7A 4QBXA 1I8IA 3LMZA 3VABA 1B9BA 1AS7A 5JOFB 1VRDA 4OI9A 1G9MC 5FECB 5BVJA 5MI0B 1L6FA 5D1XD 2CKBA 4F8LA 2XV6B 1CTNA 2A77L 3U36B 2VWTA 1AG0A 1FL6A 2VQUA 5IB1B 4UMSA 4G8GD 2VUNA 1P0BA 3CSBA 1T7ZA 3HRZA 4UTTA 1TZHB 1YUKB 4YPGA 3EJRA 2GG1A 3UJTL 3B40A 4AIZA 3QPXL 4HEPG 3DLQR 1GTHA 1KO0A 4KKLD 3U4BL 5EU9A 3EHBD 3LPFA 1BQRA 1WZKA 4H88L 4A7TA 1R2SA 5BW6A 3CN4A 1U8IA 4OCMC 4Y8FA 2YLHA 1DVYA 3QDJB 5CZKA 1K02A 3ITVA 4ALAL 1DL7L 3D3VA 2OAAA 4CVWA 4DIAA 3MBEC 5KYUA 2XIBA 4HISA 3WIHL 4Q4OA 3FT2B 3GG7A 3BP4B 3VSVA 3W72A 1FHLA 1P1ZA 1TVHB 2DZTA 4LBUA 4W5UA 5D1XA 2AVGA 1HHIA 2F74A 2QQLH 4L9LB 4LOVA 5E1HB 5C09B 2DFAA 4K23H 4KNQA 1E7UA 1YY9D 1MZYA 3OPUA 3SE9L 1R3QA 2CK0L 5IBXA 1E4IA 5DR5H 5T9BG 3R0DA 4DN1A 2WWMD 1J5SA 1O6IA 4DWSC 3RWJB 1BWWA 3EG9B 3WG7B 1EBPA 3M46A 2XGIA 1S3KL 3KS0H 3B6SA 3LDBB 3EWBX 4YYCA 1HQ4B 2G3XA 4MNLA 4PJFF 4PR4A 1WB0A 2A83A 3MNVA 4ZQTA 4Z1YA 3D2UB 3WK1A 3ZXWA 5TDNA 1YEJL 2PTWA 2B2XH 5D2TA 3TYDA 1UMLA 2FSEB 4Z7NF 4P4KA 3HN3A 4QRUA 4XMUA 3F2BA 3MJ9H 1J0YA 3MNMA 2RCSL 4YHMH 2OSWA 5ECGA 4X9YA 4ABWA 3WUZA 2NXZC 3CUZA 3DUGA 4U1HA 1ZWIB 1GTFA 1OAXH 3CFQA 3GKAA 5L6YH 1LT8A 1CFNB 3BSHA 1H4PA 3P0YL 4PJ8A 4J8RA 5IHUL 3W25A 3H26A 4WO4C 1AK5A 1KLGA 4I6KA 4LWWA 1LWRA 2A38A 4XMPH 3RGHA 5IB3A 3M88A 1FFNA 3E6FB 1V77A 3AYSA 4HA3A 4X63A 5DY2A 3DOHA 4HKBA 1EXBA 1BAWA 1UXMA 3AW5A 3X1EA 1UBPC 4W9IC 2CLRA 4BKTC 5LWYH 1XBVA 2UX6A 4I4WB 3EGXA 2V0TA 1OTTD 5E1AB 3TJXA 1IX2A 2V5DA 4UUIA 3NPZB 1SFDA 4Z7AA 1UACH 2CA4A 1A6TB 2WWNA 2FECI 2Z4TA 4JPKL 4HJ0D 1R3LA 2GKIA 2FYVA 1WV2A 4QAIA 4LGPB 2ZG3A 2QPDB 5H8MA 3C8NA 3KL5A 3CXHJ 1TZGL 1BVLB 1XBDA 4OTXH 3NSXA 2OR9H 4DQWA 1ZAIA 4Q58C 3SPCA 5HYJB 5EZOH 4AQEB 5J6GA 5FX3A 4H20L 4LPCA 1KLGB 2WC4A 2Y22A 1U8LA 2Y23A 4K94H 3N2OA 3WQOA 2JJTA 5T3XH 3RNQB 2H6OA 4RGNE 1XDLA 4FIQA 2EG8A 3MNWB 3D06A 1Q72H 1F4XL 3ZHFA 1NBYA 2F19L 4L4VB 4XNYH 2WQ8A 1N59B 1MJ7H 4UQ2A 3EA1A 7REQA 3G1YA 3W2LA 5KOMC 5I73B 1HKFA 1A0EA 2D3LA 3A4FA 3MKKA 5C3TA 3HC3H 1TQCC 4JNXA 4RDQG 5EPMB 2HJLA 3QEQD 3UTSA 4D8PA 3BAYA 2YKKA 3UOAB 4PRAA 4TUOB 1W56A 4KROD 1DJWA 3HOGA 2FE0A 5DHEA 5AAMC 1OB1A 1WWAX 1GNXA 2CJTA 1MCNA 1NCHA 2DWTA 4XBMA 4L3CA 4ONGH 4J3OH 5F8QC 4F7TA 2AV7A 5I3JA 2PLJA 1HNGA 12E8L 1YQVH 3TCLA 1IHIA 1JCTA 1YN6A 3CUXA 1WXJA 2LU4A 2FB3A 2NY6C 3IIVA 4FLQA 4BDVB 3IGHX 4OLUH 3DIVA 1XFBA 1OF2A 2OQHA 3LIUA 1HILB 3D0LA 3F7QA 1MNSA 3MUUA 3CUIA 1IGMH 4TPRL 3S96B 4NBZB 1MCQA 1AGEB 3PQYA 3O6LH 5FPIA 2X4PB 3WFZA 5JO5A 4EAYA 1P1XA 4QHKI 3OHIA 1H8LA 4B5EA 4X98B 2VDQL 3FFCB 3DCPA 4AWEA 4KJWC 3HA1A 1QTPA 4DCQB 5F1UA 2CNZA 2WSPA 3H7LA 5DJCA 1SHWA 4KGLA 1OZMA 3UZ5A 2FVLA 1AJ0A 3MO1B 2R1YA 4AUUA 1PWMA 5GS1C 3JSSA 3HHMA 3KTCA 4XMKH 1PY0A 2AV1B 1F6YA 1YTDA 1Q6DA 1A4KA 3E5BA 2Y9RT 3OKEB 1P1VA 3CFKB 4KK8D 4H7ZA 2CA3A 2HFGH 3ISRA 1XYFA 2JIXD 3BGMA 1F97A 3GNPA 3JT0A 1AGCB 3DUUA 4WHCA 2BOLA 3WO3B 2YC1B 1KTKE 3BT2H 2J5WA 4ML4A 1SN5A 2TMDA 5CWSA 3BRFA 2D03L 5ITFB 3CE1A 5F97E 2W63A 1I7UB 3GS7A 3DGGB 2WQSA 1RPKA 2OSXA 3FULA 2OMTB 4I77L 4LCWE 3HRZC 4B27A 4BXVA 3DFQA 3WS6A 1B4JL 3GBNL 3VQ1C 3OQ8A 3UA4A 1S7SB 4A7GF 1GQIA 3VZZA 2KAUC 1CF1A 4Y2DB 2B9AA 5JMUA 4XNQB 3WH7A 2W65B 3KPSA 3FSOA 2C1GA 3F1QA 2JELH 1N8IA 1QSVA 3I75A 4J2MA 2YPLA 2J6EH 4HZLB 3GVGA 2X1RA 3CLFL 3N1QC 3B97A 5FSDC 1PS9A 4LAUA 2AKRB 3AXIA 4TLKA 3W11D 4FQXA 1KYUA 2R4RL 2BMKB 4ATLA 4V1DA 4G8TA 4JR9H 3II2A 3L3OB 1C12A 4YEFA 1E6JL 4QNPE 1T22B 2A6DA 2AANA 1M65A 4NCC2 5ENWA 3GC2A 3QQDA 1QA9A 4ZUSA 1IT0A 2R56H 4U1JB 1R0MA 1H41A 2OKOA 3BEWB 4P8XA 4C7FA 1XRVA 3EYVA 5BWAA 4OM0L 2CHWA 1PZCA 1KOAA 2BFGA 2D7QA 2P1YA 3MODH 2XA8L 1YPZF 3F4WA 5LIXX 1FPTH 4C56D 3EYSH 1FHDA 2EE6A 3QEZA 4FABH 2PLMA 1DVFA 3HN8A 1H2JA 2NX1A 1DWFM 2UZYA 2R0LH 4NUPA 3U0PB 3SYOA 5M5DA 4B0MM 3GXTA 3R10A 1IC7H 3GH7A 4ZNEE 3GNXA 1GZPB 1BFNA 1UM5H 2EINB 2YUWA 1OHLA 3DVGB 4DFIA 3QXBA 3AABA 4UTJA 5JQ6L 4H1LB 1XR8A 1D6EA 4J3XA 5HJ3B 4U6VL 4Z23A 3STCA 1IGYB 2Q7YA 1M7IA 3B8UA 2DKUA 4C59B 2A7PA 5G4WA 3HMWH 5CJQL 1BWVA 1ZE3C 4PJ5B 4J3VA 4N2AA 4LUYA 3EUDA 3N85H 4C6BA 1NDMB 2BIPA 3DYOA 3ULSA 2VLMD 3DX7A 3VD0A 1X4ZA 4PJ7F 3H9ZA 4KXDA 1E5UI 4TUUA 3UBGA 4DH2A 4IBZA 3S3GA 4O4YH 2GQ3A 5EFDA 4LL1A 3MRIA 1Z6KA 3FSUA 4XVTH 2Z0UA 2X12A 4U4BA 4XVJH 4W4QA 2ZZ2A 3WNPA 1X9LA 4IM8A 3US0A 1TRIA 3BARA 4LQFL 2GC4C 1DUZB 4LF1A 2B4CC 1O7SA 2A9NH 4HUWA 2C14A 2VERA 3JV6B 3KGTA 4MJID 1JULA 2A9DA 5F0MB 1V0NA 3P0XA 4IHOA 2JF7A 1WA0X 3QRGH 4WKAA 3W53A 4AH7A 1MCJA 2NY5C 2AXFB 4ZJ9A 2W61A 4HJEA 4PJGB 3QEGH 4ZX6A 2QW5A 3TSMA 4HPHA 2ESCA 4Y4FB 2HX8A 5K1VA 3RFZC 1NP2A 5FUOH 1ID5I 1XHGA 3GMRA 5FO7B 3Q06A 4GX8A 3AUVA 1MWAB 4K5MA 3FCPA 4M48H 3IU3A 2HH0L 4XPTH 3X1FA 2ZPKH 4IGHA 4AU0A 2C71A 1UC4A 1A6UH 3FT0A 1D7FA 1LDPH 2H4EA 3FONA 4GUOA 4DO6A 4Z7WF 2FECL 3UTSE 2QKIA 1YMMB 1I8MA 5TF0A 3TQPA 2OW6A 1E6XM 2CCVA 2BJML 2M1KA 3E2HC 3LQZB 3SPGA 1LK2B 3C6LA 4G7EA 2KKQA 4PUDA 1EJ6A 2V9TA 4PWEA 4QGTA 4B3KA 3QWOA 4WW2F 2K4WA 2QQNH 3B2UD 4UFIA 1LLAA 2GZXA 3T2PA 2X16A 2RUSA 4ZB5A 2WWKO 1ZCCA 2YXXA 4MZIA 4OVVA 1RERA 2E40A 2YBGA 3MJ7A 3MJMA 3QDJE 4MPKA 5CU9A 5AVRB 1YNTF 3ARVA 4KWUA 3T4YA 3K72A 2VR4A 2ZWLT 5HHPB 1W1TA 3ENLA 3NURA 4LP8A 4ZT1A 1JGIA 4XIAA 2GABA 2TSBA 4XE0A 4YDMA 3TIEA 3E8VA 1NMCB 1F76A 1XPGA 2I24N 4MS8C 1MAJA 1UH3A 2V0AA 4ZPVA 4A7SA 4B9YA 1OAUH 1OQFA 43C9A 3UPWA 2LABA 5JOPD 1H5BA 3AQYA 4KCTA 3CZSA 2ODHA 1CFTA 1M6OB 3LX9A 4G70B 5CJXA 2OXGB 1AJ2A 2I5QA 4KVPA 2VDRL 3KNBB 4Z3GA 1BKSA 3A67L 3E6HA 4FQ1H 4F9LA 3DX0A 1Y5XA 4KRZA 1HH9B 1UYWL 2HMID 1VS1A 1LO3H 2YWYA 4LSPL 5FOBB 1FDZA 1N2VA 3TSDA 1VRXA 4IRJA 3QXAA 3ITYA 2ILLA 2HPMA 2Q0ZX 1IXNA 4DVBA 5IBTH 3MY9A 3C9NB 4IOFC 4KRPC 3WAKA 1N7MH 3B05A 2J21A 1XGTA 4L8SC 4PJGE 3KTSA 3WKZA 2HT2C 4KXZH 4DTGH 1MRFH 1BD0A 3A4WA 5G5IA 1XIBA 1C91A 5D70H 3WL9B 2C1OA 3NEOA 4UILL 1RUPH 1SUXA 1KJ3H 1II4E 2A9AA 4V11A 3BRGC 3SY0B 5CPTA 2X4RA 4RZBA 2UZIL 1IXQA 4YDIL 3S3BB 4QHUA 5GSRB 4XVUC 4F0HA 1A6AA 1JOIA 2H8PB 3UABA 4F7EB 1TYGA 5B1JA 1MVUB 3FCUB 3CH9A 3R94A 1LWHA 1YEGL 2DT3A 1U93B 3PP7A 1KCLA 3EOLA 3OMAB 3BJFA 4ZAKC 4U3XA 1GRWA 5AYYA 2DWSA 3B06A 4HUVB 4JE0A 2QCHA 1Z9SB 4TSCL 3QORD 2F8IA 3ZO0A 3GI9H 1XGTB 4EI5A 1LDCA 1A14H 2HZHA 1UCWA 3CFNA 2OELA 4Q6KA 4MMXA 3QJAA 3WBWA 3RYSA 1AZRA 3JWNG 3UZQB 2W80C 5FB8A 4KWWA 1FH8A 1EJFA 1DANT 4DJFA 4MAVA 4JIPA 3ARED 1CFTB 1M6OA 2VRAA 1F18A 3TC9A 2DUXA 2JB6A 2HTKC 4EIBA 3DN5A 1U33A 3KNBA 1D6VL 3FCTB 4LL4A 1CG9A 1P7BA 2WB1A 4NM4H 4YHIA 1S5WA 2WZHA 1ED3A 2VR3A 2Y0SA 3IPWA 1UYQA 4TQPA 5FUZL 3MLSH 1UA6H 2WAGA 1GZPA 5FO9B 3BN9C 2EE3A 5ITBL 4HNTA 3MJ9L 2FJHB 2OT0A 3LBCA 3JWNH 4EI5D 1OO2A 3CBJB 4DYKA 1KBGL 3O6KL 4N42A 1GC1L 4XBSA 1QTYT 4N85A 3TBCA 4L1DA 4YHKL 2ATMA 1QBBA 4M4RB 1O0VA 2E9JA 1CLOL 2F5BH 3B3IA 3C60B 4NQDB 2IKHA 2HKFH 5DD3H 2VO8A 2G5BB 3WUGA 5LNDA 1DEDA 3KXFA 3RU8H 4DUOA 2ZCLH 4UQ2B 5GS3A 1A4BA 1MCPL 4JN1H 4M1DH 4GXPA 2ARJB 2C5DC 4HALA 4JM2F 3WQPA 2FO8A 3BZGA 4H8NA 9XIMA 1TKWB 5E6UB 1CFQB 4JCWA 4HWBA 2WYTA 3CH1B 5IMLB 3O0FA 3W2DL 2BOFX 1JWUA 3BQUA 3DSFH 1ZXQA 1EAOA 2Q2LA 1MYRA 5A5WA 2GVYA 3ZHKA 3MAWA 4LKXA 1TVNA 3DBPA 1QRKA 4OZHB 4GNVA 3C52A 3SURA 2CO7B 2MHAB 3BT0A 1M9SA 2AJVL 1QWUA 1WBXA 4K7PH 3ZUCA 1AJ7L 3P0WA 2RFXB 1GEHA 2VP8A 4IIHA 4E2BA 2V5KA 1ADDA 4XTIA 2SEBB 3ZDYB 4AZ8A 3UBHA 2BCKB 5I28A 1MAML 4Z7VE 5AW1B 4Z8FL 1J93A 3BW2A 1BYDA 2QMJA 4JGJA 3SGKC 3M0LA 1XTLA 1P7KA 3LS5H 4D7BA 4Y2LA 1FFRA 1MJUL 5F2LA 4NKMB 2CEQA 4KJPD 1BVZA 3BQUD 3H54A 4MA8H 1Z9SA 2WYHA 5FM5O 2JTDA 1IAKA 5JHDE 2G3IA 1K4HA 4UQ3A 5EIIG 5I7GA 3GF8A 2GVEA 3CVHA 3MRHB 3FRUA 2C3WA 4XCEA 4AM0A 5IJDC 2RGLA 4Y2WA 1DDHA 1KFKA 3K80A 1SW7A 1O5XA 3HZ3A 4OZOA 2CM6A 5LXGL 2QQNL 4H8QA 3M44A 6REQB 4YS1A 4UR8A 5AVTB 3MACH 4NUQA 5HHNB 3O8XC 4I3GA 3L4WA 4O2CB 1V6TA 4Q4QA 3STLA 3IMUA 4U31A 2WWOA 4ADGA 2W62A 2Q8XA 1O1HA 4HGWA 1JAKA 3PAVA 3B7TA 3B2VH 2QUMA 1EOMA 1YZZA 3N6JA 3BHBB 2BNQA 3V5OA 4BS0A 4NN6C 5IDZA 4LRIC 1I75A 4F2EA 1BZOA 5DJ6A 2IKJA 3MO7A 4DWSA 3UBPC 4LVHB 1E72M 4E2VA 2YXGA 5G4EA 1V3MA 2F0CA 3KG5A 3S96A 2XINA 1UACL 1CS6A 4IJTA 2Z1XA 3WDPP 2Q5BA 3DBSA 1OF2B 1ONQB 2YAOA 2H2PD 4QD2E 3TO2A 4BSVA 2NY0D 2W0PA 3Q6GH 2TRSA 1S7RB 2F7FA 4O14A 1OVDA 43C9B 3A67H 3L5IA 4NQCE 4Y16D 2R4SL 5E2WL 1W2KT 1D3HA 1NFPA 3GXUB 1PSCA 1KC7A 4ZW7A 5E9DA 5DUBA 4AKOA 3QIUD 1QI3A 4HWEL 1GZGA 1X9QA 1F4WH 2DIBA 2MCG1 4DPCX 4Z7OE 4QF1A 3KWWB 4HSNA 2REQB 5I1IL 3X3GH 1F07A 5D1QB 1JI1A 1Y0LB 2IFGA 4POCA 4HJGB 1WNOA 4N8VG 5AC5A 4NRYB 4RZCB 3DROA 4FI7A 4H8PA 4QOKB 1TQTA 1NFKA 4BZ1A 1S6NA 2O0TA 4WY0F 1OSZB 4ICMA 1NGQH 1YC8A 1WV7T 3GTFA 2NWRA 3TR2A 1IAOB 2DQ6A 2DQIH 3EH1A 5ACLA 3TA6A 3UG8A 4YVPA 1RQ5A 4KEVA 2UYLA 1TIMA 1CFVH 2I9TB 4A22A 4GJJA 3PP3H 4YSCA 4MM1A 3BW9A 1YDPA 3MREA 1NOLA 4HJJH 2ZVIA 3B9AA 5K1JA 1R7AA 3LZFL 1B3VA 2NY0C 3SGEI 1GZ1A 5E0CA 4RISH 1CFMA 3QQNA 1F2JA 1TV7A 5D7JB 1KA9F 2OLSA 3V6BR 1DR9A 4YE0A 1E9TA 4HZ1A 2YLAA 1BQHA 3RF9A 2IQDA 3RX2A 1E9YB 3W27A 3B5TA 3QDJD 1MWAA 1B0RA 4J3OF 4KH9A 3DWTA 1R2RA 5C0CB 5IFHL 1UWYA 3KXQA 4RX4D 4D72A 4NSBA 4OVUA 3N1GC 5CJOL 4DJMA 2G4FA 4YR6A 4RESB 3EH3B 1UD8A 2UXFA 4JAMB 1E0XA 2GQAA 5LN4A 2ED9A 2XQYG 4Y90A 5TDPA 3KE0A 5GGRB 4X6DB 4JQIA 1PBGA 3NFNB 4CD5A 3HC0B 5DZLA 1NBZB 2A79A 4J9JA 4O57A 2Q20A 3QIWB 4ZFZA 4AMWA 5TK2A 4ATDA 1IBHA 2DBLL 1GTNA 1XD0A 4FQIH 2UY2A 3QPXH 2Q10A 2DIJA 2UZXB 3ASWA 4JM2A 3BAEL 3OAUH 1ONQA 3TT1H 4YFLI 1H63A 3GWQA 5JIPA 2ZDSA 3QZ6A 4JAWA 4RPPA 5C6TH 1TMLA 1DFXA 3M47A 1V3LA 1Y6MR 3V5DA 4D71A 3VD1A 4E42B 1LMIA 4ZSOA 1EHLL 3UR5A 4YSDA 1US0A 1TZ7A 3IRSA 1VEMA 3FO9B 3TH2T 1NELA 2WW8A 3BP5B 2V5CA 4UTFA 5LIYX 4EN3B 5L8JB 1ZOXA 3L4CA 1HILA 2PO6C 2Y7QA 4X5XB 5ABEA 3RWFA 4KXAA 1PX3A 4YK4C 1T66D 4RW3A 3RG6A 3SFWA 1U41A 1J5OL 3BT2L 2L0DA 1QEWA 4GP5B 5LUMA 4OE7A 3W2DH 4TTDC 1N67A 3QQ4B 3UBXG 3IIZA 1R6VA 4FZEH 1U42A 3O6AA 4QXWA 1EIBA 4JNZA 1EDQA 4Y7MA 4XZHA 3K7UA 3A13A 4ERSH 3T0DA 2DI7A 1MCLA 1C5BH 5C2GA 3OAYK 1ORQA 4LY4A 4JJ5B 5J9PA 1RCYA 4YXKH 1G0YR 3VXSD 1DBBH 3NACH 2EO1A 2W92A 4ZO6A 4RMSA 5AB2A 1FWSA 3OOQA 4ZK8A 4K7FA 2BSCA 4HCIA 1BZ9A 4APXA 1XR9B 3FO9A 4KEUA 4MAYC 1JD7A 3O2WH 2OKTA 2Z9TA 1QACA 1PCXA 1RJCA 4HA0A 1SLWA 4JFDA 5DXWA 2QULA 5IUCA 5B3SB 3GH4A 4QCIA 3PJTA 4X6DA 3OVQA 1QR1B 3ZSTA 4UAOC 3T2NL 3PJXA 5AZUA 1PEWA 4NM8H 4JNMA 4K37A 4FQCH 1U1HA 2DIAA 4XK2A 5HMSA 1R17A 4HJSA 1C8VA 1PLGL 3NK4A 4Z7OF 2VDPH 4ZUUB 2H32B 2G3MA 3ZDXF 1KYOJ 2GSGB 2BSSB 3QUML 4HS3A 3T3PF 2XIQA 4CNIA 3ELQA 3E9TA 4LCIL 2AEPH 3I50L 4JAMA 4PTTB 1E1EA 4UZSA 2F84A 5D30A 3MYZA 3FN9A 3OB8A 4PJ6A 2XPGB 3MLXH 3R7QA 2ZCHH 3PE9A 1QAPA 5T91A 1AR1C 5I6KA 3O8XA 2J74A 3EFOB 3SJ3A 3P1VA 3ULUL 2VABA 2WZEA 4OI8A 1YDPB 2BSBA 3HG1B 3MREB 1RP9A 1FNSH 3V0VA 3GRWA 1X6UA 2HTLC 4CC4C 5TFSL 5AB1A 4J4PC 4M6ML 4B95C 1CBGA 2DSKA 3PZTA 2NY5L 4AD1A 3FT1A 2F19H 4IMGA 1FN4A 3REVB 3AREC 1RPXA 4KK9D 5T26A 1A6ZA 4FHAA 3BX7C 3P73B 2FO4A 4IOIA 3AITA 1P43A 1VFOA 3Q3GA 3OG6B 4NBYB 2PI6A 3HE7A 5H37G 2D7OA 4G7YL 4M43L 3TWAA 4FNLH 1E9QA 3PS7A 5SWUA 4NWTH 1FAIH 2JEQA 4KX7A 3QVQA 1W5QA 4HZMA 3LKQB 2QCCA 4F80A 1CBVH 1VSCA 5HJYA 3ZDZF 1GS7A 5J12B 3WLMA 3A4JA 1KY6A 3TO4C 3CB8A 4DOHB 2DEPA 4JFED 2JXMB 2LE9A 4XVUD 4FSAA 5GGVH 1LE9B 3O11B 5KS9B 4K38A 3W6MA 1GYWA 1FWFC 1TX0A 4DYEA 3KLHD 1DQWA 5AZEH 3PVFA 3QFJB 1TU2B 4FF9A 4YOKA 2AITA 4OFYD 4O18A 2H1LM 3G5XB 4MAUH 1CMOA 3K74B 1BSIA 1A3HA 3QR3A 4ZTYA 3CQIA 2R83A 5AUMA 3TIMA 2Z31A 4CUCA 1N0XH 3FUDA 1UGNA 4EPBC 1HQRA 5DJ2B 1EVUA 2Y70A 4Z17A 2XRAL 2G2RA 4IP7A 1ZT1B 3QHFH 1O6SA 2XTJE 5EEXA 5TBOA 2ENYA 4GJ1A 1D5RA 4NEHB 2R8SH 3R79A 1RU9L 1MJ8L 5IG7A 3UXFA 1PB0A 3SQRA 4A6GA 1TEYA 4OKDA 3QFDB 5G4OA 3WQVA 3H2WA 3CCHB 3G6DL 1AZUA 2J27A 1X7IA 1LO4H 5MEPB 1DBML 3ECBA 3P0VH 4RMRA 1YJDL 3EBGA 1X97A 4L9YA 1E27A 4Z18A 4DK6A 3C4UA 2WO4A 3ECVA 3OO2A 5CH9A 2X4UA 1DSYA 5BV7B 1PKMA 3QIWD 4FXGC 4KK5D 5DMJB 1AQ0A 5D4HA 4ZDHB 2Z31D 5FYJL 2K7PA 2BY0A 5D7KD 2DVTA 2E6YA 4L6OA 3SCSA 1WBYB 2VD9A 3MRDA 3AHTA 1RZKC 3FSAA 2ZNXA 4UUJA 4P7NA 4FAMA 2VLRB 3DXAB 1O95A 2N7AA 2E7DA 2JB5L 2DAVA 1TR9A 3Q2NA 4WK0B 1NTDA 2PDBA 2YEZA 2BVEA 4PRRA 1M2OA 4P3CH 2J9XA 3A12A 2Z7ZA 1F58H 5E5LA 5B1AB 2Q8AL 1NC2D 1IGJB 4EKXA 1PTGA 1BLNA 1EZSA 5SWZE 7A3HA 1NC4A 4KBXA 1IGCH 4Y9BA 3GINA 3SY8A 1JZEA 2PMZA 2WO2B 2ZYIA 3DURB 3QJOA 4XC3H 3PPHA 2OMUA 5ESAA 4DPRA 4PWFA 4DKEL 4EQ3A 3P93A 2BVPB 4LANA 1QAWA 1MHHA 2FK9A 1K4CB 1YJDH 5D2LE 2VOTA 1I2RA 2WVTA 4WWKD 5CZXD 4QKTA 5AW0B 1SYSB 3H9SD 4FQPA 3V52L 2VXQH 3RK8A 3TJ4A 3D4CA 1VIWA 4TULL 3MYJA 2Y62A 2WTRB 1LVEA 2SEBA 2J6EL 1BD2D 1US2A 3A9BA 4XUGA 4XNZC 1MNUH 2WQVA 4R5TA 4DGUA 2YEVB 4RMWA 1TV4A 1A3XA 1N7ML 3B9KA 3GXNA 5C9XA 1QPQA 3SJNA 4JDZB 4WDWA 3P81A 4AZBA 3EO0B 3HBGA 1ENUA 2ZWYA 3T0BA 4GRWB 3TNNB 4I7ZC 1UQYA 5HGDB 3E02A 4UYPA 3GZ3A 2Q86B 3AUOA 3S1XA 2LLGA 4L8SA 2D31B 4N2EA 3KLHC 1AIZA 3IGKA 1A9EA 2WOYA 4KV5E 3ALGA 4QHRA 1DZ0A 1NCBH 2VDLB 2FZBA 4GMSH 1ICPA 2DVXA 2QCDB 1AKJD 2Z91B 4Q6IA 1XLDA 4WY7H 4OV9A 5D9MA 5EZOL 5EMJA 3UYRH 3B7SA 3IXTB 4TNWK 5JXED 1T80A 1UKQA 4HYWA 5D9PA 2R0LL 1QRNB 5C0RH 5HHVH 1C9SA 2ZYHA 1EX1A 3AHYA 1JNJA 2Z8VC 5D7LE 1YSOA 1WYIA 3M7OA 2DOCA 4LAKA 2H0JA 3SDDB 2YXFA 4K3GA 2ZAIA 3FTVA 4C58B 1XF2A 4KERA 4W86A 1J0ZA 3ALWA 4JO1H 3QDAA 2PGFA 4GUCA 1I1WA 1PKLA 1NQBA 4OV5B 2OTPA 3BPLB 7ENLA 5KYUB 1F5ZA 3TE9A 4JY9A 4XPFL 2PGWA 5I1CH 3LRMA 4J2QA 4OZHF 1NGPL 5DS2A 3ZVVA 1G7JA 1PG7W 1CGYA 4JG0H 1SYSA 1IT8A 4PBFA 3Q2CA 5E8OA 5B22A 4MYAA 4PJGA 5KSAB 5KVFH 1SO3A 2CD0A 4OLVH 5I0VA 1NGWA 1KFLA 2XIJA 3BUVA 1ILUA 2WNWA 3BZ4A 5KVGE 5LAPA 1E9PA 1QPNA 2NQ3A 1MHCB 2RACA 3CVHB 3DURA 1UG6A 2NY1D 3HGRA 1MPAH 2ZKWA 1U93A 1DUZA 1PZ1A 1U1UA 1OD0A 1NEZG 4PULA 3B3BA 1E6PA 2ENJA 2BIQA 5FCUH 4F8PA 3Q4DA 1BQHG 1OGAA 3IMVA 3QVAA 4HUXA 5TJWK 5LHEA 4G7QB 4YXHH 5HMDA 1Q94B 4YLQT 4C1KA 5F0JB 4XP1L 2HH0H 4XPTL 3SGJC 5A2IH 3M0JA 4PRNA 1K6AA 3E3HA 4MXQD 4OUOA 4XB8A 4RFNC 4XZUA 4A2SA 3DFNA 1MCPH 2YZ1A 2FSDA 2NYYD 3LB6D 3VXMB 2X4UB 1KCUL 2Q3RA 4N2BA 2DW6A 4R8WH 1X96A 4JM2D 1KTJA 4KAQL 2H8XA 4V2XA 4B5UA 4O0QA 5CG0A 2JI1A 3D7PA 4W9FC 3LCIA 1FAIL 1XR8B 4NXSA 3E9UA 1OW0C 2VL4A 2FUTA 3D18A 2A85A 1DYSA 1SR9A 2Y1ZA 2J6WA 3K81A 3LOWA 4PS7A 4QIRA 5SWQA 3FN0L 4HOZA 6PAZA 4E9YA 3IGLA 1PWLA 3F4DA 4JFOA 3X1GA 5DMLA 2PDWA 4WHBA 5F96L 2ESVD 3QJXA 3C8HA 4MJHA 1JTTA 4QYOB 4NQCA 5GIRB 4AKQA 3LB0A 4V2CB 2BB0A 3IUIA 3S5OA 5IHZA 3Q1SH 2E09A 2XWCA 4YVXA 5I3DA 1QA9B 4B97A 1J5TA 3OMNB 2X1TA 1P4IH 1AG1O 1L8PA 1OW0A 5L7XL 1OAQH 3ONBA 2DI9A 2KZBA 1U8NA 2Y63A 3WUEA 2WSQA 3WLBA 1MZZA 2OZ4A 4LLDA 5FYKU 1MJUH 4GSXA 4H8WC 3OB0K 3RL2B 1NDWA 3AWFA 3AGVA 3DH7A 2GIXA 3U0WH 1I0DA 3APGA 1RK1B 3IE9A 1MQKH 3CFUA 3FOMA 4UDTA 4AENA 1LUCA 1R85A 4O0ZA 3MXWH 1I9IL 1YNKL 2XIIA 1FNLA 3VZYA 1C92A 2LLEA 5K59E 1DWAM 5BW7C 1FSKB 4XI5C 1GA2A 3QNZB 4HH8A 2P8PA 4MD0A 3VFSB 4CN6A 1B3XA 1GTEA 4JEQA 1R87A 3SDOA 2WHKA 5I17B 1YEHL 3D25A 3KPSD 3H3KA 2V3GA 1JF1B 3K2KA 5KW9H 3ULVL 4JFUA 4EIZC 4F8TA 1WPCA 5F9OH 1T1ZA 1FVDB 3U7WL 5DVPA 4I0PB 3HHSB 4HPJA 3NRQA 3HAEA 1Q65A 3ZLFA 4FFVD 3BXNB 4GW4B 1SJHA 1E6JH 1T5WA 3N25A 4BF5A 3DMMD 2CLIA 1PZSA 1QPKA 3MV7D 4UZGA 1OV8A 5A6IA 1ZSDA 4NX0A 1NGZB 3E6EA 2OZTA 3AHZA 1QFUL 4WI0B 3SE4A 2WBJB 2Z3FA 3PV6A 2AJZB 1WT5C 4R96A 1FNEB 4Y2OA 2ODOA 4Y5VC 4GT0A 5KYNA 3KBPA 5GQBA 2VFGA 1AZCA 5BJTA 2RD0A 4ZD3L 1ZV9A 2WHVA 5HGHB 1H1NA 3CFKA 1RQHA 1RSCA 1QSEB 1A02N 2A3HA 1AH4A 4JMNA 2Z65C 5HGGS 4BI7A 4MD5B 4XN8A 3VDCA 3K2GA 3OVRA 3GMRB 1KCRL 5F9OL 3V0JA 2EF9A 5BMFH 1RZGA 3ESVF 1FZJB 3BCDA 4PJCF 4YVUA 1BZDA 3MC5A 1FE8L 5IQMA 1G5AA 2GK2A 1IIHA 1ZHLA 1BJ8A 1YNTB 3CN1A 1MIMH 3GKZA 3MMUA 4H1LH 5GNXA 3QIBD 3WS3A 4PJBE 4CC1A 2CLOA 4ZMGA 3MBWA 4OCNC 1G9EA 1WCGA 4MHHI 3FF8A 3TOYA 4MX7B 4GUGA 1LL1A 1JWMA 4H40A 3FFOA 2CHOA 2LVCA 4GBXB 2KMWA 4JFQA 1FFQA 4LF2A 4GO9A 4RWYL 1GOKA 4WSKA 3TTYA 5K4XA 4ZXBD 1TU2A 3FJ4A 1XMWA 4JVWA 1YEKL 2Z8SA 5K39A 3WE6B 4PW9A 1IKOP 2QUVA 3HE6C 1I1FA 1I1AB 1D6VH 1SN0A 3ARBA 3N1PC 4UU9A 3SDDD 3QORB 3ZU8A 1EP2A 2IQ9L 3OYZA 4H01A 4H9ZA 4PJ7E 1ECYA 3BKJL 4R4NC 4UOQA 5A6AA 3O2VH 3VD9A 5E4IA 4GSDL 4HJWA 3BCJA 3B5GA 5L0QB 2Z00A 1NL0H 2WV8A 1AXTL 3UJFA 1QTWA 3WQ5A 2XBZA 2F15A 1HL9A 1RUKL 4PJGF 3T0WA 4X9SA 1I7RB 1HOCA 2N7SA 1V6YA 1QUNA 3FBQA 3AHVA 3Q58A 3UGRA 1N0LA 3CO8A 4LPVA 1SXCA 1KQYA 1JI2A 1QI0A 1CE6A 1JPTH 3U2JA 3EXLA 4PTXA 2CNYA 1X5IA 4E8DA 5A16A 5FEBA 1Q9LA 1NUGA 3OZLA 4C6NA 3BWAB 5J6GB 1SLXA 1G6RA 3A22A 1RJQA 1MCBA 1EZUA 3ARGA 3QGKC 4P9MH 2ZSVA 4IFKA 5AKRA 5I2UA 3UVAA 1YG9A 5C3LD 1L6YA 1YLVA 1W5MA 3SE8L 3W38A 1NCWH 5DS8B 4E9WA 1JZJA 3V35A 4Z2GA 4BFJA 2J1YA 3S1GA 3TC7A 4NT6B 1ZV2A 5AAMA 4IU2A 4EEEA 2AKRA 2ACUA 2YCIX 4WI3A 5ECJE 4CNIB 3NZHL 1K8DB 1C90A 1MFCL 5DJDB 1NKRA 1Q6OA 1CN4A 3OKKB 1YMMD 1A50A 3AY4C 2XSXA 4O52A 1JGLL 3FSZA 4NQUA 1ZPUA 2WMFA 2WBXA 1E6QM 3OIHA 4YZFE 3L1OL 1QO5A 9RUBA 2VGLM 2CBPA 1A5LC 3CK0H 4CKQA 1DANU 4TNFA 2VJXA 5DVNA 1OP5H 1QRNE 3VTMA 5ICZB 3WMPA 2VN5A 4QX4A 4A7VA 4I1PA 1SR0A 4PJAE 4Y0GA 1C8QA 1CGXA 4KXBA 2O9PA 3HMCA 4XWOD 2YDRA 3QHZH 3QSRA 1KFAL 4L9LC 4XBPB 2B4CL 5I8KH 3DJSA 3D9AL 4KWOA 1BIHA 4OD3H 4MYXA 3CQHA 4PY7A 4ZS7H 4X6CF 4OLZH 2DQCL 1GPOL 5GZNA 4GXWA 4TKWA 2HX9A 25C8L 3RDTC 5L7XH 3TYAA