3CTTA

Crystal complex of n-terminal human maltase-glucoamylase with casuarine
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
862
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Maltase-glucoamylase
publication title Total syntheses of casuarine and its 6-O-alpha-glucoside: complementary inhibition towards glycoside hydrolases of the GH31 and GH37 families
pubmed doi rcsb
source organism Homo sapiens
total genus 274
structure length 862
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3cttA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cttA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3cttA01
3DX1A 2VJXA 5GNZA 4MNJA 1JDCA 3WD3A 1KTBA 8A3HA 1EA9C 3LRKA 5CPSA 5GNYA 1SYTA 1V6XA 2IUZA 1R8LA 2XGBA 3N17A 1R85A 5DFAA 1GJUA 3WELA 2AOSA 3GXTA 1X6NA 1L0PA 4CD6A 3VGBA 1MW3A 2ZUTA 3NDYA 1XD1A 1RP9A 2VZOA 4NI3A 3ZSSA 2A3HA 2G3MA 5D4YA 5I77A 5LA0A 1WO2A 5EFFA 2BXZA 3SCPA 3IGUA 1HP4A 4GZIA 4N42A 1TCMA 2VT0A 4OJYA 5A6LA 2EACA 1JFXA 4PBGA 1A3HA 3GZAA 3WQ4A 2YFNA 1Q6GA 3BAYA 1BLIA 2BY1A 4F9DA 3VMNA 3MO4A 1UH4A 2FH6A 3D51A 1MW0A 5HPOA 2YBUA 3BLKA 4DWSC 1T0OA 4AZHA 3GXPA 1GOQA 3EJUA 3QOMA 3W53A 3U5UA 1WPCA 4FNUA 1JGIA 5CSUA 4U3CA 2BNJA 4HMEA 1TFVA 1E6RA 1E6NA 3A47A 2WM0A 3NSNA 2JF7A 3DC0A 5IDIA 1UH3A 1HJVA 2V5CA 1EGZA 3ARYA 2UY3A 1DWGM 3WDQA 4JKKA 3L2LA 1OGBA 3AS3A 5E6ZA 3N15A 2D23A 1QI4A 1O7AA 2XG9A 1QNSA 4IPNB 4U5KA 3DYPA 1VBRA 2YKKA 1GJWA 3CHDA 2WXDM 4CN1A 1E3ZA 4H8UA 1ZBWA 5A8MA 1N82A 3ALFA 1MXGA 1WAWA 1GOMA 3MSGA 2F1BA 1FHLA 4AISA 4AD0A 4JAWA 4WIWA 3EMZA 4GI6A 5A6SA 1PS2A 4CKQA 3ECQA 3A4WA 3DX4A 4WLCA 4B16A 1QNRA 2C0HA 3L4UA 4M8UA 2D22A 1L8NA 2GDVA 4WKHA 3K46A 5AY7A 4UQEA 1KQZA 1LWJA 4W7VA 1W1TA 5A6BA 4UQCA 3CIVA 2O9TA 2E8YA 3HU7A 5BROA 2EPNA 1HXJA 4W7UA 1JDDA 1HNYA 4NRRA 3POCA 3WF0A 2O9PA 2BVTA 4CD5A 1E0VA 4MAVA 2QV4A 1O7DC 2Y5EA 3FAWA 3M07A 2BVDA 2DQXA 4OIFA 3WQVA 1ZBCA 1J0YA 5C71A 1QHPA 1D7FA 4FLSA 1G9HA 3W29A 2XN2A 3PTMA 4QLLA 1B3YA 1TR1A 2ZUWA 4HTYA 4IM4A 1LL4A 2QPSA 4ZE5A 3LRMA 1PAMA 1I1WA 1MVYA 1NWSA 4AMXA 4AEEA 3IJ8A 4AWEA 3SCWA 5ABHA 1BQCA 2ZUNA 1OBAA 3D4ZA 3WBEA 2EBNA 5M17A 2RGLA 2DSWA 1UR8A 1TQSA 2A3AA 1CEOA 1JL8A 5A2AA 1G0CA 5CLTA 1OWQA 3AMCA 1QPKA 2FGZA 2UY5A 1K6AA 4U33A 2J8FA 1CECA 3ZJKA 5FKYA 4GI8A 4J7RA 4GZEA 3WDIA 3IANA 1WZKA 1XHGA 1DWHM 1ZJAA 7A3HA 3ARSA 3CHFA 4H41A 4CCDA 5CPQA 1XYZA 5CZKA 2GK1A 5FL1A 3VKKA 3WUGA 3WUEA 1BFNA 2ZX9A 3RM8A 3T0DA 1JZ6A 1B9ZA 1E5NA 3VDCA 1R33A 4B9YA 1UG6A 3MV01 4PSRA 4URIA 2D20A 2FGLA 4PTMA 1JYWA 2D2OA 1PE31 1W3KA 1B3WA 3RO8A 3VIKA 3WDRA 3AMDA 2XVNA 4LX4A 1BF2A 4CGTA 3KWXA 3WF3A 4GO9A 3B8SA 5A2CA 4S3JA 2XTKA 1C91A 3BUPA 1ISYA 1QX1A 1CGVA 2RGMA 3CUJA 1JI1A 1I1XA 4WSKA 1Z32X 4L4PA 1IV8A 4HA1A 2JALA 1EIBA 1LLOA 3AYSA 1V3MA 1E70M 3DDGA 1W32A 5DEZA 3GXMA 2W92A 1UQZA 1XH2A 3PZTA 1E56A 1BPLB 2ZXBA 3WF1A 1TA3B 2J7EA 4AY1A 3KEHA 5ABEA 4QFUA 1ODZA 4XV0A 1WNOA 3EJSA 2JIWA 4AZCB 5A6AA 3AHVA 1DWJM 4P8VA 3OBAA 5M5DA 4GQQA 2WB5A 3T08A 1J11A 4W8BA 1D3CA 1R34A 1WDPA 3NSXA 3TONA 1B31A 1XYFA 2CESA 2GDUA 4GPNA 2JEQA 2PWEA 2QF8A 2HISA 2D3NA 2BHUA 2ZIDA 3CO4A 1PSPA 3AHZA 3SCQA 1M01A 3I3DA 4NRSA 3W24A 2J62A 1LQ0A 3APGA 2J7FA 2VZSA 4RE3A 4W89A 5EMYA 4C7DA 4TX8A 1CNVA 3IK2A 1XRVA 3RDKA 8CGTA 4NSBA 3ZQ9A 2WAGA 1BAGA 3LX9A 4GXPA 2PBGA 1QNPA 1DP0A 2WCSA 3OA5A 4N0RA 4JFUA 3WMCA 1MFVA 4AD5A 2OWXA 1FH7A 2PSPA 2GJPA 2FYVA 1XCXA 5JBFA 3UEQA 3VILA 1CGUA 4H8VA 1W9XA 5A95A 3M46A 4XX6A 1U2YA 3WMBA 4ZXOA 1V6VA 3UR7A 4UTFA 1JZ2A 1UD5A 1HXKA 4W5UA 2CERA 1KGXA 4HPHA 4W88A 2EPMX 3H54A 2WC3A 4QCEA 5JBDA 1H41A 1JXKA 1KTCA 4F79A 4JHZA 4JCMA 3IJ9A 3W6LA 3WUBA 1SMAA 2VQUA 1ZJBA 3HG2A 4P8XA 3BAKA 3RJYA 4D6EA 1J18A 3CBWA 5BXSA 2DT3A 2F2HA 2XN1A 5A1AA 4FMVA 3WIJA 3A3HA 1E55A 2ZWZA 3EDFA 1LG1A 3AIQA 3WF4A 3WSUA 5BXRA 3W81A 3WF2A 4TVCA 3VDBA 2X8RA 5A8OA 3WNPA 3AIVA 5D8WA 1MW2A 2G41A 4TOQA 3AXIA 3JUGA 4FLRA 2CKSA 5FOOA 1XV8A 4FLQA 4D6FA 2VI0A 5A2BA 4PUDA 1JI2A 1QWNA 2J7BA 2ZE0A 1E4LA 3SCOA 2J75A 2A3CA 4WSJA 3BAJA 2D3LA 1R47A 5A6BD 2ZXQA 1UWTA 2X2JA 4D71A 5AC5A 1HL9A 2V3GA 1UZ4A 2O92A 1AVAA 4W85A 2OW6A 1TZ7A 2CKRA 4LQ1A 3VVGA 3LXAA 3T2OA 1FFRA 1E6ZA 2JEPA 2FHFA 1E1EA 1HJUA 3A4AA 1LG2A 3VO0A 1G5AA 3M7SA 4ATDA 4PCTA 1JYXA 1Q4NX 3DYMA 3GNPA 2WC7A 2JIEA 3SUSA 4X0NA 4MB4A 3ALGA 2ZX8A 3WBAA 1GOKA 3BCDA 5JIPA 4PYSA 2X2HA 1GOWA 1H0IA 3GXIA 3I3BA 3VDHA 4CN6A 2EAEA 4KH2A 3WDPP 3NDZA 3WL0A 1UH2A 1FA2A 3F5KA 3AOFA 4AZGA 4RL3A 1UYQA 3L4WA 5C8BB 1OGSA 3WD0A 2C8NA 2NT1A 4M29A 4KMQA 2EO7A 3OG2A 4QCFA 3GM8A 3UG5A 2IXVA 2YA2A 4JKLA 2VCCA 3MANA 4AEFA 3D3AA 2PF0A 4MJ2A 1H2JA 1H5VA 4IUGA 4XZBA 1G94A 1QW9A 4TUFA 3SCUA 3VSTA 1ISVA 5IXEA 1K9DA 4W87A 4MB1A 2WPGA 3EDJA 3NCOA 1VFMA 1A47A 3VTRA 3CC1A 1AQHA 1CLVA 3VUPA 3IAQA 2VURA 4BA0A 2D73A 4TXEA 3GXDA 1RPKA 5I5RA 1BYDA 1FH9A 5E09A 4PCSA 2YJQA 1K9EA 3D5HA 3MMWA 2VRJA 3S2CA 1BYCA 5IFPA 4CUCA 4AZ5A 3WL1A 4DUXA 4M56A 2WC4A 2WWCA 1EO5A 2WHJA 4F8XA 1WDSA 1PBGA 2BVYA 3ZSTA 5EBAA 1UOKA 3N9KA 1OGGA 1TA3A 3T09A 3UERA 1HX0A 1WCGA 1E6PA 4V2XA 1V02E 4AZCA 4Z2LA 3HG3A 2ESCA 1MYRA 3MUAA 4D6DA 3T2PA 2WHKA 2E4TA 3VD3A 3AXXA 3OIHA 4TVDA 3SUTA 4P8WA 3RCNA 2XIIA 3DDFA 1PPIA 4LYRA 2CBUA 4UOJA 2OYLA 3B9EA 3LPGA 3HJEA 3WNMA 3CHEA 1TQVA 3OZPA 4M24A 2BY3A 2J7CA 1W2PA 1MXDA 1E6QM 1UR4A 4A3HA 3WNNA 3RPMA 4ACZA 2DT1A 2YA0A 1V0MA 3VMOA 3EJQA 2J7DA 4M82A 4OOZA 3AS0A 2YL9A 5BCAA 5D9PA 3SCVA 1V6YA 3AIBA 1ISXA 4NZCA 4KGLA 3U5YA 4UCFA 9CGTA 1WDRA 2E8ZA 3EMCA 1GOOA 1XH0A 4IPLA 1E6XM 1WB0A 5AYBA 4LYQA 4GO8A 3AIUA 1NWTA 3WH7A 4U31A 3L4XA 3ARRA 2FE0A 4AD1A 2V3EA 1KWKA 5A6KA 2E3ZA 2DH3A 4UOQA 4PTXA 5D8ZA 3N1AA 3AZSA 5HBFA 1X1NA 2QMJA 3UG4A 4JFTA 3BVVA 3WY4A 1GPFA 4QP0A 2X1IA 3BUDA 2OWWA 4WKAA 3W28A 5BYWA 3W82A 2ZICA 5GQBA 3WD2A 2DH2A 1GQIA 1F4AA 1W9VA 1J0KA 4DUVA 2GFTA 1UD3A 4EKJA 4W84A 1CXKA 2ZXDA 5CXPA 1U33A 1V3JA 2GUYA 3RJXA 3EDDA 1UKPA 1J01A 2VMFA 1OD0A 4M80A 4PMVA 2FDMA 2G3JA 4MNLA 4TTUA 4NXSA 3AROA 2TAAA 4OBRA 5A8QA 1JIBA 2XVPA 4GI9A 3ZJ8A 3WEOA 3VIJA 4AZ7A 4PTVA 3ARWA 3CZKA 2WMGA 1TVPA 2XN0A 3PHAA 4UFMA 4BQ5A 1DHKA 3WN6A 1KXVA 3WKZA 3NYDA 1EH9A 3BVTA 3ZO9A 3ZIZA 4FNQA 1EQPA 3BH4A 4E8CA 4JIEA 2VQTA 4P7NA 4JCLA 1JNDA 3ARQA 2DSZA 3POHA 3EJTA 3KLLA 2XSBA 3PZOA 2W91A 3F4VA 3NJ3A 1CGXA 2EQDA 3CV5A 1XH1A 3TTQA 1PJ9A 3AS1A 3WD1A 3G6LA 1W1VA 3L4VA 1TQWA 4PMYA 2WMIB 2FHCA 3N11A 5HDRA 5I23A 3RM9A 1XSIA 4YHGA 2PWGA 1OT1A 5I78A 3OLIA 4PMXA 4D6JA 1NM9A 3MSDA 2EABA 1GORA 3SEPA 5E0CA 1CIUA 1MQPA 5KEZA 1C7SA 2G4FA 1JZ3A 3CZNA 4CCCA 4UFLA 2D0FA 2WSKA 4HOWA 2YDQA 1LF1A 1K9FA 5CJ5A 1JDAA 1UD8A 1QHOA 3U7VA 1CENA 4J27A 4J3SA 2VVSA 4JFSA 1X6LA 3FW6A 2JFEX 2BHZA 2BY2A 4U2YA 2D1ZA 5DT5A 3VNZA 1B90A 1FHDA 1FOBA 3ZJ7A 2XWDA 1PX4A 4ZXLA 1V3IA 4AZIA 3UESA 4D1IA 5LYRA 4UQDA 1E4NA 2WBGA 3BVXA 4E2OA 3H55A 2QLYA 3TV8A 1PX8A 2GJXB 2BY0A 4U3AA 4UQ9A 1E5JA 1C8XA 1E4IA 3BMVA 1J0HA 3RM4A 1XC6A 4PMZA 2E9BA 4W7WA 1E72M 2ZX6A 1V0NA 3WH5A 1D2KA 4AIEA 2F61A 3AQUA 4BQ2A 3ZT7A 3DX0A 3BAWA 4AW7A 1US3A 1DEDA 1JZ5A 1B0IA 4MADA 1DTUA 4J3TA 1KXQA 4Q7NA 3ARTA 4E8DA 3GXFA 3WD4A 3M6DA 4J3WA 2YLAA 2J8GA 3AS2A 3QOKA 2VZVA 4AZBA 4CU7A 3VD5A 3PZNA 3VMPA 3L4TA 1WZMA 3OGVA 1MFUA 1UKTA 3AHYA 4Z2HA 3KZSA 2VCBA 3L4ZA 3K4AA 1W1PA 3W37A 1H11A 3FXYA 1IT0A 3GH4A 1KGWA 1JD7A 3CMGA 4AD2A 3SCSA 4OZOA 1Y7VA 1VFFA 4H04A 4XUYA 1DWIM 3WNKA 1W9UA 2F7QA 4EE9A 4UR9A 1CYGA 4OBSA 5CPTA 1HJXA 2VVNA 1KXHA 3TOPA 4D6HA 4ZEPA 1EO7A 2WLYA 1UKQA 1UD2A 3PZGA 4BCEA 5BRPA 4CU8A 1OT2A 2F7OA 4TVUA 4Z2JA 4UNIA 4QLKA 3AZRA 3WNLA 1ECEA 4GIAA 2VOTA 3PTQA 3EYPA 1VF8A 3E1F1 1QI2A 3MI6A 1CBGA 2ZUVA 3AIEA 2DT0A 2CBJA 1VEMA 1JAEA 3OGSA 1ODUA 2YOCA 1NOWA 4UFKA 6CGTA 4AMWA 3K1DA 1HIZA 3VGGA 4JL1A 1WZLA 1PZ3A 3DHPA 2OLHA 3UCQA 5F7UA 4BS0A 1B2YA 3EMQA 2X0HA 2IXUA 4HOXA 3BC9A 1NH6A 1R7OA 2VX7A 1H4PA 1BG9A 1CXIA 3K8KA 4LYPA 5D9OA 3W27A 3WH6A 2WVTA 1UWIA 5E6YA 4JHOA 1KGUA 5M3WA 7CGTA 3U7BA 3WH8A 2F7PA 3PZIA 5DF0A 1CXLA 5BXPA 3FNDA 1KFWA 1PX3A 5LA1A 2WZEA 1W3JA 3BCFA 5BWFA 1AQMA 5JBEA 2J25A 5C70A 4J3UA 3AHTA 2Y4SA 2WVSA 4NZFA 1W3LA 3B9AA 2CHNA 3ZOAA 3LPOA 4AYGA 3S5YA 5CQ1A 1C93A 4H8HA 1GVIA 1JD9A 1JZ7A 1SMDA 2F18A 3THDA 5TD4A 2GSJA 3VOCA 3TTYA 3QHNA 3VGHA 2EPOA 2XGIA 5GNXA 2AMGA 1PS3A 3RILA 2E40A 3BSGA 1ZBKA 3QGVA 3BMWA 3T0AA 3WQWA 1ISWA 4R5EA 3VIPA 4PEEA 1M53A 2AAAA 3VNYA 2PI6A 1M7XA 5JUVA 1Q6EA 4PUEA 1UKOA 1H09A 2D0GA 3BAXA 3CZJA 5KZ6A 1EHAA 3BLBA 2YL6A 3BUQA 2VX4A 5I3DA 5A8PA 3WENA 1JNEA 1OCQA 3NUKA 1EDGA 4AD3A 3ARVA 4MPKA 3BAIA 3EDEA 2ZUMA 3O6AA 4V28A 2WLZA 5CG0A 3VIIA 2WW5A 1MQQA 3WY3A 3RMEA 1HT6A 5CGTA 3DECA 3PBGA 4W8LA 1EOMA 4ML4A 4PMUA 2NT0A 1ZS2A 1KQYA 1KB3A 1QWUA 1KWGA 1M04A 3K4DA 4HP5A 3EDKA 5HNNA 1OIFA 4UZSA 1FH8A 3EBVA 2BFGA 1KBBA 1TG7A 4K68A 1XCWA 1HKIA 3VSUA 2A3BA 2UY2A 5IHRA 1KCLA 1H0GA 2YLLA 1GQLA 4MNKA 4DWSB 3QR3A 1CWYA 2EJ1A 1W9PA 2YIHA 3II1A 5LA2A 3A6OA 3F5JA 5BRQA 2X0YA 2E0PA 1PCPA 1LWHA 5FL0A 2F1AA 3WFZA 1QNOA 5A6JA 1KCKA 2Y24A 3GH7A 1HKJA 4KRUA 1SZNA 4KRTA 4M81A 5A94A 1ZBVA 4HA4A 3KE0A 3ARUA 2VX6A 3T2QA 4PSPA 4H7VA 1V3HA 2J77A 2CITA 1JFHA 3RIKA 2OSYA 1TUXA 3BVWA 1V6WA 2CYGA 3WQ5A 1C8QA 5CSYA 1V6UA 3FY1A 1OD8A 3CZSA 3S5ZA 1YHTA 1CTNA 4GQRA 1HVXA 1XSKA 1NWRA 2OWCA 2J7HA 3GDBA 3NIYA 3SUWA 4D6GA 4UFHA 3I3EA 1ZU8A 3VX0A 2Y8KA 2X09A 2VL4A 5A6MA 2PWDA 1VAHA 2A3EA 4PMRA 1CXEA 2ZX5A 2DSKA 1UWSA 3IAPA 3FHAA 1UASA 1W2VA 4MB3A 1QNQA 1PEZA 4WF7A 1HN1A 1R75A 2QHAA 3A23A 1C90A 3TA9A 1GZJA 1E0WA 2DIEA 3GXNA 3SURA 4QDMA 2OSXA 4C7FA 2DGAA 2WHMA 5HPCA 1UWRA 1FP9A 4DO4A 1GOIA 3WFLA 2XM2A 3VGFA 2JE8A 2VC9A 5E1QA 4LPCA 3BLPX 5E70A 3UG3A 3VIHA 5IFTA 6TAAA 1V0LA 3CZEA 1OINA 6A3HA 1TQUA 2WCAA 5AC4A 5ECUA 2WZHA 5D9MA 2V3FA 3F5LA 4HOZA 2G3IA 3AIRA 3PZMA 3A4XA 3GBDA 5CGMA 2XYLA 1LL6A 4XB3A 3NSMA 1EOKA 3ZR5A 3K8MA 1CGWA 3VD4A 3OB8A 1B3VA 3AJ7A 2WYSA 4MDPA 2WVVB 2WCGA 3FHQA 1B1YA 2UY4A 2VZTA 2JF6A 4DUWA 2W62A 4DM2A 4ZFMA 1E4MM 1UR2A 4X0VA 4ZENA 4J3XA 2XSAA 2XPKA 4W8AA 3ZT5A 1XGZA 1UHVA 5FIPA 3WMSA 4BZYA 1CLXA 1FFQA 1F4HA 1Q6FA 1UKSA 4LXFA 3CTTA 4FNTA 3L4YA 3AHXA 3VIFA 1NP2A 1H49A 4BQ4A 2Y2WA 4A4AA 1DWFM 1ITXA 3WUFA 3VM5A 3A21A 4W86A 3SCNA 3W25A 3MU7A 3ZMRA 3L2MA 2CETA 4F9JA 2EADA 5I6SA 5FD0A 1VFUA 3WY1A 3PZQA 1QI0A 1KR1A 2XFYA 2ZX7A 4U5IA 1BYAA 3U57A 2VR4A 4CU6A 4D1JA 4Z2KA 1UR0A 1E1FA 3W4RA 4OGZA 2QPUA 3SCTA 4FNRA 4PN2A 1TQTA 1QHZA 4PMOA 1JYNA 2WK2A 1WDQA 3GYCA 3WEMA 2J7GA 2VZUA 4IISA 2DIJA 3OLDA 3A5VA 4MNMA 2CIPA 3W26A 2VNCA 2Q8XA 3QHMA 3ZJ6A 3SUUA 3DX2A 2WZIA 1P6WA 4PMNA 3EJRA 1CGYA 5M03A 3PN8A 3VDAA 2VRKA 2WMKA 3UR8A 4AIOA 1GCYA 2ZOXA 3DX3A 1V3LA 3D50A 2BXYA 4D72A 3CH9A 3VGEA 5DO8A 2DPEA 4OUEA 1CXHA 3AZTA 5ABFB 3BVUA 4TTGA 1JYVA 3CZ8A 1HP5A 2YFOA 3SUVA 1VJSA 1V3KA 1OM0A 2B31A 2WWDA 1UQYA 4WK9A 3VX1A 1NWUA 3VPLA 1W3HA 2YDRA 4AYSA 4YPJA 1WE5A 4CVWA 3VU2A 3MUY1 2VCAA 3QHOA 4HU0A 2YA1A 1E43A 2DDXA 2ZUSA 1GONA 2CNCA 1E9TA 3D52A 2XIBA 3K8LA 3KL0A 4HPGA 2J74A 1BSIA 4RE2A 4HMDA 1QI5A 1BG4A 1HI7A 3N12A 1V02A 3EJPA 5A69A 3AIWA 4UZUA 4ATWA 4NF7A 1EXPA 3N04A 2UWFA 4J3VA 1JF5A 2G8ZA 1GVYA 5I0DA 4V27A 2ALWA 5E0FA 1C92A 4R27A 4EK7A 1W9BM 4Q22A 2X2YA 1E6SM 3CUHA 4LGXA 4DWSA 3KLKA 2E9LA 3BSHA 2WKLA 2J4GA 3THCA 1ITCA 1JAKA 1E73M 1VBUA 2WNWA 2NSXA 1O6IA 2WKGA 3VGDA 1PIGA 3GH5A 4EANA 1HKKA 3GNOA 3VINA 1GHRA 4QLJA 1UD4A 2FH8A 5FCZA 2QMKA 4B3KA 1JZ8A 1KR0A 3N13A 2YBTA 2W5FA 3MMUA 1UZ1A 1UR9A 1J0ZA 1UA7A 1YQ2A 3AICA 1NARA 1UUQA 3OLEA 2CPUA 1H1NA 2W61A 1QVBA 1NOFA 1G01A 1E0XA 2PWFA 3BXWA 3PZ9A 1CGTA 4YN5A 4XZWA 1G1YA 1JXJA 2EPKX 3VSVA 4MAZA 4MB5A 1WZAA 1MW1A 1VB9A 3CHCA 1CDGA 4JFVA 2XVLA 1C7TA 3W6MA 1TMQA 1BGGA 5GPRA 2O9RA 3BUIA 1US2A 2WBKA 4HMCA 1JZ4A 1ISZA 2DEPA 4AXNA 1RP8A 1XSJA 1GQKA 4WJXA 4TX6A 5HOSA 2J47A 1CXFA 1KBKA 2PB1A 1OIMA 5IHSA 1W9DM 4AIUA 2HVMA 1HWWA 3OLGA 2BS9A 1HF6A 1TE1A 2V3DA 2XHYA 1J0IA 1E40A 3ARZA 5I79A 2E9MA 3VD9A 4BQ3A 4HZ7A 3AYRA 4U2ZA 2WMFA 1AQ0A 1QBBA 1JG9A 2G3NA 1PZ2A 3LXCA 1C3FA 5D9NA 1QOXA 4MTVA 4P7OA 1BHGA 2PC8A 2XFRA 4F66A 2XFFA 3TTSA 2W67A 3VIMA 4UQBA 4PRWA 4NZJA 3N18A 3VD7A 3KL3A 5AYIA 1HL8A 2PWHA 2XWEA 5A3HA 2WANA 2X05A 2OYMA 3SCRA 4B3LA 3G6MA 4X9YA 2ZUUA 1R87A 1VRXA 4GKLA 2Y8VA 3W38A 2Z1SA 3IJ7A 4AMCA 4GINA 1I75A 2WVVA 1Q6DA 2GJRA 3TTOA 3AI0A 2OW7A 1MWOA 1GQJA 2XUCA 2WVUA 3CUIA 3VIOA 5DT7A 1H3GA 1WP6A 2VRQA 3LPPA 1NQ6A 3B9DA 1HJWA 2WMJA 3CMJA 1SFSA 1QBAA 3WQ6A 3WH9A 3WQ8A 2Z1KA 5EB8A 3GTNA 2DT2A 2MANA 1VEOA 4DO5A 4ACZB 4MDOA 2DSVA 4PMQA 1FP8A 4H2CA 3T0BA 1HJQA 2EEXA 5EFDA 5A8NA 4CD7A 5E9AA 1C8YA 4KWUA 4PTWA 1UD6A 1E9LA 4E4PA 3DYOA 5I24A 1R46A 2CCRA 2WMHA 2VX5A 4JZ5A 4UOZA 3MMDA 4Y7EA 4FNSA 1J12A 2ZXAA 4L4OA 2ZWYA 4P7QA 2NW0A 2IGTA 1UA3A 3LMYA 4W5ZA 4Z2GA 4KGJA 1XD0A 4BF7A 3ZR6A 1J0JA 3UETA 3ARPA 4ACYA 1EDQA 1VIWA 3ZT6A 1IZKA 4CCEA 2CEQA 2VUYA 1HVQA 3AXHA 4AZ6A 2YL8A 2J78A 3HG5A 4WKFA 5HXMA 5ABFA 1RH9A 3MUIA 1OB0A 1QI3A 3MV11 3S6TA 4JL2A 3PZVA 1GNXA 4Z2IA 4B9ZA 2D0HA 2CXGA 1EHNA 1HTYA 3TP4A 2CHOA 4OOUA 2W66A 3W0KA 2XVKA 1U30A 3GBEA 3WNOA 1WKYA 1B3ZA 1RD6A 2WMIA 3LRLA 3CZGA 1BVZA 2YDSA 2J79A 3OZOA 1M03A 4UFJA 2VO5A 3CUFA 1EDTA 3AMKA 3AMLA 3AFBA 3A22A 1VJZA 4DM1A 4OKDA 1V08A 4C7GA 4YHEA 4P8UA 4DO6A 4FK9A 1Q6CA 4NXKA 4S3KA 2XM1A 2CBIA 4HZ8A 1W91A 4CD4A 4JFWA 2D24A 4CN4A 1ESWA 1UR1A 3AMGA 4AD4A 2OSWA 3O9NA 2GVYA 4DWSD 3OGRA 3MKKA 1TVNA 4NX0A 1SR0A 1BVNP 1B3XA 2X2IA 4RE4A 1IZJA 2F7RA 2XVGA 2WSPA 1ZB5A 4HZ6A 4M1RA 2DSUA 3CPUA 1AMYA 2GJXA 1V03A 4UQAA 3GNRA 1QW8A 2VR5A 1BYBA 1NP0A 2CBVA 2W4XA 2WHLA 1E3XA 7TAAA 1LJYA 3HN3A 2EPLX 3MUZ1 3WDHA 4P7RA 1R86A 2VTFA 4CD8A 3ZM8A 2XJ7A 4GZJA 2PBOA 3CLWA 4PMDA 3HG4A 3CUGA 4FNPA 1BGAA 2O9OA 3BGAA 3VIGA 4HU8A 3WDJA 3MS8A 4P7LA 1VEPA 3HZ3A 4J28A 1EQCA 3ARXA 4FLOA 1CZ1A 1GUVA 5CLWA 3J7HA 2EXOA 3PTKA 4AC1X 2FHBA 2BV9A 3D4YA 1HKMA 2YL5A 1DWAM 1KXTA 1CPUA 3A24A 4W93A 4D6CA 4A3YA 1V0KA 2GK1B 4D6IA 4ZE4A 2C7FA 1JF6A 3CZLA 1BTCA 3BUBA 1R7AA 1S46A 5BXTA 4EAMA 3FN9A 4JKMA 3WEZA 3HMCA 1K9TA 1LL7A 2V38A 3DHUA 3VM7A 1HJSA 4HA3A 3H53A 2F8QA 3LPFA 3AISA 5ABGA 5DMYA 4MJ4A 1E71M 1B30A 3SIMA 4B15A 2BHYA 4QAWA 2OYKA 2W63A 1PIFA 5JIWA 1MQRA 4ATLA 3KL5A 1J9YA 1VFOA 1VENA 1ZL1A 3CGTA 1E15A 3FAXA 4UFIA 1UWUA 4CVUA 3O2LA 1OSEA 3LXBA 4FF5A 2V5DA 1W1YA 1UWQA 5I2UA 1GHSA 3PZUA 1GW1A 1NOUA 1J10A 3WY2A
chains in the Genus database with same CATH superfamily
1RZQA 4QHLB 2V8ZA 5CPSA 5GNYA 1XQKA 4FDWA 1SDDA 4OZFA 1KCRH 2MNJB 3K71A 4S38A 2QADB 4S1RL 2EE9A 2AVGA 4PJIE 3SY0A 4LB8A 1M3UA 2X6UA 1IFHH 5HDBB 4U6YA 2NXYC 1LEKB 5E2TH 5LA0A 4PCNA 4YL9A 3LS5L 2PP0A 4QO1A 2EYTB 2LVCA 2EDLA 4TN9A 4XKMA 1Z3GL 1OCJA 2BJML 2YBUA 2MH4A 3HMWH 3GKWL 2GFBA 2Y1AA 1OHZA 5ETUA 3MNMA 3CHRA 4HS3B 4Q7DA 3HF3A 3C60C 4N4PA 2IDFA 5AOLA 4E5XA 2PPCA 4O02H 3INOA 4KBPA 4KQ3H 2WBWB 4GQBA 1RCQA 1E5CA 5DCCA 5LDUA 4HBQA 3M0VA 3RWIB 2TSBA 1BMZA 3C09C 3DI2B 3TJEL 1KLZA 3GS6A 2R1KA 4MWFB 4G5AA 5JHLH 4J6RL 4XTIA 5I8KH 3BKCH 4ZUWA 1CDIA 5FO7A 3LV5A 3VB9A 1Q66A 1LE5B 4HX1A 4UYPA 1XAKA 2JQXA 4E9QA 1J6PA 4ZPVA 5AY7A 3KM2A 2ERJC 1FDJA 1HCFX 4U1HB 3HU7A 3ZE1E 4DVRH 3PPHA 2JGYA 2ZF9A 1JXGA 2KC0A 5GIRA 3UZYA 5EOCH 1JWSA 3TBWA 3CDZA 1MVYA 3GIZH 1YW1A 4JTJA 5CKGA 4MLSA 4G6KH 1BLNB 5ENWA 4Y9AA 5C0AE 1KTJA 4MCZA 3P5YA 1OANA 3DRTA 5A2AA 3AMCA 3TVMA 3VC6A 2J8FA 1CECA 4MY8A 1A7OL 3WDIA 3O6KL 1TTGA 1ZJAA 1NEUA 3HGOA 1JCXA 1Z9SA 1MJJB 1K03A 4P3DA 4AVKA 3WUGA 1IGJA 5L6YL 5GGRB 3VXSE 3EH2A 3UBGA 4OJEH 4KNQA 4OLXH 3VIKA 1U8LA 2JB6A 2FZNA 4WUIA 3LQAL 4XSLA 1BYOA 3BSMA 1TLKA 2VDIA 4KT2A 1SO5A 2NQLA 3VXNB 3VFMA 3GUTA 5T3ZE 2ZG1A 2PCEA 1XF5B 1E70M 4NO2A 4ZNCD 4L4VA 2BNQD 3SDCB 1ANUA 1WFJA 4GSRA 5HHVL 1CTOA 4QUOA 3DGRA 4N6RB 2DEXX 4G8IB 5A6AA 3ELFA 1DWJM 2PDUA 3CDCA 4GQQA 4DGVL 5IEHB 4CVZB 4Q8QA 2ZOTA 3ONBA 4YZFF 2DMBA 4GPNA 5CPLA 4JLRB 2ZIDA 3VNLA 4H26B 2AJVL 5IW1A 3W24A 5FO8B 1G7UA 3TM6A 3ME0B 1ACZA 1TDQA 1HQ4B 3JBG7 4NKOA 3TLRA 3EJZD 2NX5E 3DROA 2HDJA 4U1KB 3UEQA 4UCGA 1W9XA 5KS9F 1H7PA 3TBTA 4J4PC 1ZTVA 4IPJA 3WMBA 1VS1A 2Y7LA 5GZOD 3QDJB 4W88A 2WC3A 1NOAA 3CFTA 3VCRA 3Q2VA 4WUUA 3NGFA 1IQDA 4EJ1C 1G7HB 3W9EA 4D0CA 4K23H 1ZJBA 1G9NH 1P5UC 2BS8A 3MYPA 3OQ8A 3NZ8B 4G6JH 3SM0A 3U4FA 4YK4B 2PDWA 3MA9L 5T3XE 1WBZB 1K7XA 3M7WA 3PWUA 3P3RA 3FKRA 2GUOA 4NFCA 4LVNC 4FLQA 2PWVA 4MWAB 4WFEE 3RR1A 4JFQB 5D8JH 2X2GA 2GQ3A 3FO1A 2D3LA 5IW6B 3O9WB 4FR1A 4NZ1A 3PHOA 1YXDA 1C5CH 4S3FA 3MRCA 4D71A 2BIMA 3HLAA 3ICJA 4HAFA 4KCVA 3QNXB 4ZCWA 2FSEA 2G9HA 3BIKB 3MOBH 3NPVA 1TZ7A 3LCWA 3F05A 5DUMH 3VXUB 1D3GA 3AREC 3DBNA 1SM3H 4FP1A 1SYVA 4MSWA 1ICQA 4PCTA 4LPTA 3MSRA 2OEJA 2WC7A 4L61A 3WBAA 3BCDA 3ULSA 2UXVA 5TE6H 4CNNA 5JXED 3SDXB 1MJUL 2J9ZA 3S37X 4NRYB 2X4RB 3OG2A 3CQHA 5EIIB 3GM8A 1FRBA 4D9QE 3N6JA 5EF2A 4YJ5A 3RE0A 4IUGA 3TV3H 5F9AC 1KIQA 4U7KA 1ISVA 1W0MA 3GVVA 2R1YB 1NGPL 3KYMA 5BOPA 5EBUA 2HWZL 3CN2A 3KRUA 1L9WA 5I5RA 2YD1A 1NEZB 3HPLA 3NCFB 4WY7L 1WDSA 3COTA 1XF2B 4RXGA 2EIMB 4MMZC 4H5SA 3T77A 1TA3A 3HZYA 1WCGA 3O2DL 2D7QA 3CC5B 2P5EB 4QF1B 3N43F 5T8GA 5DRNB 4WFGE 5IROD 3IDYC 3K91A 2VR8A 4UQIM 4KNUA 3DMMB 1JGDA 4C8XA 1MDAA 1YN6B 2CJSA 3VMOA 4O52A 4YC2C 3L3GA 1IKFL 3ZTEA 3QC0A 2YL9A 4YOKA 5EO0A 1MCDA 4EAYA 1E3FA 4N6EA 2VZ3A 2VC2B 2QXWA 4FX7A 4K3JL 2FQDA 5E08L 5F2MA 3TQPA 3EYOB 2NY5L 3RY6C 3ZKXC 1MOEA 2CLIA 2DH2A 2BOFX 1AZCA 3OKEB 3FU8A 1F4AA 3V52L 2KLRA 1Z5LA 1RIVL 3H26A 2VQ1B 5FF3A 3BRGC 5EU6A 1EUNA 3FOLA 3LGDA 3QJQB 4OBRA 4AQAA 1GSMA 3H6OA 4Q9QL 4HUVB 1FY6A 5DBTA 2BNRA 4GMTL 1EH9A 1Q9KB 4G42B 1S6NA 4X0KA 3V4PH 3K2MC 4HMNA 3ABSA 1C9SA 5SWSA 2VQTA 4P7NA 3POHA 4I3SH 2VH5L 3H9HB 4RBPH 3FJNA 2FEJA 4L4VE 1H1ZA 4A37A 3FULA 1PJ9A 3AS1A 4JTAA 4BF5A 1W1VA 3T6QC 1XX9C 3GNXA 4ORIA 2FVMA 4XK2A 4YBQC 4G7EA 3NEVA 2XFXB 3NFNA 2NVAA 4CBPA 5I75B 5SX4I 4PUWA 2XISA 5DT5A 3ETBF 5I6LA 3ZIMA 4ERGA 2A6NA 3TO4D 3TZVC 3VKBA 1J4EA 3SQRA 1UCBL 2P8BA 3MCNA 3N34A 3BVXA 3TV8A 2O72A 3BDBA 1XLDA 4PJ9D 1L2UA 4XOEA 4ORGB 2ZXCA 3KH4A 3V7PA 3QQWA 1T7XA 5LWYH 2P5WA 2BSBA 4Y5YB 5A3IC 3DC8A 2OX5A 4HUXA 3PFMA 3QUZC 5IGXH 1BD2D 3BAWA 3IARA 1ADOA 3SE8L 4NYLB 3ARTA 1FWJC 1IBGH 3IU4L 1GTEA 3HAEH 4WUUE 1U8PB 4M7JH 3PIQB 2XQBH 1HZKA 3AHYA 2GIMA 1KCWA 4AGQA 4HK0A 3LN3A 1JD7A 4JHWH 1CLKA 2N1KA 4A04A 2J6EL 3Q94A 3S3PA 3BZ4A 3RKPA 1EPVA 2A0LC 3S2MA 2F5BL 4QLKA 4G8EA 2OO0A 4Q8MA 4KRLB 3B97A 2RJGA 1ZAGA 3DG7A 1P7QB 1UT2A 5IKCA 4A05A 2JKJA 5FCUL 1SJHA 1A9BA 2CIKB 3CHOA 4JFFB 3G5EA 3UGXA 2Y7FA 1HKLL 4Y9BA 4ZSOA 3BHBB 1IGTB 2NZIA 4X60A 3HZVA 5KZEA 1QCWA 2CRIA 4LRSA 2RIKA 5E0QA 5REQB 1EWEA 1BG9A 1ES0B 5AW6B 4LYPA 3QJXA 1JF1B 2CG9X 3RPTA 3SBQA 2E5CA 1CL7H 3HPFA 3A9BA 1RY0A 5FECB 3MUGA 1QKZL 1N7MH 2WNGA 1D6VH 4M48H 2ZE3A 1CF8L 3E38A 1ZK5A 2PTXA 5HYJB 2XGIA 1T89A 2DWDA 1VFAA 1XGUB 3UWUA 5EB9A 1NCWL 3WQWA 4JVUA 4M1BA 3R11A 4C83A 3HI6L 1KGJA 1I7ZB 1HCVA 3WFEH 1MI5A 3LTPA 4QNWA 1KY6A 3HA0A 2ADJA 3BAIA 2WZMA 3L9YA 3NVDA 1G4SA 1AY1L 3TJ4A 4HSQA 3A6BH 1PU0A 4LLWB 5DT1H 1D9KB 1RZIA 2VN7A 12E8L 1CE6B 5GS1C 3EDKA 3EBVA 3GU1A 1XCWA 1YY8B 3II1A 4JG0H 3F5JA 2XZQL 3CU1A 1OL0A 2EUWA 4HUWB 2VEKA 2VAJA 5BRZB 1F1AA 1JCNA 4KRTA 2GLKA 3QHFL 3UG8A 4BE6A 3BJ91 3CPRA 5AVWB 4H7VA 3QW9A 2QV5A 1R2SA 4N5EC 1ICPA 1ZLWK 3TQKA 3S5ZA 3EX2A 4Q89A 4UFHA 1XLAA 3HPJB 3L3DA 3GPSA 4O13A 2J8OA 1ADSA 4WZ9A 3C08L 4K3GA 3S1XA 5AVSB 2E47A 3APMA 1TXKA 1IB5A 2KKQA 4DP6X 5GGTA 2HTMA 1F6FB 2BNRE 5BOOA 3LQLA 4Z8FH 2PPAA 1SSGA 5HPMB 2ORBL 4Y2OB 4HHAB 1FUNA 3NQAA 3KMDA 2QKIB 3V0VA 1H3UA 4HOZA 1F6AA 4OSUL 3NSMA 1KEMH 3GNMH 1B3VA 3QJRB 5C3TA 2HVKA 4FXKB 4IG2A 3HGRA 1TZOA 1T4WA 4C91A 4D3CH 3FCUB 3C5ZA 2FJHB 4G5ZH 3HUJF 4HIJA 3CSGA 2R59A 1JXDA 4H4IA 3VM5A 2HG5A 4M61A 3OPZH 1MFAH 4J12A 4JPIA 3L2MA 2R1XA 4F9JA 3QZWG 4DVBA 3BCJA 2A6JA 1L6XA 3MLSL 3O4OC 1F90H 3U57A 1XXXA 2P5WE 1UR0A 3CFEB 4G8GB 1YY9D 4PMOA 4B6ZA 3A5VA 3MLYH 4GUFA 4HBCH 5E9DA 3D9AH 4Y4HC 4H6KA 2X89D 1A6WL 5KVGE 1CGYA 3JV0A 4APQC 5GHWH 2WMKA 1GCYA 4PP1C 5DO8A 3PG2A 1MHCB 2O61A 2DLGA 3DG6A 5I6NA 1JYVA 1ZENA 5DMGC 2P7TA 2Q2LA 1VJSA 1MLCA 2H6OA 4WK9A 2PLTA 1FNEB 1WE5A 2H4EA 4QRNA 2YOAA 1R0AH 1XDTT 2XRAL 2CUMA 5IVXA 4KKBC 3DURB 3QY8A 3EYQC 5C2GA 2WKOF 2YBGA 5DA0B 1EXPA 3HOGA 5JORA 5I0DA 5DJ6B 2NSOA 1GOFA 3OJVC 2OX4A 1OAUL 5E95B 3ZVVA 4ZSOE 3AU1B 4ESKA 1S8DA 3FQTA 1KV3A 4QTGA 4PBXA 1PEWA 3GJFH 3GD6A 4MDJA 2DYRB 2HXAA 1HUVA 1EX0A 3BEWB 1QBLH 4AC4A 1FG2A 4B3KA 4OUUB 5I1JL 1R3KA 3N13A 3RAOA 2R9RA 2IAMD 1TREA 3VFVB 1PD1A 3SO5A 1UZ1A 3IT8D 4MJIA 1DDTA 4GKNA 1UUQA 3CVHA 3L1OL 1W8SA 1X8FA 3MGTA 4XXCC 2FX8H 3N3TA 3A4DA 3IVKA 4FXGA 3IDJB 3WCZA 4PB9L 1CDGA 1TPXB 1AKPA 3D69B 4LHUD 4LCSA 3WK2A 5D1XE 3CSTA 1T40A 1RP8A 4WJXA 3NL5A 4TX6A 5HOSA 2I7OA 2FJGA 2BS9A 5AALA 1HO4A 4XP1L 4ZDHB 4QXGL 4ZQOA 4AZUA 4I0PA 5LBSA 2QQNL 2CRZA 3ZL2A 3KRZA 3BH8A 4U2ZA 1MI5E 1AP2A 1ED3A 4H8PA 4P7OA 5KAQG 1CFNB 3RWFA 4IJRA 2O55A 4PJGE 4Y4FB 3V6ZB 1JGLL 4ZGYA 4LCCB 1H7RA 3OJDB 2A85A 3G6MA 4B3LA 4Z76B 4GKZB 3JTBA 1OP3H 1WUNT 3O6FB 2DQDL 1TZGH 1BBDL 2GUBA 4PU2A 3VCCA 3APCA 4HT1L 1Y07A 1DIEA 3B9DA 3GLEA 1OEPA 1S7UB 1R30A 1UM6H 3MRPA 3P9MA 2KZ1B 4MDOA 3QWQB 2YRZA 2WXHA 5C6TH 1W8EA 1ERNA 4JHAL 1TYJA 3OKDB 3T3MB 2DEWX 4UIOA 3KLAA 4AX6A 1TF4A 4EPDC 3QUML 2ZWYA 3G5ZB 1NOLA 2IBBA 4EOWH 5H8MA 3L17A 1TKWB 2ARWA 5KJRL 1AJ0A 2Z4QB 1CBVH 2HRPH 3ROLA 4WWKA 5FDWA 1RSCA 3RGVD 5HWMA 4JTGA 2D69A 1NC2D 4YGAB 1PKOA 5B1AB 5GZNA 3VFNB 3D6NA 4JE0A 3ROOA 4EZMA 5D2NC 1QFWI 3TYFB 3HMXH 3T81A 2YD9A 4G7FA 4P2OD 4TNVK 4NHVA 2VDQB 1GYAA 1R0MA 4EN3C 2Y1VA 1TTAA 3QEQA 4LNRA 1P0SE 1JRHL 4XCEB 5DHVB 1WKDA 1S38A 1NKGA 3DX6A 2EEDA 4H0GA 3O0LA 1LNUB 4HZ8A 4I89A 1KYOJ 3O8XC 3O4LD 3CYVA 2PDCA 4O51B 1EJSC 3SB0A 3OX8B 5I3IA 3MCLH 4NIRA 1ORQB 3V8CA 3OHXC 4AJWA 3MX0A 4YHNB 5E6UB 4A2GA 1ZHBA 4YHPA 3CPUA 1GXEA 3T42A 4ZODA 3LKNA 2G2RB 5HVHB 7TAAA 3HN3A 3WDHA 3CFBB 3PJUA 1BWLA 4AQ1B 1TPH1 3MCKB 4E9SA 3ORJA 2ADAA 1O5RA 4J39A 2CO3A 4XMUA 4PRTA 1N6VA 2CO1A 1S7RA 1BEUA 2XWTA 4LCRA 3VAEA 1BM7A 3MP3A 3RUGE 4HH9B 1FAIH 3PFUA 5DEFA 1GUVA 3QMSA 1TRIA 3KVJA 5EOQL 4R97B 3F7PC 1U8MA 4GRLD 4FQCL 2GOUA 4XP5L 3IU3A 1IZCA 1JN6A 1MNUL 3PV6A 2PNDA 2Z65C 4G43B 3JW7A 3TYGH 1HQRA 4O1CA 2PXYB 5FXCH 4P4KD 2Q3RA 4FQIL 4RDWA 1P4IL 1R5YA 1QAWA 1U8JB 2Q2EB 4GEJA 3PJXA 2INZA 2YSSA 4MKNA 2AEQH 4DQAA 1HU8A 5IVXE 3L7FA 4DP9X 3QEUA 3WY2A 4DZIA 3T8MA 5GNZA 3CHQA 2J2ZB 2IQ9L 2I17A 3Q37A 1DJIA 5C07A 3FT0A 5D03A 1R85A 5H37H 3DXAA 5AD0A 3PAOA 1A1OA 3CFCL 1N64L 4N85A 3HG1D 1E8YA 3QO1A 3VGBA 3EHBB 1MW3A 3LN5B 2VZOA 4MA8H 5D4YA 2JKTM 2CGRL 2Y7GA 3C5JB 1J96A 3IEAA 4K5LA 5TDNB 5A6LA 2XBTA 4MJIE 4PJCA 1IGFH 4KJQC 4AEHL 4FQ2H 2G4EA 4E2VA 5ACZA 1ZFJA 3GWJA 2MQ0A 2BVPB 3LDBC 3BN9C 3EH5B 3PY9A 2BNJA 3MYJB 3CBRA 1GOXA 1QLEB 2EE3A 4DZBA 2GBTA 4LLMB 3ZVHB 1YXCA 1DBAL 4G7VH 3SGEI 1V55B 3VFTB 3MV7B 2XWJB 3FT3B 3QUMA 5IBLC 5LGHH 4IPNB 4U5KA 5BO1H 1DZBA 3C2FA 4D7BA 4F3HA 4Y1AA 4I7ZC 3WJYA 1URZA 4APXA 1YDVA 2ITCA 2WJ5A 1SXAA 2F1BA 1QU4A 4K1WA 4AD0A 4JAWA 3SDDC 3KPSA 4MASA 4KDTA 3SY6A 4A8NA 4WWNA 3BDXA 1I7UB 3AUWB 1US0A 4M0XA 1SHWA 5A6BA 3PB0A 4DJEA 3H7VA 3WTWA 1IUZA 4B27A 4AWTA 1HXJA 2WO3B 4KXZI 1PDYA 4AM0B 4Z1PA 1XWYA 5B80A 2O9PA 3GLCA 4ML9A 1K4DB 1NGWB 5GS3A 1G9HA 4JR9L 1I2OA 3NVQA 4POZD 5FJTA 2MPAH 1UR8A 3TZNA 2EKGA 5HHMD 3GO2A 1SOSA 3JYCA 2V63A 4EQ2A 5CLTA 1QPKA 3H0TA 2DWYA 3H2WA 4HIXH 4PJ8D 3IANA 4I18C 4PCPA 3ES7A 1XYZA 5GJNA 4IRSD 4HCLA 4LLVB 3VRLE 2FPVA 1CDUA 4PSRA 2N7AA 3IDMB 3MBEC 1Z7JA 3BPNC 2PMQA 2QCDA 2FWLB 1A6UH 1OGAA 5J3HD 3WF3A 1RZFH 3GSUB 3N42F 3TFBA 1UJQA 3QZEA 4MA1C 1BXAA 3AYTA 5MEOB 4FYTA 3SY5A 1EIBA 2VFHA 1E90A 2W92A 1EJXC 2NSQA 2Y07H 3IS4A 4PRNA 2IS7A 1DDHB 1YYML 2ZXBA 1PKQA 3N4FA 3A6CH 4QFUA 3KBHE 4U1GC 4F57L 1WNOA 4PRID 2YZRA 2P28B 4JQ2A 2OKMA 5AW4B 3T08A 1J11A 1WOAA 2R82A 1AXSA 1OX5A 3QJFA 1XIJA 1R34A 3KDMB 3LEPA 3QFWA 2GDUA 3OZ9H 5KVDE 3TASA 4K8RL 2BFVH 1AK5A 3CO4A 5I6XB 1U4FA 1MRDH 3UMTA 2H6UA 3IK2A 4WW2F 4Q4OA 4YVXA 4XZIA 5TFSH 1TB3A 4FQXD 4NBYB 3NCCB 3MRRA 1S5HB 2O5ZH 3TR9A 1E5ZA 4UM8B 3QUXA 1VCFA 3RO6A 5ECJE 3VILA 5EEXA 3KOYA 3TBVA 4V2CB 5BV7L 5DUPH 1EAOA 5JQ6L 5EU5B 3QFJA 5GS0L 4XH2A 1CD1B 2YPKA 3H54A 5C3LD 1G7JB 3ES6A 1O12A 1JV2B 4F79A 1NMAL 4C6IA 2JV6A 4Y8FA 3WKPA 4HZ1A 1I9JL 4EDWL 1Q6OA 3BAKA 3EFDL 4LNVA 2APVA 1A5FH 3EO0B 3AT8A 2HFEB 1BREA 4OCMC 3EDFA 4GS7C 3AIQA 3W81A 3ISYA 3LH8A 2F9RA 3QIBB 3HUJB 5EA0H 3AIVA 2P88A 1M1XA 1TZHB 4LSQL 1R9ZA 4B2DA 1KTRL 3L3JA 2W88A 3NCMA 1AKJB 1AS8A 5CZXC 5IMLA 4G1NA 1LROA 2QEJA 5IG7B 2J6WA 2NCEA 3QJOA 5FC9A 3AZUA 1JK9B 3BWWA 3ZIYA 2QW5A 3P4NA 1EZVX 2YKLH 5C07E 2DQWA 3MRQA 1ZLPA 4FRWA 2OW6A 4Z23A 3DXAE 2PS2A 3T2OA 2PCPA 1E1EA 1WXYA 4XTDA 2EXYC 3QPEA 5ABAA 5D7JC 4ELDA 3K4WA 3U30C 3W1QA 3WFBL 3GSRA 3TWAA 3NPZB 3FQUB 3RPIA 2OL3H 3TQVA 3GXIA 3OQ3B 4CN6A 2EAEA 1YUKB 2FD6H 3MBXL 4PJCE 1SBSL 1PLBA 3MNWB 3O11B 3HNVL 4LPUA 5F6IB 1ID2A 3EB4A 3NABH 2HFGL 1YIXA 3E5PA 1LOQA 3QDGB 3MANA 1XEDA 1T0MB 2WQ8A 2ZNXA 1CB2A 3RVUD 1MVFA 3APFA 4E9WA 1K9DA 4WUKH 2UV8G 3RGHA 2EIJB 3MNVB 2WPGA 4LY4A 3EDJA 2NNRA 5JHBA 3KVMA 4QYOB 1L6YA 5IB4A 5I6OA 4A7GA 3WJMA 4PCSA 2YJQA 1URLA 1AC0A 4Y1AE 3WUWA 3EXJA 1EB3A 3F62A 2WWCA 4DKTA 4X9HA 1BM3L 5JDJA 5EBAA 4WHYG 3VXPB 3KPSE 4ZPTB 2V5BA 5I06A 2IADB 3RX5A 2OR9H 3FHEA 1E4XH 2AV1B 4P8WA 1RK1B 3H6AA 2HT2C 4LYRA 2HPTA 5EU4A 1NGYB 1REIA 2N3JA 1AD0A 4LGPB 4W6YB 4EE2A 2DT1A 1B0RA 1EJTC 1LE9A 2Y5JA 1XFPA 3S8GB 4EO5A 1HOEA 4UWMA 5T91A 2VLKD 1RUMH 3FSTA 3C6LA 1WDRA 4TUKH 4L9LB 2IALA 1JDFA 1ZT7A 4KKPA 3UYRH 2VFEA 1EP1A 4OT7A 5EDXA 2JLPA 5GQBA 3V7AG 8PAZA 5I9QC 1P6CA 4FG2A 3VABA 3KHQA 1CXKA 4Q9RL 1R6VA 5CJ8A 3MBWB 4RGMC 4M80A 4DTGH 4PMVA 4N8VG 1QR1B 4MNLA 2Y7SA 3OKKA 4JM0A 4JQAA 5A8QA 4PGBB 3CZUB 3EH3B 4HJIA 4PRHD 4Y5XC 3WEOA 1NBVL 4INFA 1OGAE 2AGTA 1EUUA 1TEYA 1PNDA 4P2RB 5DK3A 4G6MH 1EQPA 3QG7H 3CQ0A 3BO9A 1LO4H 3KDOA 4MY9A 1TRDA 3NQFA 3LS4H 4LOVA 3N2MA 3ARFA 1OCRB 1TQWA 2C3HA 1BXCA 1EMTH 4KC3B 3W1RA 5ICXB 4KEVA 1KGCD 4PODA 5EOCJ 2XXMB 2BX7A 2EE2A 3CAWA 1RHCA 3U7VA 1CENA 3F64A 4F80A 3RP1A 5HUOA 2LE9A 3BKJL 3NT0A 4R3UA 2DQIH 5LYRA 3W76A 5AB1A 3RVWD 1WDAA 2GJXB 4LWWA 4M3HA 3UR2A 2FT6A 2JJTA 1GPOH 5I5IA 5KN5A 5FYLE 1YEJH 1DYSA 4KNTA 3WN5B 3QFJE 5D7IF 5D93B 1JZ5A 1UM5H 3QZNA 5GSRA 1EJUC 4Q7NA 4MM1A 2P8PA 1R5IB 4R33A 3WD4A 5HY9A 1TOXA 4J3WA 5TQ2L 2F8XC 3BQUC 3VMPA 1KC7A 3SDAD 1XIWA 2V9TA 4WNQB 3S8FB 3S1GA 1Z9NA 1CBJA 4C58B 4F7KA 1GW6A 3CXHJ 4HUCA 5LCVL 5D6CB 3ZX1A 3ABOA 4LVGA 4PMJA 3BJSA 1UKQA 1MUWA 2Z7KA 3QORD 3V0AC 2YC1B 2VOTA 3PNWB 1NAKL 2YAEA 2Z93B 1QI2A 5HGHA 2GZXA 1S3TC 1NBZB 1IBBA 2Y8UA 1FUYA 4PG2C 3W1XA 5SWZD 3K2GA 4ADTA 3ELQA 1X4XA 1YMHB 3LHVA 3NZUA 3QSTA 2J8UF 4MFHA 3H12A 1IWAA 3FYOA 4BZ2A 2OJZH 4JPWL 3RLSA 3I02A 5AKQA 1BFOB 4BS0A 4HOXA 1AA1B 3H3KA 3BLDA 1YMMA 4O57A 4IPPA 3W27A 3B06A 4ORMA 5C0AA 1YNPA 4Q8BA 3G5YB 5BXPA 3NM3A 4ODUB 1ZCRA 2Y6SC 1EPFA 2YUWA 5K9OB 1KKOA 2A4AA 1H62A 1WV2A 3E3HA 4AYMC 4R7NA 1GEQA 1RZKL 1U95A 2YB4A 5AFAA 1IM3B 3VXSA 5I5JA 3GJEA 4ZUUA 4YUEL 3QUYC 3H2AA 4MWFA 4Q74A 3W07A 1S2CA 4TLTA 3D07A 4PUEA 5EY5A 1LE5A 2DF3A 1G4MA 1NM4A 3UZZA 5IFJB 2ZD0A 1EHAA 4TMBA 3JWOH 4AVNA 2YD0A 1COBA 2DS4A 5E5UB 5MERA 1RPQA 3F7YB 5LXXA 4F37K 1G4RA 4YHIB 2A4EA 2FGWH 1CGSL 4BJLA 1QWUA 1KWGA 3UX9B 4UZSA 5EFIA 1FWSA 4FXRA 5IBTH 1LLAA 1MCPL 4FCAA 4YXHL 2A6KB 4O8AA 2OR2A 1BLNA 1CWYA 5C8JA 4N86A 2DDQL 1H8OA 4AB4A 3K6SB 1QK0A 5A6JA 3FPYA 3SN0A 4R26H 4HGMA 2CR3A 5AC8A 1YNLL 3TVMD 1Y8BA 4L0YA 2J9YA 4JTLA 3LMJL 3GMNA 2OSYA 4KWSA 3EA1A 2QDEA 2EUVA 3LKOA 4S1FA 2VC6A 4BF9A 1ECQA 4F2EA 3IETA 3UWWA 3KS6A 4WW1A 4FIRA 2CFFA 2IAND 5I1DA 3C87A 4PV9B 4PBWD 1UASA 5ADOL 2PTZA 4QRQB 1HN1A 1XJBA 3R58A 5T5NF 1XF5A 4LBUA 1IC7H 5FI8A 7FABH 3SDCA 1QFUH 2OEKA 1SMOA 2CO4A 2A9BA 3R7MA 1A53A 4N6RA 5DWUL 5E23A 1A7PH 1OZMA 3UY8A 3GSXB 5IEHA 3SZKC 4LOFA 1IEXA 2VC2L 1FCVA 4MJZA 5LHEA 2NYYD 3GLAA 1FJ1B 3KOWA 4O15A 5FO8A 3KM8A 2WCGA 3LQZB 3BPCA 3KPQB 4DUWA 2E7BA 5A16B 2CO6B 4NDMB 1MAML 4UT9L 3S47A 1UKSA 1SY6L 4IRZA 4OJCA 1UCWA 3X3GL 4HJJH 4E42A 2GGEA 3O2VH 2EADA 3AXMA 4AMKL 2BSEA 5CGYC 1RZGB 4P57B 3N42B 3V7MA 2OBGA 4GUCA 1BYAA 3D30A 1SYSB 2EC9T 5D5MF 3SR7A 4RCAA 3W4RA 2VDNB 1JCMP 5EU9A 2D7OA 3T1GA 1X96A 2UZ9A 1EYEA 3OC5A 5INDA 5JZ7C 2R14A 2GSIA 3E8UL 2J88L 1EJOH 4WO4D 4OQTA 4BK5C 4R2GC 3RJOA 3V4VA 2CDGB 3L1EA 2AZUA 1E1CA 4XIAA 3WD5L 5F3BB 2PP7A 1WTLA 3RWJA 3QHOA 5IV2B 3TBSB 1HJBC 2QSVA 4WW2B 3KS0J 2CNCA 3O9WA 4XXDA 4YDKH 1MCRA 4RRPA 3TMLA 3RPBA 3QNXA 3SIZA 3S37L 2R2EB 4UZUA 5G4WA 3FO9B 4M6NH 1DJNA 2CHXA 4LMQE 2X4NA 5HDBE 3CUHA 1DFBL 3BSHA 1YADA 3RTLA 1BAFL 4XKYB 1JPEA 3G1DA 3C8KB 3I4KA 3KCLA 2R29A 1WKFA 3GH5A 4QRPB 3G6AB 3SBRA 2FH8A 2QMKA 1JZ8A 2Y22A 1YMME 3LEXB 4XOCA 3H21A 3TUUA 4NRYA 1UA7A 3CIWA 4MCMA 4RFNC 4TV3A 5EIIA 4Q8PA 1BOYA 1I31A 5BU9A 5EORL 5J57B 1N8FA 5MI0B 1GKEA 1Q9WB 2ZYFA 3T0EC 4AIZA 4YN5A 1F61A 1G1YA 2GWNA 3QYSA 1XR2A 3I6EA 5DD5H 5GGQL 1BVWA 5C2XA 1HE8A 1XSJA 1FLRH 4XBEL 3UXIA 1Z5YD 1NEZA 4KIRA 2YN5A 2IV9A 3MLUH 1TE1A 4NPYB 2JI1A 4XO6A 3IGHX 1QSFD 1NFIA 3KYNB 4G3YH 4XX1E 1NFKA 3CC5A 2P5EA 3CFUA 4OH2A 4Z7UF 3F2CA 2NY3D 5E7FA 4ZX3A 2FVLA 1MWAB 4QTFA 1JUEA 1E5BA 2XOTA 1VRXA 5IT2H 2FBJL 2GJZB 4R34A 4Y88A 3MRMA 3QISA 2UVFA 3R8HA 3TA3B 1RSYA 4URKA 1R2TA 2UZIL 4OVUA 1E9IA 4Q4PA 3SDOA 4ZXBA 1SXSA 3T07A 2VRQA 3VD2A 1NQ6A 5IP4A 2A7BA 3PAJA 5ICZA 4I3RH 3TT1H 3WQ6A 4X5PA 5CBIA 7ODCA 2GQHA 4MJJA 1HAWA 3A3YB 3L1FA 4ZS6C 1AIFB 4NUGL 5DJ0A 4HFWB 5H8DA 5E9AA 2JIXB 2B08A 1H0DA 5AECA 3DYOA 3PL6B 3MHGA 2JCCF 1GHFH 2VQ1A 2FGBA 1MFNA 4HF5H 4GIRA 2V2XB 4UOZA 4RR4A 4XP9L 5DURD 3BZEA 4LEBA 4AE0A 4KGJA 2EG6A 1XD0A 3UP6A 1S2EA 1ICTA 1J1XH 5EU6D 4OI9A 3SYQA 2BNUA 4HUVA 1EDQA 4BFEA 1MLBA 1KSRA 3SGDH 4IKNA 4AGMA 5I1HH 2OMYA 2FB3A 4I9WE 3MUIA 5CILH 3GAKA 1GNXA 4BE5A 2WN2A 2DAVA 5ISZD 1L7IH 3H9HA 5SWSD 1G67A 4UTJA 3ZRSA 3M17B 4NQEB 1XF3A 3WLLA 3GBEA 4Q6YA 5KUMA 3TN4A 4WWPA 3KZPA 4E0RB 3UC0L 3NNTA 4B5UA 4X4KA 5EO1A 4K15A 2DIKA 5EZOH 4YHEA 4IIQC 4P8UA 1A4KB 5IB5A 4I9XA 4QRFA 3ZMEA 3EAUA 3Q05A 1E67A 5AYTA 5FJIA 5A2FA 1DBKL 3WLSA 2ICES 4KWWA 5CBJA 5CN1A 2IIJA 4DEWA 1ROCA 2NNCA 2CGZA 4EIUA 3TC7A 4RE4A 1IZJA 4X5XA 1SQ2N 2GC4C 4YHOL 3GNRA 3L5WB 1A6TB 4HXBH 2WHLA 3ABMB 3H42L 1LJYA 3QLLA 1K8DB 3B2DC 3RDTC 4ZMQA 3FUDA 3ATEA 5BJTB 2G0KA 3QDJE 2WW8A 4MA7L 4DXKA 2ZJSH 3BE1H 4CC4C 5EMLA 5HATA 3BPLB 1CVRA 4EEEA 4WEMB 1VESA 3Q5YA 5EMJA 4IYKA 3U1QA 4QDPA 4X6BB 4Y5VB 4LLYA 4OI7A 4KFMA 2F08A 1T20A 3KBVA 3L9RB 3ABKB 3C6CA 1BJ1J 3EX1A 3DBSA 2F8QA 3AU2A 1U21A 3T3MF 9XIAA 3HN8A 3VNIA 4J23A 5BOJA 4JN7A 4K3DL 4CVUA 2WXFA 3M5YA 1OSEA 3KBMA 5DQ9B 4N6QA 3JVAA 4XMTA 4GISA 3UBHA 4DPRA 5B38G 2CIKA 4NHCH 4LO9A 4OF8A 4X7TB 1IGTA 1R8LA 4PIRF 4C6EA 5FLVA 3OGOE 3WTYA 5D7IB 1GKQA 2ZUTA 1RP9A 5FGBA 4W81A 4A35A 3SDXE 4UQ2B 2C91A 2ILLA 2PYFA 2EACA 1OOAA 4DXVA 4PBGA 2FWUA 4LNYA 2H0FA 1Q6GA 5B8CA 5E6IC 1BLIA 3GI9L 3W0WA 1GVOA 4OKVB 5JH2A 4NNXA 4JG5A 5C0RL 3VFPB 1ZANH 3QOMA 1SJBA 4A21A 1B54A 4ZMGA 2GGGA 2YXMA 5JPMB 4ACTA 4K6AA 1E6NA 1FDZA 2JF7A 2V5RA 1HJVA 4YGVA 2V5CA 4PD4J 4UAOB 3RTQC 1FAKT 5DFWH 1I7ZA 4JQXA 3HN5A 4J3OF 3K72A 8RUCA 3RN6A 5PCYA 4DNMA 4D8ZA 4L5FH 4HN4A 3GIQA 2J8UB 1E3ZA 4XPBL 1GOMA 4O1FA 4GLEA 2P5EE 3S4SG 4LLWA 1R3VA 1D9KA 1YJDC 1JGVH 1TPEA 5CM1A 1QNRA 2DUXA 1CICC 4HCDA 3B5GA 1P2CA 1CE6A 4XO9A 1PY0A 1LWJA 2YD7A 4UQCA 5J1TC 2F19H 4Z17A 3R25A 2BSCA 4XN7A 5KYUB 7PAZA 1U9KA 1MJ7L 4CD5A 3K2IA 1E0VA 2ZPKH 2WXMA 1I85C 3BZGA 1O7DC 1OVDA 5C71A 5BRZA 5TE7L 1XR9B 4M93B 4EBQL 5D1ZD 2Q1EA 1D7DA 3E0WA 1UZ8B 2ZUNA 1MSSA 3GQFA 4F1ZA 2F6UA 4I1RA 2V2TA 3B2UD 4PE8A 1WF5A 1D2OA 2FFIA 1CEOA 4NJIA 5G1YA 4GQPH 1UVQA 4MYAA 1M7DA 3AY4C 4FTVD 1AE6H 3F7JA 1NUGA 1FORH 1JCJA 2HROA 3PY2A 3CHFA 4Q4QA 4PLJD 3VI4F 3PAUA 2VLMD 5IQNA 4GXUM 4XAYA 5CHNB 5FF4A 4K5MA 2NTSP 5T1LD 3HBLA 2V17L 5I1LA 1B9KA 4RFEA 1UG6A 3DK2A 4ZTPH 5AYXA 2R2BA 2IDSA 3URAA 2XA8H 2CBTA 1ME9A 4X2RA 4Y2OA 1OARL 2C4XA 2WTPA 3DSFH 2QF7A 4OGAC 2NX9A 1LLOA 1IAKB 3IMTA 5HR7A 3RFZC 1QACA 5AKVA 4BFNA 4AUUA 4XC1H 3RLHA 2HT3D 3K6DA 1BFVL 4Q3MA 3D0CA 4TS6A 2VLJB 2W9DL 1B6UA 1IT9H 5IQMA 1ODZA 4GSXA 1T21A 4JO3H 5F1SA 5I19L 3OAZH 5M5DA 1ZCOA 2FJHA 4U6TA 4ALAH 5E8EA 2FTYA 4H40A 1XZ0B 3C5ZD 2CESA 1CT8B 4FQHB 3T0XA 3DRQA 4OFVA 2J62A 4XZHA 1AI1H 5KVEH 3SGUA 4DQOL 2PDJA 3O2DA 3EWDA 3IFLH 1URIA 3T1FB 1H1YA 4F9LC 3NQBA 4JFEB 1GZQA 4EI5B 3EJYC 2J1WA 2J1YA 4O00A 1OK4A 3S3JA 3Q7JA 4TQEH 1TELA 2VXUH 3WS6A 2IF7A 4I4WA 3UJFA 1T0NB 3S9ZA 4H8WL 3N9SA 5E8NB 1L6PA 4ZXOA 1KM5A 2VDQL 2X70A 3CCHA 5E9DD 4OM1H 4AQ8C 1IGCH 1DIKA 5D1XA 2H9GA 4YSEA 4GJJA 3W6LA 1XIBA 1YO4A 1TPC1 4A2LA 1CFSB 3WIJA 4GKTA 4I3GA 4WNJA 3NACL 3B9KB 3DURA 1CFQA 3TFKC 3WX7A 3KPNB 2OMVB 2C4FU 4JKWA 4I87A 2ICWA 4GBXB 2P5NA 1QATA 4PJGA 4WJG3 2LU3A 2ZE0A 5KS9A 2N01B 4IP7A 4OCXL 4QLWA 2QR6A 4LPVA 1OK0A 4M7LH 1BP3B 5C0CD 5D5MB 4NJ9L 5F97E 1UZ4A 4WX2A 3WQGA 3CE1A 2VDOB 4OUUA 5IESL 4JKPL 1O68A 3VO0A 3B2PA 3P3UA 5FKPA 4IOFC 1IXPA 4CW1B 2DKSA 1LYQA 4L65A 4PJHF 2QTVA 4L8SC 1CI3M 1DXEA 1BDYA 3RWDB 2AV7B 2H26B 5DHEA 3CQIA 3CZFB 3PWNA 5IBXA 2OK0L 3L4WA 3W0WE 5EG6C 1BZEA 2EVHA 3OPSA 4J3ZA 2IXVA 4Y89A 2CLEA 1IXOA 3BKMH 5I3GA 3MRNB 5EU7C 4AXWB 4RNFA 5CS7A 2B59B 3SCUA 3BP5B 3IM1A 1UWAA 4LRNH 4YO0B 3EJZC 3W02A 3CC1A 1AQHA 3QJHA 1G1OA 3CN4A 4BA0A 1WYJA 3DKJA 3MMWA 1K9EA 5C08A 1GIGL 2XH2A 4P0DA 2KX9A 5GZOC 4ZQKA 4AUYA 2VXNA 1R3HB 2QDDA 1NTHA 2C1GA 4JHBA 1RALA 4PB0H 5HQMA 1A64A 3CT2A 1JCVA 1P1MA 4JO2H 4UOJA 3I6KA 4OIIH 2J6EA 2PP1A 1UJ3C 2Z35A 4Y4KB 3FT1A 5BRZE 4UILL 1QLEL 4IGBD 4OOZA 1NIDA 2A77H 1GGBL 2EEAA 2NCMA 5E2UH 1HFUA 4CJ0A 1UB5B 1K6WA 5HHQA 1E6XM 3HBQA 4QDWA 3G5ZA 1N5AA 2E3ZA 4UOQA 4AY7A 1CFVH 4F15C 4HCRL 3BW9B 1LJMA 1NSNL 5FAAA 2X30A 1BD0A 3RZCB 4XWOD 1K6QL 1HEZB 3L3IA 4Z7UB 3CSBA 3QI9A 4F7CB 2BCKA 3RUGA 3P3YA 4AYDC 4ANUA 4WWKD 4RFOL 3IGKA 5E1AA 3VFNA 2TAAA 1KJVA 4QQ3A 4JNZA 3JWDC 3O2WH 3O3BA 2JI3A 1MFBH 2POZA 5JXEC 2Z25A 2XN0A 2ZVRA 2HKHH 2DVUA 1DHKA 1KXVA 2ACQA 3ZO9A 1KT2B 2GY7B 1ETZB 3C2YA 2Y9RT 1XF4B 4WDIB 4PY7A 3KLLA 2W91A 3QEQD 2A74B 3QXTA 1LNUA 5JXAH 3TTQA 3VKDA 1ZWIA 1F18A 4O51A 1XSIA 2DVXA 4YHGA 3OX8A 4HNTA 2JCCB 4BA8A 2IXQA 3FA4A 3QYMA 1CIUA 5KEZA 4JR5A 1UC5A 4G82A 4LANA 2WSKA 4LASH 4X6FB 1B4LA 1KPVA 2I9LB 1HKVA 1S7XB 4QRUB 1FOBA 3T40A 4HFUL 1NGXA 1A5BA 4K3EL 1AH1A 2CLZB 2X4PA 3CL8A 3QRLA 4HH9A 4U0QB 1U2HA 4G8AC 1E4IA 3RM4A 4FADA 4M8QA 1RQBA 2ZCHH 1J5HA 3DX0A 1US3A 1SJMA 3ZKNC 3DIDA 5KSAA 4MADA 1TMHA 4NQDB 4OHQA 4OE7A 1WA2X 5ID1B 1SFTA 1JNLH 2PXYA 4CU7A 4YZFE 1XIFA 4N24A 1E9QB 1XCFA 3L4ZA 2WQPA 3ULVH 3W37A 1H11A 4L1HA 4F8PA 3CMGA 2ZVIA 3PUEA 3WFAA 1Y7VA 5FEXA 5DR5H 3O45B 3KPMA 5K2ZA 4HK6A 5CPTA 2HRHA 4D6HA 3K74B 4PLKC 4QAIA 1OT2A 1D5XA 1X38A 4UNIA 3U9UA 4ZA0A 4UQ3B 4JTIA 2N7SA 3GK0A 3E1F1 4C4BA 3SPJA 1WD9A 3MI6A 5KS9E 2D4DA 4NAFB 1JCYA 3OC8A 1U2CA 3LN5A 3B0XA 3CT7A 3ZS4A 6CGTA 4JDEB 3FB6A 1H6TA 1ZVYA 2YJLA 2ZRUA 3ENLA 5HGDB 1TMLA 4NN7B 4TO8A 3DSNB 2CLPA 4GH3A 2VKZG 4KY1L 3HIJA 3UAJC 3MBFA 3WH6A 2BVPA 3HE7A 1IL1B 3BH9A 1OF0A 4Q6JA 1LEGA 4XNYL 1UB3A 1XLHA 4PBDA 1KJ3H 3R0UA 3SO3B 1OHQA 2DBLH 4NPJA 3VFTA 3MV7A 5CQ1A 1PCKA 1C93A 5F89B 2XWJA 1JZ7A 3KZ8A 3FT3A 4UDUB 4TQIA 4AQLA 2PYEB 2AMGA 2QCGA 3NJIA 4XO5A 3PBYA 4BQCA 4ADUA 1KC5L 1A7RL 3NCEB 3OMAB 3NEOA 5C08E 3X17A 1XIHA 5DTFB 2C3GA 4K9EL 1KCSH 1EZVY 4MPKA 1DJHA 3TDFA 2Q87A 4HYRA 1BGXL 3BQVA 3DX7A 3MRKB 2Z31B 2ICCA 2X87A 4A39A 4DJED 1N8WA 5G1MA 3JWNE 5FUZH 1FGNH 1KB3A 4HP5A 4L4TB 4PP2A 1VF5C 5T33L 1BZ8A 3D05A 1R3IL 2EJ1A 2J1ZA 4QCIA 5LGJB 4WKZB 3IIZA 5B39G 4Z1BA 4GFTB 4JX5A 2J72A 1G87A 4HXAH 1IM9B 5A94A 1ZBVA 3QE5A 4LSRL 5DRIA 4OCWH 2A3TA 1PO9A 5AYYA 9PCYA 1JFHA 3QV7A 2GIYA 3BVWA 5BZDB 1CTNA 1UWYA 3IDMA 3ITOA 1QNVA 3GDBA 4EN2A 3MDJA 1ZU8A 3B8TA 3NR0A 1K8IB 3GSUA 3M0MA 5EZIL 43CAA 3O16A 5DBUA 4ZO6A 1F8IA 3DX8A 2H3DA 3FHAA 4AV5A 4B7LA 3FOKA 1BX2B 3G6DL 2R2CA 3MTRA 2DJSA 4E68A 1RK0A 4WF7A 3IRDA 1MUCA 3PWLB 4HKZB 3BJLA 4A7VA 4PFMA 3UXFA 3D47A 2UZXB 2LOEA 3L68A 4XMWA 3BDYL 1AW1A 2F58H 1HS6A 4KHXH 2IFGA 3C12A 5IFTA 4D8OA 3N91A 1NDYA 1E0OB 4Y2DB 5RUBA 1PLGL 1IVTA 2G60L 2G3IA 4AK2A 1HL4A 4M1GH 3V0UA 2NZLA 5I3JA 4ZMVA 1ZPLA 2D2HA 3VI4B 2XPKA 3CWHA 2QJHA 1UHVA 1S5HA 4P9HH 2FZ3B 3CTTA 3EJCA 3LB6D 3RVXD 3WUFA 3SCNA 3ZMRA 4UOW0 2VABB 4B3VA 2GC7C 3QUXD 4NM4L 4UUJA 1CD1A 3DNKA 1MF2H 3B3DA 1KLUB 3HA1A 1WGVA 4H9VA 5JLZB 1JV2A 5IB3A 4P5UA 1WS8A 1PCWA 3O15A 5E00A 5F7HA 3HEIB 4L9YA 2AGJL 2NUTB 4FXJA 4PTUA 1EVTC 3EO0A 3NPSB 4UTWA 1UWEH 3EJRA 1OTUD 4L29A 4MD4B 3CH1A 2ZAIA 1FSKB 3V1PA 2BZDA 1AKJA 3I6SA 2IOOA 5CAYB 3S46A 1GONA 3R0KA 4HPGA 4NUPA 3LVEA 4XODA 2DMKA 1BVKB 3KLQA 3LY0A 2F54B 2WUCL 4YR6A 3M1CA 5DCEA 3C61A 1DUZB 5KW9H 1JPST 4P2YA 4WEUD 2J4GA 1GMIA 3HC4H 4Y16C 2PRHA 2X16A 3PHSA 4UIMA 1QSZA 4MTMA 2IBZY 1DUYA 5F9DC 3NSJA 2JLLA 3O6MH 5AOMA 3O3DB 1NAMH 1RFDL 3UWVA 1AGEB 3WLWC 5GS2D 2R23A 3FK4A 3MJ9L 2CPUA 3KUMA 5MEND 3HC3L 1MFEL 4P23C 3HV8A 4G70B 1PZSA 3HPZA 1F3JA 2ARJA 4IM8A 3D34A 3PZ9A 3EB2A 2ZUYA 2XVLA 3MV7E 2FATL 2Y5QA 5FHBH 4K5OA 1I4FA 4AXNA 3DHJA 3DFPA 2OTWB 3GTXA 3U6XA 3H22A 1RUPH 4PGEA 3I65A 1S7SA 1QWKA 1IO4C 3P30L 1ENUA 4BQ3A 4HWZB 3E74A 2ZWNA 2QUTA 2H32A 5HHXH 4ZFFB 4MTVA 5CGBA 2VKWA 2AV1A 2E09A 1RK1A 2E9GA 3VE7A 1X9RA 4N25A 1E9OA 3VG9C 4PJHB 5KETA 1OG6A 3SCRA 1TE6A 2KHAA 2ODOA 5JHAA 2GJRA 4D9RE 1OC6A 1G7PB 4KKCC 3KTXA 3GSNH 3K80A 3O0RH 1A14L 4PJDF 3WIFA 4KBXA 4PRPD 3CHXA 1D5MB 3OWEA 4F7TB 5DSCB 3MLZL 4H2CA 5JHDA 4KQ0A 3MMEA 3THML 2EDBA 4OJAA 4FQQB 1K5WA 2ITDB 4NJKA 3VFWA 4NWUH 4Z2GA 2CHZA 2Z6IA 1NAL1 4ONHB 4OU3A 1SXZA 1IZKA 2Q8ZA 2VUOA 4OY9A 4I7WA 2IAMC 1LEIB 4WEBL 4E2DA 1TSRA 4P5TC 4A2DA 1B0WA 1GZPA 3ZDZF 1TJ0A 4KVCL 1FVDB 5KYWA 3EEGA 1GKOA 2ZDSA 4RA0C 2PW1B 2E5BA 1G0XA 4MJ5A 2JNZA 2VMEA 1WVZA 5A43C 4NJGA 3GTHA 5LSMA 1XLIA 4QRSB 2YXGA 4NZUH 4LEOA 5EBLA 4C6NA 4JFWA 3U0WH 3WJJA 3DETC 2GGIA 2ZRVA 2A83A 2DM3A 2OSWA 2KPNA 4DWSD 5J11C 2X3CA 3VFSA 4BSWA 1RA0A 3WMLA 4HZ6A 5J13B 1DO6A 3WIAA 4BCYA 2DSUA 3WFDH 1VACB 2GJXA 1FBIH 2VR5A 1BYBA 1UURA 2R4SL 4LBEB 5HGBA 3QQ9D 4URTB 1LT7A 4NSKA 3KYKL 3MA7A 4CNPA 1ZGLA 4N9DA 4MVAA 1R5IA 2O9OA 2Z26A 2YEZB 1ZALA 3CASA 5D32A 3UQNA 2Z28A 3MS8A 1N26A 4KROB 4DP7X 2GITB 1A0QH 1EJ6A 4GYPA 3SDYH 1U8HB 1KXTA 3MJ9A 3ZW3A 3A24A 1ZPTA 1BEYH 3ZLHA 2NMSA 4JO1H 1K5NB 4X7DC 1S46A 3AQZA 1MKFA 4K71C 4N1EA 2ENPA 4HCGA 1Z44A 1F6LL 3HUJE 1K70A 5HHPB 1WC7A 1A8ZA 1X6UA 2YC1A 4LCYA 3KL5A 3LKRB 3UBPC 1ZL1A 4DKDC 5DC0A 3SE4A 3ISWA 5CSZA 3STPA 4MHHG 1GHSA 3S3CB 4AL8L 4QG9A 5KSWA 1AHKA 5BQ7A 3MQIA 2L4OA 1YLBB 4BKLA 3GG1A 4NQ1A 2BIIA 2WBJB 1ZLUK 2VDNL 5CZSA 4NQSB 3GBLA 2WJEA 1X6NA 3ARBA 5IM7A 3PS7A 2I14A 1TYRA 5DEGA 1RZ7H 4MCYA 4NI3A 4ZZKA 3WIIL 2OQYA 5E4EB 5TPWH 5L9FA 1SVDA 4CSTA 4ODUA 4GZIA 4KEMA 1VGEL 5C0AD 1LO3L 3NA9H 2X7WA 1SSDA 3BLLA 5KG9A 4J8RA 4TLKA 2NY0D 3WSQH 4QHMA 1XYLA 1IM3A 5BS0B 5CSUA 2Q6WA 4XBPA 1EFQA 4DZ8B 1ZHNA 1CDHA 4Z0XB 4EXQA 2XKUA 3FRUB 3DC0A 3LKPB 3VXSD 3UF9A 1EGZA 2WZ5A 4L64A 4RW5A 4MPQA 3WDQA 4JKKA 3L2LA 3N15A 1OGPA 1O7AA 5DVPA 5I0VA 3IDXL 3II2A 4J1UB 4KK8C 5E6RB 1GJWA 4N2CA 1MRCL 4Z7QE 2B3RA 2W6RA 5T3ZD 4ZW3A 3F7YA 4NZRL 5KITA 4FXFA 3T4AB 3EMZA 4CKQA 4OJFH 5L2KB 2QUNA 4GACA 2EVJA 3LD8B 1NFAA 2VXSH 2IH3A 5AHIA 2DQTL 1TJPA 2FDBP 5FAGA 5DCBA 1TJGL 3K6IA 2CDEB 3R18A 1X7IA 4P4KC 2Y5EA 1TWZA 4MAUL 2OCJA 4FLSA 2XN2A 3C4UA 4S0TD 4Z95H 3V5KB 5L7XH 4AWEA 3JYBA 1YEEL 5JHDE 2Y61A 2J8HA 3CN3A 3V5DB 3RBSA 1NIUA 4PJ5B 4JN6A 3MACH 4PRDA 3SKNB 2NX5D 4LUSB 2DZBA 1LQAA 4R0LB 2OMZB 2DEYX 1R9XA 2IBZX 3JZYA 4V1DB 3LEYL 4LS1A 1CDCA 7A3HA 4RUBA 2R0LL 2P45B 4PV9A 2DQEL 5HGGS 2BOLA 3IE9A 4WV1C 3WUEA 3MJ6A 4FKEA 5CMAB 2VLRB 2IPGA 3CK0L 1MWAL 2QVNA 3DTXB 4Z0BH 3WDRA 3ECWA 4RWYH 3Q45A 3SQMA 1TQBC 5T3XD 3L3HB 1QX1A 4JEQA 4LSSH 4JM4L 3GSXA 1A1NA 1AJ7H 1UEMA 1FYTB 2VEGA 2FECL 3LYRA 4YHYC 3DUUB 4MG4A 4NO5A 1EWHA 3R94A 3A3WA 5I8CA 5D1QA 2A79A 4TNWK 4QHLA 4DP4X 3AO0A 3PZTA 3WLJA 4O2EB 4Q6XA 4FFYH 3WF1A 3HB3D 4WFED 2Y0SA 4XV0A 3FBQA 1OTTD 3K4ZA 3TYCA 5AVUB 3PP3K 4NDMA 1FKWA 4FX5A 3E6HB 2Z4GA 5ESVB 1F4WH 1HXYB 5IIEB 2YDAA 4IIDA 5JQHC 1NFBA 1LEKA 1GAFH 3FUKA 3QPXH 3LXUX 4NUQA 1S5MA 5F0JB 3PSVA 5FA3B 2EYTA 4JPQA 1RZGA 1BAGA 1SYSA 2WCSA 3TEYA 2IOMA 4K94C 1OAXH 4HS3A 4LDLB 2WYTA 2EPMX 5DY2A 4D9QD 5AG9A 1A65A 4AJ0A 3O07A 4POZC 5JW3H 3BV7A 4YCOA 5C6PB 3ECVA 3EX3A 3RWIA 4P8XA 3B2VL 4D8AA 1AHWC 2NY6B 2F2HA 5HVGB 5AB9A 4FMVA 2KERA 1U8CB 2ZOLB 4EP8C 4PJ8C 4BV1A 1Q72H 4KIEA 5GRUL 1AO7B 4IKLA 4IMAA 2R2EA 3AXIA 2CKSA 5DMIL 5FOOA 4L1DA 4I6KA 3G77A 4U1HA 2ED6A 3NIFF 4WFGD 1MCBA 3PGFH 4XKYA 3ZWSA 4FOKA 1ZHLB 4JB9L 2X2JA 3DI0A 3O41B 1DVFC 3A67L 5A2JH 1T83A 1KCVH 4Y2NA 3OAYH 4LQ1A 4ZB0A 2XFWA 5CJQH 3M7SA 4DFIA 2FR4B 3HRZB 1GOWA 3I3BA 3RLVA 3L5XH 4KH2A 4AX3A 4PBVC 3VH8G 5ITBL 1T03L 3FFCB 1UYQA 1C5BL 5C0JB 1MJJA 2X10A 3R0DA 5GGRA 1I8JA 1YSOA 3ILDA 3E6EA 3DGGB 2Z8VC 3NQ6A 3HZKB 1H2JA 3C0LA 5C3IA 4NNPL 1WWBX 1NVMA 2QS8A 2FUTA 4F7EB 3TNNB 4U4IA 2HMID 1FIGH 2D7PA 3Q1SL 3VXNA 4PW9A 1CFMA 3FTZA 3GXDA 1GJPA 2PPEA 3H2EA 3DFHA 4BHUA 2WHJA 1PHQA 4O58H 1MWAA 4XP4H 1F3RB 3N9KA 4IIGA 5EN3A 3NQCA 1VBJA 4L4VD 4G8IA 4RAVB 5JIIA 5KBDA 3TEVA 5B1BB 4ZK8A 4CVZA 2LFGA 2AC0A 4L1XA 1P4UA 3SSGA 1OX6A 4JLRA 5LCVA 1I8AA 1MDRA 3DVIA 3IJIA 4H26A 4ZXBD 2C1PB 5L4FA 4JDZB 1ZS8B 2YA0A 1A3QA 3ME0A 3IS0X 2CUIA 3EJQA 4HFWA 1X7SA 4OF7A 2HN7B 2AERT 1HQ4A 4WI3A 4MZ1A 5I17B