3CTTA

Crystal complex of n-terminal human maltase-glucoamylase with casuarine
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
862
Chain Sequence
b'VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase
publication title Total syntheses of casuarine and its 6-O-alpha-glucoside: complementary inhibition towards glycoside hydrolases of the GH31 and GH37 families
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 274
structure length 862
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3cttA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cttA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3cttA01
4JHZA 1XSIA 3IJ8A 1K9TA 2D1ZA 1HP4A 1O7AA 4BQ4A 4P8XA 4ACYA 3BVWA 4ZFMA 1R34A 4GO9A 2EPLX 3VIMA 4DUXA 5EMYA 4PUEA 1OT2A 4J3VA 4W85A 4BQ3A 1GONA 5BWFA 1JAKA 2ZX5A 1SZNA 4WLCA 3IGUA 1UD3A 1CZ1A 1CGYA 3CUIA 3WUFA 1GOWA 1OD8A 1E55A 3UESA 2OSWA 1E4IA 4CN6A 4MAZA 5BXSA 5BYWA 1PBGA 3S2CA 3WIJA 5BXRA 4PMNA 1BVNP 4GO8A 3BC9A 3BAWA 1TR1A 3N9KA 5TD4A 3SUUA 8CGTA 4WSJA 1X6NA 1XV8A 4KGJA 5A2CA 2WZEA 5DEZA 3AIBA 4H8UA 1RH9A 2XN0A 1KBBA 5E09A 7A3HA 4JFWA 1WP6A 2WVSA 3ZM8A 2W67A 1BGAA 2EO7A 1CGWA 4AZCA 1CGVA 1NARA 1MVYA 3UEQA 1GHSA 5DT5A 4Z2LA 1FA2A 2WXDM 5M03A 4WKHA 3D4ZA 4M1RA 1FFQA 3WNOA 2WM0A 3ARTA 1VAHA 4DM2A 1R7AA 3EMZA 1V3IA 1W3KA 2J7CA 5HNNA 4QAWA 5IFPA 4OZOA 4ACZB 1ITCA 3SCUA 2Y5EA 1C3FA 1QPKA 2QV4A 2D20A 3DYOA 4J3XA 1GJUA 3MS8A 3CLWA 5I23A 2PWEA 1U2YA 4JFSA 1HKIA 1GJWA 1BYDA 4OUEA 1UR1A 1FFRA 2Y8KA 4JFTA 4MTVA 3GZAA 3PZVA 2W66A 3AIEA 1B3XA 2VZOA 5FL1A 3WQWA 2WWCA 4CCEA 3UG4A 5FIPA 4B3LA 2JF6A 3SCVA 1LJYA 4CD4A 1R85A 4X0VA 1QVBA 5HPOA 3VIOA 3G6LA 3TV8A 3QOKA 4LX4A 4ZE5A 4WJXA 3BSHA 4MNLA 2W4XA 3CZGA 1Y7VA 2WBGA 1IZKA 4C7DA 2BVDA 1B3ZA 3T2QA 2YIHA 3WNMA 4MDOA 3OLGA 2J8GA 2BXZA 1GOKA 1VB9A 1WAWA 2G3JA 1OGGA 4ATLA 3AS0A 4MNMA 4PRWA 4MDPA 1CGUA 4S3KA 3SCTA 1H1NA 2VX7A 2D0GA 4AZ5A 1DWHM 3WEZA 3AS2A 3DX4A 1ISVA 3ZSSA 4M81A 4OJYA 3WMSA 2ZICA 2UY4A 1HI7A 2BHZA 2ZIDA 2XVGA 1EHNA 4ATDA 4ZENA 5ABHA 1WE5A 2WMIB 3EJTA 1TVPA 1H49A 2PC8A 4W87A 1XH0A 4KWUA 5CQ1A 5A6MA 1JYWA 2QMJA 1EGZA 5EB8A 2EBNA 1TUXA 1PIGA 1PZ2A 3WF2A 2QLYA 3K8KA 5BRQA 1JGIA 4D6IA 3CHDA 1KXTA 2ZUMA 3WD3A 1O6IA 5GNZA 5ECUA 2VZTA 3BAJA 1VFUA 3W82A 1LWJA 2XWDA 1DWIM 1BAGA 3GH4A 4PMRA 5A8OA 2WSPA 2CITA 2WW5A 3FHAA 5GNXA 2W61A 1EQPA 4S3JA 2VVNA 3SCOA 2BY3A 3RM4A 4IPLA 1OWQA 3VIJA 1DP0A 3LPPA 1VEPA 1DWAM 1U30A 1JNDA 3PZMA 1E3XA 1EHAA 3K8LA 2G41A 1BYCA 4W89A 3HG2A 2W62A 4AIUA 3WKZA 1E1EA 2CKRA 2DH2A 5A8QA 3VNZA 5F7UA 3I3BA 3ZJ7A 3RIKA 3GYCA 1BYAA 3VD4A 3TTOA 1DWJM 2O9OA 1WDRA 3MO4A 2G3IA 1E0VA 3RDKA 4PCSA 2WANA 3AQUA 4U5IA 1BSIA 2WZIA 1R86A 2ALWA 1US2A 1X6LA 1H2JA 2DGAA 3NCOA 1E1FA 3VMOA 1EDGA 3TTSA 1E3ZA 3L4XA 3LXBA 2WMHA 1UH4A 3WF0A 1CGTA 4UFIA 4TVDA 2C0HA 3ZR6A 2WKGA 1ZU8A 4D6CA 1J9YA 1CLVA 5CJ5A 1K6AA 1OIMA 1G1YA 3K8MA 2E8YA 5AC5A 4AD5A 2V3DA 1JDAA 5A6BD 1UKOA 1HJUA 3B9AA 2YDQA 4KH2A 3GNRA 1GW1A 1TA3B 4TVUA 5EBAA 4AZBA 4CD5A 2ZWYA 5IDIA 4Z2IA 4AMXA 3LPOA 1EA9C 1V3LA 2CBJA 4D1JA 1MQPA 1F4HA 3WD1A 3D51A 1B3YA 3CPUA 1VFOA 2UY2A 2ZUSA 2E8ZA 2W63A 1I75A 3GXPA 1MWOA 4UOZA 3VILA 4D6FA 3W6LA 4DWSA 2VNCA 2FH8A 3GNPA 4B9YA 2F7PA 3BCDA 4HMEA 3GM8A 3ARXA 1WZAA 4DO6A 5E6ZA 1QNOA 1UKPA 1UWSA 2V5CA 1M03A 1BGGA 3WL0A 4AMCA 4D6EA 2E9BA 1FH7A 5AYBA 8A3HA 2EPMX 5CLTA 1JZ3A 4RE4A 1QHOA 3AICA 3N17A 4NF7A 2Y2WA 3CZJA 3VD3A 1NWUA 3ARSA 2W5FA 2V38A 3VGDA 1E9TA 3AZTA 3N18A 4JL1A 2A3CA 1KTCA 2O92A 3N15A 2FGLA 4B15A 2GUYA 5BCAA 1OGSA 1KXVA 2DSVA 1HKJA 1JIBA 2D0FA 1GOIA 4L4OA 2F1BA 1UYQA 3UR8A 1V6VA 1OM0A 3GXDA 1BPLB 1G01A 1HJXA 4CUCA 4XZBA 4B16A 1E0XA 3BAKA 3HG3A 3TTYA 4UFLA 1SR0A 1NOFA 3NSMA 3VINA 4MPKA 1FHDA 3WEOA 3CBWA 1WDQA 1R47A 4FMVA 2QPUA 3MKKA 4JHOA 1Q6DA 4FLSA 2EAEA 4A3YA 1TG7A 1D3CA 4HMDA 3MI6A 4PSPA 2Y4SA 2DIEA 3IANA 5E1QA 3IJ7A 2BFGA 2VCAA 2E40A 1GQKA 4HMCA 2D0HA 1J0KA 3EBVA 1C8QA 1W9BM 4WKAA 4UQDA 3II1A 5E0FA 1E73M 4W93A 1QBAA 2WCGA 2BVYA 4XUYA 2IXVA 1E6SM 1UR4A 4AZCB 1TQTA 1XC6A 2FHCA 4GQRA 1E4LA 1GVYA 2YLAA 1CXIA 1GORA 3TA9A 1CLXA 1E72M 4TTGA 1CXHA 1V0LA 3LMYA 2VX6A 2OW7A 2CNCA 3K4AA 2WMFA 3ARYA 3W24A 4RL3A 1WCGA 4QDMA 3WBEA 4FNRA 4EK7A 4CKQA 4MB4A 2VURA 4AIEA 5LA0A 4HOZA 3SUTA 3MUAA 3BAXA 1MXGA 3VD7A 3WQ5A 1QX1A 2AMGA 3HU7A 1UHVA 3WF3A 3CZLA 5M3WA 3M6DA 4AD2A 3HG5A 4CU7A 2YL5A 4PMUA 4V27A 3H55A 2HISA 2WHJA 3AISA 4U3AA 3EJSA 3UR7A 1C8XA 2FH6A 1OGBA 5D9PA 4AEEA 1CXEA 1QNPA 3VDBA 4DWSC 3VD9A 1CGXA 4YPJA 4ZE4A 1NH6A 3CZEA 1W9UA 1V6YA 4JCLA 1HL9A 4B9ZA 4BZYA 2G3MA 4PTWA 2XG9A 3OBAA 3AMLA 3DDGA 1MW0A 1RP9A 3ZJ8A 3WQ8A 4FNUA 4AW7A 1BTCA 1UR9A 3ARZA 4AD0A 5C71A 2D23A 3CV5A 2G3NA 3N11A 1KCLA 2VI0A 5I0DA 3LXCA 4CU6A 1IT0A 1H09A 1J10A 5D9NA 1ZBKA 3ZT5A 1PX8A 1YHTA 2XFYA 5D8WA 3BVXA 1MW3A 4FLRA 1S46A 4GKLA 1G0CA 5E9AA 5CGTA 1NWTA 1EIBA 4TX6A 4J7RA 3W38A 2A3HA 2V3GA 2O9TA 1J01A 1FP9A 4W8BA 3AHZA 3FW6A 1W3HA 1FP8A 3F4VA 2DQXA 4OBSA 4TXEA 4HU8A 4P7QA 3K46A 2YJQA 2GVYA 1I1WA 1HNYA 2EPKX 1UR2A 2VL4A 3WNLA 1W3JA 3WH6A 1W9VA 1ODUA 3M46A 2UY5A 3CIVA 4XX6A 4UOJA 4AZGA 5FD0A 1E56A 2PWFA 1LL4A 2OSXA 2J7EA 2VCBA 4MAVA 4AC1X 3B9EA 1O7DC 3SCPA 1XD0A 3RO8A 1NWSA 1A3HA 2F7QA 2DSUA 3TOPA 4NI3A 5I3DA 2WC4A 4QFUA 1H4PA 2X8RA 2J74A 1H41A 1V6UA 2WMKA 5KEZA 1JG9A 2X0YA 3AHXA 3VDAA 3GBEA 3PN8A 5CPTA 1E6ZA 7TAAA 3NUKA 3WY3A 2BXYA 1OD0A 2Z1KA 3RILA 3HJEA 5DMYA 3QOMA 3WH5A 4R27A 5AC4A 2XM1A 4PMVA 5CPSA 2X09A 4FK9A 2VTFA 3OG2A 4FNSA 5BRPA 3QR3A 2J62A 4W5ZA 3T2OA 5C8BB 1JF5A 2VR5A 1HVQA 3L4VA 4DUVA 2F61A 3NDYA 4W7UA 3LPFA 4MNKA 2HVMA 4Z2KA 4TTUA 3OZPA 3EDKA 4P8VA 2IUZA 3F5KA 3NSXA 3BH4A 4UQEA 1CTNA 1OINA 3ZT6A 2A3AA 4HPHA 1QI3A 2E9LA 3U7VA 2XWEA 3WQ4A 1V3KA 2FYVA 1KB3A 2DT2A 2ZUNA 1LLOA 1UH2A 3JUGA 3SUWA 2QF8A 1AMYA 2XFFA 4MADA 2JIWA 2GJRA 3VIPA 1JAEA 2Z1SA 4W88A 2X1IA 3FAXA 4IPNB 4DWSB 2ZX7A 3OZOA 2FGZA 1GNXA 4P7NA 4PBGA 4U3CA 1XH1A 4H8HA 3DHUA 4TUFA 1C91A 2PSPA 3QHNA 3VUPA 4YHGA 1V02A 2WHMA 1NOUA 3WDRA 3SCNA 1EDQA 2CBUA 3T0BA 4MJ4A 1QWUA 5A2AA 5HOSA 4PMYA 3AHYA 2ZUTA 3EJRA 1QNQA 3A22A 4TOQA 1V02E 3KE0A 5A6BA 1JZ8A 1B0IA 3GXTA 4AISA 3B8SA 1M01A 3LPGA 2BHYA 1GOMA 3WEMA 2WLYA 4PMOA 2D73A 4UZSA 1LL7A 3ARWA 2CHOA 4WIWA 2GK1A 3AMCA 3NDZA 1KCKA 3GXMA 3W29A 1TMQA 2DDXA 5HPCA 2ZOXA 4MNJA 4OBRA 1AVAA 4HP5A 2EEXA 2VO5A 3WF4A 3EDEA 1UWRA 3QHOA 3SCRA 3WDPP 3A3HA 1XRVA 3BUPA 1LQ0A 1J0HA 4JCMA 3AIVA 3VGFA 3IK2A 3WMBA 1KGXA 1JF6A 1QWNA 3GH7A 3H54A 3THDA 1GCYA 1OB0A 2X2HA 2VQTA 3CHEA 1K9EA 3T2PA 2FDMA 4CD7A 4DO5A 1W1YA 3KLKA 1WZMA 1CIUA 1W2PA 3CMJA 3TONA 5LA2A 2BY1A 1QW9A 1CDGA 5JBDA 3O2LA 5DF0A 4WK9A 1Q6EA 1W9PA 1V08A 1Q6FA 3EYPA 4LYPA 2ZUVA 2YA1A 4UQ9A 2EJ1A 3NJ3A 4EKJA 1TZ7A 3CZ8A 2VVSA 2ZUWA 3D50A 4PTMA 4JKKA 2VZSA 3EMCA 1LF1A 4UR9A 3A5VA 3VIGA 3VGHA 1QNRA 4UFKA 1FOBA 5ABFA 3OA5A 4FF5A 2WVTA 1AQMA 5M17A 4BCEA 3KZSA 3BSGA 3PBGA 2XSAA 1CXLA 5JIWA 3ZMRA 1M04A 4AXNA 3VX0A 1EQCA 4IUGA 1Q6GA 3VTRA 4TVCA 1WO2A 1V6XA 1VFFA 2D22A 2XVNA 1ZBCA 2DT1A 4K68A 3WH7A 2DT0A 3PZGA 2WHKA 1WB0A 3MV01 4EE9A 4NXKA 4WSKA 1JXJA 3N13A 1UKSA 1PJ9A 3CH9A 1SMDA 1ZJBA 2J79A 4UOQA 1VJSA 5A69A 4C7FA 5DO8A 4JAWA 1ZS2A 4Q22A 2WKLA 4W7WA 1GHRA 1F4AA 3A4AA 1PEZA 5D8ZA 4UFMA 2DIJA 3BUDA 3CUJA 1ZJAA 1WDSA 3W4RA 3ALFA 1ECEA 4UQAA 3UG3A 5EFDA 4GZJA 1TQWA 3B9DA 3D52A 1QI2A 1HXKA 2J7BA 2X2JA 2ZXBA 1UA3A 4KRUA 3UERA 2XN1A 2EADA 3A4WA 3NYDA 3ARUA 2RGLA 2Q8XA 2C8NA 2BS9A 2YA2A 2NSXA 3CTTA 4DM1A 3ZJKA 4RE3A 3BMVA 5LYRA 4QLJA 2D3NA 3WSUA 2VT0A 3RJXA 2GJPA 2X0HA 2FHFA 2CYGA 3WMCA 4M8UA 1UWIA 2VZUA 4ACZA 2AOSA 4PUDA 2JIEA 5HDRA 2WHLA 3A4XA 2IXUA 1QHZA 3VIIA 3AOFA 3WNKA 3MMUA 1UD8A 1KQYA 1KGWA 4PMDA 4W7VA 5JUVA 4NRSA 4ATWA 1TVNA 4M24A 2XYLA 4LQ1A 1PX3A 4BF7A 2YL9A 1UD5A 4J28A 1E4NA 4F9DA 4BS0A 3VM7A 4AD1A 1W3LA 1JZ6A 1CPUA 2VQUA 3DX3A 1WPCA 4UNIA 3RM8A 3SURA 1QI5A 3FY1A 4AWEA 3THCA 2CIPA 2X05A 1VBRA 4ML4A 1ITXA 1E5NA 3AXIA 3GH5A 3SIMA 2XFRA 3POCA 3D5HA 2BY2A 3A24A 4DO4A 4P7LA 1OT1A 3CHFA 3L2LA 3AYRA 2VRJA 3W28A 1HT6A 1HL8A 3AYSA 2VJXA 1TQVA 2A3BA 5D9MA 1K9DA 5A2BA 3WD2A 5IHRA 3AZSA 5HBFA 1UQYA 2VCCA 1OSEA 1PPIA 3PTKA 3W37A 2EABA 1HJVA 2QHAA 1HVXA 1KXQA 3D3AA 1ISXA 5KZ6A 3WENA 5A6LA 2E0PA 2J4GA 4MB5A 3PZ9A 1ESWA 4N42A 1V3HA 1J0JA 2WMIA 2F18A 1QOXA 3U7BA 1DWGM 2PWGA 4CCCA 2ZXAA 1UD6A 4GINA 3WUGA 4URIA 2VRKA 4B3KA 3H53A 4PTVA 1FHLA 5A8NA 1UKTA 1A47A 4HOWA 1JXKA 3RJYA 3EMQA 2WBKA 3WFZA 2F7RA 1LG1A 2UY3A 3AIWA 1TFVA 3G6MA 1PS2A 1SYTA 1CWYA 5A6AA 4C7GA 1E6NA 1HTYA 1J11A 1CNVA 4NRRA 4NX0A 1B90A 2X2YA 4AYGA 1E71M 3W53A 1W32A 3IAQA 1OCQA 2WC7A 1KFWA 3N04A 1B1YA 4PYSA 1VENA 2OWWA 2OWXA 4LYQA 4D6HA 2RGMA 3HMCA 1V3JA 2CERA 4HZ6A 4D72A 3ECQA 2XVPA 4ZEPA 1VJZA 5IFTA 2W92A 1DWFM 4FNTA 4FNQA 4HA4A 3VGBA 1ISZA 1IZJA 5CXPA 2VRQA 2NT0A 1JNEA 1L0PA 1MQRA 4HU0A 1VRXA 4AD3A 4CVUA 3AI0A 4HPGA 2YL6A 1FH9A 2GDUA 3LRMA 3VNYA 3DC0A 1E6QM 4FLQA 3PHAA 2WNWA 2WYSA 3F5LA 4W5UA 3BVUA 3KEHA 2YFNA 3GDBA 2XM2A 2JE8A 3ZOAA 2FHBA 1D2KA 2DSZA 3RPMA 3K1DA 3PTMA 3SEPA 5FL0A 1ISYA 3CUGA 1VBUA 2JFEX 2XPKA 2J75A 4CD6A 5JBFA 1PCPA 5CSYA 1UQZA 2GK1B 1HKMA 3BMWA 2XVLA 3MSGA 2WVUA 3IJ9A 1RP8A 1CECA 3S6TA 2YOCA 3VM5A 1E15A 2XN2A 2PI6A 3BXWA 4AD4A 3VU2A 3LXAA 4NZFA 1K9FA 1TA3A 1BG4A 1G9HA 3EDFA 1CYGA 5DT7A 3CUFA 2XUCA 5C70A 3WD0A 4U31A 2OYLA 5CGMA 1EO5A 2F1AA 3MUY1 1WZLA 6TAAA 1JZ2A 1CXKA 1MW1A 4Q7NA 1L8NA 3SUSA 3BLKA 4LPCA 1NOWA 2PB1A 4H41A 2V3FA 3DYPA 3UETA 1HP5A 3VSUA 3OB8A 3VSVA 3S5YA 4UFJA 5BXPA 3TP4A 2XTKA 2OSYA 4MB1A 4UTFA 2VR4A 1JYNA 1JYVA 3WY2A 3MUZ1 3U5YA 3RMEA 1MFVA 5A6SA 5E70A 1LG2A 3NIYA 2XHYA 1UWUA 3WY4A 1CENA 2WCAA 6CGTA 1Q4NX 3VO0A 1W91A 3CZNA 1T0OA 3DYMA 1BVZA 4EANA 1JZ5A 5ABFB 2ZX6A 2PBOA 2Y8VA 3MMWA 3FAWA 3OGRA 3W0KA 1WNOA 5FCZA 4P8WA 4W8AA 1LL6A 3CMGA 3QGVA 4WF7A 3GTNA 3A21A 2EPNA 2ZX8A 2WWDA 2JF7A 2V3EA 3W6MA 2C7FA 1QNSA 4XV0A 2WVVA 2J77A 4AYSA 5A8PA 2W91A 4UCFA 3O6AA 2WLZA 1GOOA 1NP2A 3OLIA 1V0KA 5BROA 5D9OA 3DX1A 2VMFA 3L4YA 1I1XA 3SCWA 3VD5A 3OLEA 1E40A 2DSWA 1BF2A 2OYKA 1DTUA 4KGLA 1P6WA 4AEFA 4HZ7A 4Y7EA 3VSTA 2CBVA 4F79A 1C92A 1W9DM 2ZXDA 2ZE0A 4NZJA 3WF1A 1EDTA 1HJSA 4R5EA 1UWQA 4GI6A 4XZWA 1GQIA 3ZR5A 4PCTA 4AZ7A 3WNPA 9CGTA 1EH9A 1QI4A 1EXPA 3WFLA 3T09A 3WELA 3PZUA 1EO7A 3POHA 3T0AA 2JEQA 3A23A 3AROA 3I3EA 3FNDA 1V03A 3OGSA 4QLKA 3AIRA 2F7OA 4GXPA 1XYZA 2PF0A 1MXDA 2TAAA 4U5KA 1QHPA 5JIPA 4P7OA 1MYRA 1SFSA 1UR8A 2G8ZA 1KGUA 1UZ1A 5AYIA 5FKYA 1RPKA 2BV9A 1VEMA 2CHNA 4E4PA 1N82A 2WPGA 3VIKA 4W84A 3AS3A 3AZRA 1UD4A 1JI1A 1BYBA 2GJXA 3ZIZA 3CZKA 3EDJA 1G5AA 4PEEA 3AXHA 3AIQA 4PN2A 3PZQA 4OOUA 3EJPA 3L2MA 3VOCA 4D1IA 1B2YA 2J8FA 2QMKA 4N0RA 2J47A 4QCFA 2D24A 4F9JA 1WZKA 3WQ6A 2OYMA 3GXIA 3VMPA 1Q6CA 5DFAA 2ZUUA 4OIFA 2F8QA 1QBBA 1HWWA 3ZO9A 4CN1A 2E3ZA 1JFHA 2EACA 3NSNA 3AXXA 2IGTA 2WCSA 2J7FA 3KL0A 3SUVA 3WUEA 1GQJA 4KMQA 3BGAA 5JBEA 3OIHA 2DH3A 4CU8A 3VDHA 2D3LA 4E8DA 5A1AA 3WQVA 3F5JA 1BG9A 2GSJA 2CXGA 1XSJA 3MU7A 1G94A 1B3VA 3CZSA 2YBTA 4IM4A 5GPRA 1W1VA 3A47A 1XSKA 1IV8A 1UH3A 3WH8A 1XHGA 1GVIA 3WDIA 7CGTA 1ODZA 3LRKA 3CUHA 4PMZA 2BY0A 1HJQA 1HXJA 3GBDA 3OLDA 1KXHA 1M53A 2VZVA 3AS1A 1V0MA 1HKKA 4A3HA 2D2OA 1E6RA 2CESA 1H0GA 4PMQA 5GQBA 3SCQA 4DUWA 2YKKA 1E6XM 2YLLA 4D6JA 5A8MA 4CCDA 3WUBA 1J18A 2ESCA 1UG6A 5A6KA 4HA1A 1M7XA 1US3A 2OW6A 4TX8A 3VIFA 1PS3A 4BQ2A 2G4FA 1PSPA 4CD8A 3IAPA 3WDJA 2WZHA 5IXEA 1KWKA 1ZL1A 2DSKA 4QCEA 1DHKA 2WAGA 1CBGA 1JDCA 3GXNA 1PZ3A 2DT3A 3A6OA 2CCRA 4M80A 4OGZA 1TE1A 2VX4A 2GDVA 4MJ2A 4AIOA 1GOQA 2OWCA 4W86A 3N12A 3AMDA 2UWFA 4LGXA 2XSBA 2XIIA 6A3HA 3BAYA 3PZNA 1JZ7A 1XGZA 3AHVA 2FE0A 4Z2JA 1AQ0A 3PTQA 5GNYA 1E43A 1J0IA 2A3EA 3DECA 2F2HA 4OKDA 1XCWA 3CO4A 3MSDA 3AHTA 4X0NA 5E6YA 5EFFA 2Y24A 3RCNA 1KQZA 4FLOA 2J25A 1UA7A 3GXFA 2VUYA 3DDFA 4J3WA 2WK2A 2PBGA 4HA3A 3MMDA 2MANA 2V5DA 3W26A 2CKSA 3FXYA 5AY7A 3BLBA 4AY1A 2VOTA 2NW0A 4D71A 3GNOA 4YN5A 1UASA 3WN6A 4D6GA 5CZKA 1U33A 3AMGA 4M29A 2JALA 3APGA 1H0IA 4H2CA 4ZXOA 1EOKA 1E9LA 1JYXA 1E5JA 4BA0A 4E8CA 3ALGA 3ZSTA 4W8LA 4HZ8A 1KR0A 4F66A 5A3HA 4J27A 1B31A 4IISA 5M5DA 3ZQ9A 5A6JA 1TQUA 1NQ6A 1R33A 4E2OA 1UR0A 3W81A 4GI8A 4P7RA 3TTQA 5CSUA 2WB5A 5CG0A 3EDDA 4Z2GA 4AMWA 2BHUA 3UCQA 1UUQA 3N1AA 5ABEA 4XB3A 5I5RA 1PE31 1KR1A 4M82A 3T0DA 1CEOA 4V2XA 2WC3A 1NM9A 1YQ2A 3VX1A 2XVKA 3MANA 4YHEA 3BUIA 4J3SA 3S5ZA 1JI2A 1JD7A 4JIEA 3PZOA 3O9NA 1R8LA 3BCFA 1CXFA 4L4PA 3VDCA 1NWRA 2OLHA 1JZ4A 4UQBA 4GPNA 1VFMA 3VGGA 2WMJA 2VC9A 1R87A 2J7GA 1WKYA 4GZEA 3OGVA 4UQCA 1KBKA 3K4DA 2YL8A 1BHGA 4AZ6A 3ARVA 5LA1A 3D4YA 1OIFA 1TCMA 3SCSA 4JKMA 1J0YA 2PWHA 3EJQA 5FOOA 3MUIA 1W1PA 3BVVA 1B30A 2GFTA 4X9YA 4NZCA 4QP0A 4BQ5A 5E0CA 1FH8A 3KWXA 5A95A 4EAMA 1UKQA 5BXTA 1C90A 1JL8A 3W25A 4U33A 1JDDA 3VMNA 4U2ZA 1HIZA 2E4TA 4FNPA 4MB3A 2BVTA 4GIAA 4HTYA 2DPEA 1E4MM 3ARRA 1WDPA 4CN4A 1QW8A 1XYFA 3J7HA 1BFNA 3HN3A 1GPFA 1HF6A 1LWHA 2J7DA 3ZJ6A 4P8UA 5CPQA 4J3UA 5I79A 2WVVB 3AMKA 1XCXA 3PZTA 4J3TA 1R7OA 1V0NA 2E9MA 3WD4A 1BLIA 4JL2A 5I6SA 4U2YA 3ARQA 2DEPA 3L4ZA 3DX2A 1GZJA 4AZIA 1J0ZA 3ZT7A 1ISWA 3WH9A 4JZ5A 4WKFA 1W1TA 1UOKA 1X1NA 2AAAA 2YBUA 2YDRA 3U57A 3HG4A 1ZBWA 1QI0A 2CEQA 1V6WA 2CPUA 1BQCA 3CHCA 1R46A 3MV11 4Z2HA 3AJ7A 1E70M 1W2VA 2EXOA 1B3WA 3WNNA 1RD6A 1ZB5A 1J12A 3ARPA 4PMXA 1KTBA 1R75A 3AIUA 1PAMA 1C7TA 4JKLA 1C7SA 1MFUA 4UZUA 4RE2A 4LXFA 4H8VA 2BNJA 4AZHA 5A94A 2NT1A 1HX0A 2CETA 4UFHA 3LRLA 3WY1A 1UZ4A 1C8YA 2X2IA 2XJ7A 4PTXA 5IHSA 2YFOA 2O9RA 1D7FA 1UD2A 1SMAA 3LX9A 2GJXB 3BUQA 3FN9A 4CVWA 3QHMA 3W27A 3E1F1 4GQQA 1VEOA 4CGTA 4NSBA 3M07A 1HN1A 1PX4A 4QLLA 2EQDA 1MW2A 5I78A 3HZ3A 2QPSA 3BUBA 4DWSD 3DHPA 2ZWZA 5I2UA 1Z32X 5I24A 1KWGA 1H5VA 4M56A 3I3DA 4D6DA 4GZIA 2XGIA 2EPOA 3L4TA 1NP0A 4GI9A 3BLPX 2PWDA 4F8XA 1VIWA 1PIFA 1JD9A 2YA0A 1EOMA 2ZXQA 3PZIA 4HOXA 1ZBVA 2XIBA 1OBAA 1TQSA 2ZX9A 4ZXLA 5CLWA 2O9PA 3BAIA 5I77A 1H11A 3UG5A 4LYRA 3DX0A 3VKKA 2J78A 1XD1A 1W9XA 1B9ZA 2B31A 3RM9A 3L4WA 1C93A 2VX5A 5ABGA 5D4YA 4KRTA 3VPLA 1E0WA 1GQLA 2WSKA 3WL1A 4A4AA 2XGBA 3WDHA 1H3GA 4V28A 4H7VA 4JFUA 3KL5A 4NXSA 1AQHA 4H04A 3CGTA 1UWTA 1V3MA 1MQQA 2YDSA 1DEDA 3U5UA 3BVTA 3VGEA 5HXMA 2J7HA 1E6PA 3T08A 1HJWA 4JFVA 1GUVA 2CBIA 3VVGA 3KLLA 4PSRA 1VF8A 3WBAA 3FHQA 3M7SA 3WDQA 1JFXA 3AFBA 1XH2A 3CC1A 3L4UA 3VIHA 3KL3A 2JEPA 4OOZA 3EJUA 2WMGA
chains in the Genus database with same CATH superfamily
4GIYA 1CI3M 3SKNA 3DG6A 1U21A 4PJGB 5KYXB 3G1AA 3UVAA 3WJZA 1MUJB 3ZLGA 2ZJSL 5KOMC 4JRYA 4HCRA 3VIMA 5AW6B 2WNKA 2O93L 4AHQA 4JRYE 3V0DA 3O0RL 1GONA 1H50A 4BQ3A 3F58H 5L9DL 2GITB 2QJGA 4R0LC 2Y5JA 4Z95H 4I5XA 1ONWA 4APQB 2Z27A 2Q7YB 3FONA 3B9OA 3VYLA 3P8JA 3O4LA 5LO7A 1NCGA 3BAWA 4XWOC 3P6LA 1I7TA 1ZHKB 3O4LE 4GRMB 2OOGA 1TEGA 5F9WB 2J71A 3UL4A 2YCIX 4TSBL 4ODSH 1XUUA 1XGUB 3JWNC 2ARJQ 3NK4A 4M1RA 2I26N 3ARTA 1OO2A 4GC4A 5C6TH 3UZYA 1TV5A 4IIBA 2QV4A 1GJUA 1N8FA 1IEAB 2OZ4H 4C5ZA 4ORIA 5BW7C 1ZTXH 2QADC 5JHDD 3AIEA 5K39A 4CLMA 4IMAA 5E2JA 1XB8A 4GEJA 2X53A 4QRSA 1OEPA 4B96A 4B4HA 3MODH 2BOCB 3G6LA 1H7OA 2C34A 3GFYA 4JPIB 1Z0MA 4ZE5A 3RGHA 4MNLA 3CDZB 3BXNA 3HIJA 2BVDA 3WNMA 1RULH 3MUHL 1FNAA 2Z29A 4LPYA 1PKQA 4Q8BA 3PL6A 1A7QL 4PRWA 1MCRA 4S3KA 4CNIA 4IGBD 1BF5A 2HJKB 4ALDA 4BKSC 1PKQE 1QQDB 1NM4A 4KZEH 3F84A 1M71B 4PB9L 1B88A 4UTKA 4W87A 1M05A 2QAPA 2YUXA 5DA0B 3LPWA 3V5KB 4ZMPA 1MWAB 2EBNA 4CVZA 2ZSVB 2XY2A 3JR2A 1LOQA 4DPCX 1OAJA 2KT6A 1KTLB 2XQYA 2W0KA 1BAGA 2BVOB 3P2TA 5DMMA 3SE8L 1VFSA 3WXVH 5EDXA 3P54A 2HK1A 2C1OA 5FGCB 4URTB 1XAKA 4ONFL 2VXUL 4DN3L 4AJ0A 5EKYA 3MMEB 3MUJA 4QLRA 3ZJ7A 4F8TA 5DK0B 1BYAA 1IEWA 5JPNC 2DWSA 4UAHA 1G9ML 2WQWA 4F5CA 2V37A 2VFIA 2J44A 4HU2A 2DGAA 2Y3NA 2F0CA 5HDBB 2WMHA 5F1OB 4F5CE 4CILA 3NTCL 3QIWB 4DEFA 1G1YA 5AVSB 2JJSA 2ZZ7A 5GRVL 4XAFA 5F2FA 3LHPH 1VGAA 2ZG3A 4ZTXA 3DIVA 4HC1L 4HCLA 4E9SA 4KH2A 3W9EA 5E93A 4AV5A 1TTUA 4U1GB 1F3JB 1V3LA 4E3TA 1NQKA 3KOWA 2DQEH 4JDTL 3QCUH 1FWGC 5BS0A 1S5TA 4D6FA 3NQBA 4LOEA 1M6UA 4RNJA 2VR9A 1JGUL 2OX4A 1LO3H 5BS0E 3QEHA 4DO6A 4OZHA 1UKPA 1N2VA 1BQ5A 2HK0A 3TNMB 2L7JA 5FJUA 4OZHE 1UG9A 3CASA 3M5XA 1FNGA 3NT0A 2EXWC 4JFDB 3JVGC 3HVDA 2ZUQC 2GUUA 1CK0L 3STBA 3UBXI 1FA4A 1GOIA 4X9IA 5T1KD 4XC3L 4J9JA 2AANA 1NLBL 4BEUA 1VSCA 4B16A 3BAKA 3TU6A 3MJMA 2IDUA 4GVIA 5AW2B 5HR6A 4NZ5A 3VRIB 4UIMA 1XDTT 1MOEA 4HK6A 3BGFC 4WUIA 3GIZL 2K45A 3NR0A 4EF3A 3WO4C 1W9BM 3OJVC 2Z3FA 1E73M 2VD8A 4UQ3A 3KGTA 1AP2B 1GTEA 4JNYA 3LSBA 3KW7A 3THQA 2VXVH 1CXIA 4FZEH 1Z9PA 3FVMA 4DQOH 2Q8AL 3DXAB 1DQVA 2YPLD 4GRSA 3ZL2A 3L45A 4QE4A 2LVCA 4AIEA 3U7WL 3O9WC 3RCYA 4EUPB 1KNOA 3UMTA 3CFUA 3O8XB 3U48A 1BV8A 3BZFA 4ZFCA 4BKNA 3UR7A 1E6OH 2A0LD 3S42A 4X9SA 2WXOA 3R8GA 1Q2RA 5IW6A 4US5A 3DJTA 3CDYA 3IFPA 1UBPC 4X6BA 3VFTA 8FABB 3AADB 4H00A 3ARZA 1JRCA 4F91B 2R15A 4KV5F 1I3GL 3FH7A 2UZ9A 1J10A 4HS6B 4LEBA 1G6RA 2XFYA 5D8WA 3VW3L 4KRLB 2ZQ0A 2VAAB 1XIWC 1XICA 4JDVB 1G0CA 2NQHA 5CGTA 3QEUA 2VXTH 5I8EA 3LNIA 2FUQA 1HINH 1GAFL 5I6MA 2DYRB 1N5AA 5K59E 2PWFA 3DFHA 4WV1A 5M7QA 1FVCA 1O7DC 2PAJA 1KBGL 3SCPA 3CUXA 2XI9A 4L0ZA 1EHKB 4I9MA 3GSVB 2IDSA 3CB3A 4QJ3B 3LNDA 4KJPD 5CPTA 1E4WH 3SE3A 3R43A 4H4IA 2Z1KA 3ZL4H 5EZJB 1KB9K 4OV5A 4GXWA 4D0DB 2GCYA 4C56D 1LO2H 2YAHA 1NCTA 4HIQA 4JNZA 2VM9A 2VKZG 1YE4A 4OLYL 1A5KC 1K85A 1NGWB 2QCLA 2B39A 5CZSA 5DMNA 3PAUA 3R8RA 2EDOA 3TJIA 3BH4A 5IJVA 3T6CA 4M7TA 3DBXB 2RGSA 1ZP4A 1TZHB 1AJ0A 4KUCF 5D9SB 1L9QA 2WJFA 5DJZA 2OS7A 3CLEL 1UH2A 3PGCB 2YQ3A 3CFMA 3MPGA 4N8VG 2FYYA 1H61A 1XH1A 1IEBA 3NGBC 3CD4A 3GG8A 2MQGA 1AYRA 1NIEA 5C2BL 4HDIB 4XMPH 3N34A 3KEDA 4MJ4A 2UUDH 2PYEB 2FX8L 3SRDA 4Y5XC 1M01A 2P80A 4B9IA 2C1HA 3NJNA 4NKDA 3GZOA 3TJEH 4DNMA 3HTLX 5I1AB 4JQIL 3GXMA 1TMQA 5HPCA 3EZ8A 4XNBA 3FKRA 5DRCA 4KKLD 1XRVA 1UATA 4OD1L 4JY6B 4KO5A 2QNEA 1E6JL 3SO3C 3NCFB 1DYZA 4Q9RL 4I9WD 1EMTH 5AZUA 2QT6A 1K9EA 5K9KB 2Y7QA 2EAWA 1S9XB 2BP5M 4F3FA 4JZOA 3LNHA 4M1BA 5AVWB 4AU0A 5J11B 3MRNB 1EAOA 5FO8A 3SE6A 3GKAA 3WKQA 3N3MA 2CR3A 2APXA 4N6FA 2X9XA 2QQQA 4F57H 2VVSA 3IPBA 4QNPF 5HI4C 5FWRA 4TUOA 4U0QB 1FCQA 3HMXA 2EECA 1K8CA 1YRRA 5SX4H 1OF6A 1IM9A 4KJYB 4PR5A 1WFOA 2EICA 4IUGA 3FF8A 3QDAA 2ERJC 1EZVX 1PJ9A 3QNYB 1VQTA 1L7TL 5DO8A 4JAWA 1PY0A 3VC5A 1CGSL 4IMDA 1GHRA 2VL5B 3JV4A 4BUQA 1NJ9A 4EOWH 1Z7AA 4BZ2A 1NAKL 4QF1B 2X28A 4G5DA 3N29A 3ZUCA 3OPZH 1L0QA 1KCRH 2R9HC 3B83A 4LMQI 5D7EA 4Q97A 3BMVA 3WE1A 4LSVH 2BWGA 1LK2A 5HYJD 2VT0A 1TF4A 1ZLSL 3WMCA 1B4EA 4LCWB 3DDMA 5L88L 1JUFA 1X7QA 2Z64C 1PS9A 2H7WA 4LVOC 3ZKNC 3CVIH 3RQ3A 3DGBA 1BFTA 5DC9B 4BS0A 1JZ6A 3QDMB 1X5AA 5E9DD 2V2CA 1JCXA 3MRKB 3AXIA 1XQKA 5AOMA 4DO4A 1NAL1 3QZWB 1L5GB 1DVXA 1Z3NA 3SD2A 5D2LB 1FL6B 1I8IB 1TVBB 3A3XA 3AYSA 3NP4A 4Y1AD 1DYSA 4QRRD 3CV6A 1PDZA 5ADOH 2A6NA 1II4E 3EA2A 5CH9A 4J23A 1D6VH 2DQDL 2QHLA 3U1QA 3L9YA 1JNNH 4Z7OF 3IDGB 3Q65A 5EOTA 2ZZ1A 4OVXA 5CPNA 4K71C 1FHVA 1S7XB 1EZUA 3EO1A 4TVPE 2CC0A 4RZ4A 3L54A 4WDUA 1F8MA 2IWFA 4F0RA 2WBKA 4PP2B 1JULA 4P4RA 2I5YH 4AF0A 2OMNA 1Q94A 1IBGH 2VDKB 3FCSB 1XWVA 4DGVL 2OQLA 2OKOA 2PS2A 5JUEH 4O0KA 5TF1H 3IN2A 3SPIA 3CFEA 1NEZA 1U9KA 3GSRB 3UWYA 2FQGA 1KM1A 1E3FA 3BZEB 9PCYA 3RR4A 5AHEA 1D6EB 3QXAB 2ABBA 4AUJA 2GDUA 1N0LA 4OQTL 4GYKA 4FXJA 3HI1B 3O15A 2OT1A 3BVUA 3KEHA 1GPOH 8XIMA 3VQMA 4GUIA 2XA3A 1KBJA 5HMFA 2XPKA 3SI9A 1UMYA 5CSYA 1R6VA 1ILSA 4MS6A 4MMYB 2HFFA 4JN7A 2H32A 5MHSD 4QHRA 5HYQB 5KG9B 2GJ6B 4D9LH 2DMKA 4EXAA 2KL6A 5DRZB 5I76B 4MNGA 1CYGA 3B9KB 1I7ZB 2F9RA 4M7JL 1IL1A 5LJYH 3RKDD 4MNGE 3D8MA 4D2JA 2PB1A 2EXSA 3I9AA 4LEOA 1PHWA 4FS9A 4G8TA 3VSUA 1LDPL 4XAYA 1U3YA 5GS3A 1UYWL 4O4VA 1DVFC 4WRHA 5CZ0A 4JO3L 1QO2A 4O51B 3MV7A 5H2BB 3NZUA 3BO8A 3ANYA 4IMEA 3V5DB 2PPAA 3QIUA 3GO2A 3MV7E 1E9PB 2ICEC 3VRJB 4TQ8A 1TTFA 3BUYA 3L9RA 3GD1C 1TVHB 3UQNA 2QEZA 1F45A 2OFQA 1QNSA 2ALDA 2F7IA 3QEZA 1PY9A 3Q43A 4L6HA 3D3VB 1GOOA 3MTXA 2E6QA 4WI2A 2PLTA 4YTRA 4LUTB 3TV3H 1M3JA 1RK6A 5BZXA 1KYUA 1T6MA 2UY7A 1DO5A 4YXLH 4M1CC 5DD5H 9CGTA 3ROLB 3WELA 2WW8A 3POHA 5HYSG 2MCAA 2C3ZA 5LAXB 5F9AC 3QXDA 3ZDZF 3N4EA 3ARDB 4KAQL 5TE6H 2QVIA 5E1AB 3AS3A 3FPYA 4OGYH 4ZX4A 2X4QB 3W1AA 2ZKMX 1C5CH 4N0RA 5GGSB 2OA9A 2BOBA 5FC9A 5FYKL 3EA1A 5KN5B 4OECA 4RDYA 4CN1A 1S7VB 3FULA 4DIAA 3I65A 5DZVA 4J3OG 1RJYA 3QDGD 3SE9H 3FCTB 3SUVA 3WUEA 4BFFA 4CNOA 2NQJA 5A1AA 1EVTC 4RFNC 1X9UA 4TQIA 3KPMA 2AQ1A 3KYOB 1J5HA 2PF8A 4IBWA 4OAWB 4PMZA 3DOPA 1E27A 1JVKA 3EPNA 2DQHH 1V0MA 1N8ZA 3ME0A 1OHLA 4Y5VB 2P5WB 1WGOA 4OJDH 1EAQA 2L7QA 1MRFH 3BWUF 3RJDA 4TX8A 1V05A 3BESR 3TBSA 2PYFB 4RESB 3IXTA 5GIRB 1RV8A 2LFGA 4YBLC 4W1TA 2WAGA 3GXNA 4PFEA 1I2RA 5CU9A 4Q6KA 3X13B 3HS9A 4KVCH 1A9EB 2Y5TA 4Y4HC 4AIOA 4NQSB 2AK4D 5IB1B 4IS6B 1LT8A 1VC4A 4KS0A 3LDBC 2AJXH 3NIFF 4ZFZB 5T1MB 2A3EA 1WBYB 1RZQA 1G7VA 4MD5A 4LLMA 2WSRA 1ZP3A 1UA7A 4FFZA 4YHNB 1KEMH 3FXYA 3QORC 4Z7NE 3GNOA 4YN5A 1UASA 3INOA 1Z0NA 4XP4L 1FO0H 3TBTB 2VW6A 1IBFA 2VSKB 3BYTA 2GG1A 4BA0A 2XKSA 2X1PA 3W2KA 4L9DA 1CR9L 3BKYH 4MJZA 4X6DB 4GW1B 5AG8A 2DZUA 1KTKE 3KBWA 4EZMA 5CG0A 5C3IA 4LSPL 5CEWA 5FJIA 3UBXG 1NM9A 3MANA 3MUXA 4F20A 2DZPA 4C60A 2NQ3A 5CKAA 3CFNA 3W76A 3LQAC 4FOMA 1X1ZA 3LSOA 3VG9B 1NWRA 2XACC 1F05A 2F8OA 3VXQB 1PSCA 1BHGA 1TCMA 1G7QA 3MNVA 4IGBB 1MFDH 4ZT1A 2NY5L 4NUGL 1LZOA 5TQ0L 3RI5K 3URAA 2ADFL 1HIZA 4XP9L 1GKQA 4TPRH 4BFKA 3REVB 4HTYA 4Z7UA 3I68A 5ITFA 3IS1X 1JPKA 3ARRA 4P5KA 3ZKMD 4KKCD 4Z7UE 3VI3F 3AQXA 4PJFB 4HGMA 4IJRA 3WD4A 2CRMA 3UYRL 1TTGA 3B2VH 4ONVA 3WJMA 1UZ8B 4K2UL 2J4WH 4ZFOL 3MNWA 1X1NA 3HG4A 1M6JA 5FYLD 1HQTA 2HUEA 1FZMA 5J1SC 1EZVY 1FFTB 2NZ9C 1BJ1H 1ETJA 3C8FA 3P5ZA 5EU5A 1SSDA 3KPNA 1C7SA 5GGTH 2VC6A 3KBNA 4BEQA 5A94A 1HX0A 4UFHA 2BW5A 4FP8L 1K5NA 4FKEA 3DFTA 5F1IB 3GLCA 4LVNB 2DQUH 2GBTA 3N2JA 4NSBA 2WBWB 4MNQB 1MW2A 4RGMC 3CCHB 3DHPA 2MSPA 3V35A 4PAZA 3R94A 4JKNA 1EEPA 2O7QA 5MERB 1KGCE 4Z78B 3OKKB 1EOMA 4O2FB 3SZKC 5I1LA 4K5PA 4H8QA 2PZ0A 3RX5A 1EJTC 3CNYA 3QFEA 3GLEA 3OL2A 1H11A 1XCTB 1GVOA 3RMJA 1NEPA 1QR4A 4HT3A 3U46B 1W9XA 4WHBA 3MDWA 5AAWC 5ABGA 4LLQA 3LD5A 4BCZA 2ZQKA 4HWEL 2VM3A 1ACXA 3LNEA 3VXUB 4NO3A 3FT4A 2J1YA 4PLNC 4I8DA 3N42F 4PRNB 5CS7A 4MQ7B 3AFBA 3SDAA 3SDXA 2A9NL 3ZE2E 1I1CA 2X4UB 5C08D 4DUOA 4JFHE 3SDXE 2ACSA 3BVWA 1RBLA 3IIZA 3H1ZA 4ZOBA 3DO4A 4NRYA 3UYOD 1R5IB 5IUSA 1D9KC 4A05A 2CA3A 3GS7A 3SN1A 1SZNA 3T42A 3EOBA 3O81A 3N91A 2ODOA 4BUHA 5BRZB 3GK0A 3CPLA 3DARA 5I30H 5JXAH 3HMWL 3M0MA 4MA3B 1ZVSB 2NW3B 1AUSL 5J6HA 2IH3B 1ACYL 2QSQA 3GHEH 2IKHA 1BVNP 5BPPA 5JXED 5D1ZC 1U8HA 1A7RL 3SDOA 4KGJA 3LDVA 2I9UA 4ZZFA 2J8UB 1EA0A 4W9CC 3U30B 3GMPA 3OG4B 2YPLB 5J1AB 4XNXH 4UI2A 1GHSA 2WXDM 4NQTA 3VJ6B 5I1EL 3WN5C 4W6XB 1MJ7H 5GRYA 4P2VA 5D93B 1V3IA 2G5RA 2YRLA 4TNGA 3MHFA 5CC6A 4UTUA 4Z23A 3GHTA 3ANUA 3F2CA 4NEHB 3RI5F 4FYRA 1HKIA 4KRMB 5IK3A 2FO1A 1FFRA 4H1LA 1IXOA 1AZBA 2ISWA 4HCHA 2IAMA 1BBJA 1EBAA 1HYSD 1FWAC 5JXQA 4LFYA 4A6YA 5ECGA 2TRHA 2H5UA 3JVFC 4HFUL 3VXGA 5LNGA 4C7DA 1ZHNA 2FMNA 3S2LA 2W0FA 3FTGA 4MDOA 3PPGA 1DDTA 3RWHA 4ZR8A 4FOKA 3RDJA 2GUOA 2G3JA 1J5OH 1SMOA 4O8AA 2A79A 4U4MA 4Y8DC 1DBKL 4L8CB 3R1ZA 1VCVA 3D69B 2BHZA 3UTPD 2GJZA 5EF0A 4AKQA 4PS4H 3S0CA 2E76C 1M1XA 4IQEA 5JW5A 4QRBA 2IANA 2QMJA 3T3PF 3B5GA 3MCMA 1XLCA 2FWUA 3IIXA 3N6HA 5BRQA 2PLMA 2IANE 4RWYL 4M6NL 4XIAA 3BH9B 3EGXA 5ECUA 4WGVB 4WVRA 2HT2D 1NUDA 1T7XA 2DQCL 3MRMA 4PGBB 1VFUA 4R0LB 3H4XA 3P77B 2VDNL 2ZE3A 3MSRA 3ZN6A 4R53A 5DURB 4O12A 1TDQA 2EE3A 3IGAA 1NLDH 4PTNA 4Y9FA 4C56B 4RGOL 1VEPA 5GGRY 1RBOB 4E38A 5DXWA 4UT9A 1NBYA 3GSNA 3WD5H 1OCBA 3LN4A 5DFWH 1YNQA 2G3IA 3DC8A 4PCSA 2QLVB 4WJKB 4XN9A 2IWEA 1E1FA 4GRWF 4P4KD 2KLSA 4EPEC 1BZ9B 4MQXD 3WF0A 4BHUA 3ZR6A 4O50A 2HVJA 1MCNA 3T0EC 2H6UA 5BQ7B 3GO1H 1T83C 2IGFL 5CWSA 1UKOA 1RZMA 1DHPA 4BK4A 4NENA 2QADB 1FYTA 1TA3B 3FC8A 1VCAA 3NL3A 5DEGA 2WLNA 1RZFH 1MQPA 1ML0A 1NC4A 1EJXC 4PRIB 1FYTE 1KULA 2UY2A 2BSRB 1RJZB 5CLZA 4JY8A 1JRBA 2YAPA 1UWXK 5IBXA 32C2A 2GBUA 4FNLL 1IAIL 1IGFH 4HBKA 4FTVA 5D1QD 1FC1A 2CDFB 2Z91A 4Q8OA 3WQEA 4XRCB 2BH0A 5CLTA 1NBVL 4O19A 3EG9A 3D85B 4R7LA 4KBPA 3AICA 4FTVE 3GD6A 3VD3A 3QYQA 3F4WA 5FA4B 1JPTL 3IMRA 2A3CA 2O92A 4RH4A 3HG1B 4EDWL 3EYVA 1C5DB 2DSVA 5ECVA 3MRRB 1CUOA 1AZCA 1G7LA 1P7QD 4I3RL 3K2UL 2VO8A 4RRPG 2O61A 3TTYA 4UFLA 3TQPA 4PY7A 3OKEA 3RLVA 1WCBB 1WDQA 3BVJA 5C0CD 5TJWK 1W6LA 4U1HB 3CPGA 4A3YA 3H2OA 4WK4B 1IQDA 2Y4SA 4P48A 4GHRA 4L4LA 3IVKB 2NZ9D 1S3TC 4P9HH 2AXFA 4U1IA 2Y2YA 4JFXA 4XUYA 4NQVA 1GZHC 1JGEA 4AENB 1KJ2A 3RZCD 4AZCB 1F3RB 4IGMA 2A9DA 3TO2B 1R24A 1AE6L 4X50A 4GAAA 5JPNB 3LZRA 4RK8A 4O2CB 4TR9A 1W1B1 2WQPA 1UCBL 4ZAKA 4D0BB 2VX6A 4D8PA 2J27A 3L5JA 4DFIA 1I0DA 1S78D 2BDNL 3LHTA 4EK7A 4N2CA 3L3JB 2VURA 1PSKL 3CV7A 1XLLA 5MEND 3RGBA 1I8MB 3QWNA 3DGCR 4V27A 3WK0A 4YNYB 4U6VH 4CADB 2FH6A 1YEGH 4XNQB 3C60D 3DROB 5CCKH 3ATZA 4HOMA 2GAZB 3L7FA 4WGXA 3SY0A 4A6GA 3MGOA 4EBQH 2YC1A 3AMLA 1HKWA 1NGZA 1IM3B 4HCFA 5EMUA 4YUEL 5I17A 1BQRA 4B0MM 5DR5L 1VPOH 2X7VA 2AVFA 2PPDA 1CT5A 5JMOC 3EKGA 2WLLB 3Q1EA 1WA1X 1VZGA 5D2WA 5E9DB 2CDGB 1OP5K 4A7GF 2O9TA 2BGQA 3ERXA 2FB3A 3S34L 3PCYA 2ZUQB 4OBSA 4HCIA 3DJSA 4HU8A 2RH0A 3O05A 2GVYA 3UFIA 3LHVA 2UZPA 4C65A 4XPHL 5I28A 1GC1H 3QF0A 3WUWA 4E9RA 3PQYA 5E8OA 1ZLVH 3RO8A 3PQYE 1BYPA 3BGFB 2H8ZA 2EO9A 2WMKA 4A2MA 3MNZA 2BXYA 2HRWA 1QLFB 3WO4B 2XXMB 4S1QH 1S9WB 2QZQA 3QJUB 5D1ZD 3PUGA 4HISA 3A3WA 2VR5A 1LP9E 3FFOA 3NO3A 5DHVH 4W7UA 4GZ7A 2OCJA 4OW6A 5ABTA 4NRZB 4TYUA 2IPUK 1YNTB 1NMAH 5BNKA 1SYSB 1QI3A 4WK2B 2QYGA 3O9WB 3AAZB 1J88A 4OF5A 1LLOA 3BG3A 2GTWA 2MPAH 4QRUA 3SGJA 2BNUA 3DOIA 1XDJA 1GR7A 1OC6A 4MZYA 5DS8B 1T1ZB 4OCWH 3OZOA 2D3JA 4PQXA 4HFWB 4XNYH 3MFFB 2QELA 5E24E 4XBSA 3KOYA 4HCDA 1PKOA 3INUL 4YHGA 4DNLA 1BJ1J 5A2AA 4IG2A 3PWUA 2IH8A 3A22A 3SBWA 3T1FA 1T66C 1BD2A 3UW6A 1XIWB 5IHZB 3STZB 3V75A 3BHBA 1BD2E 3PPHA 2V33A 1UWRA 5A2JH 1RZ7L 1D5MB 3HE6A 2J88H 3VGFA 3FCUB 1AXIB 1X4XA 2R1NA 3H54A 1GCYA 1XF0A 3RO6A 5CAKA 1EC9A 3VYNA 3UXLA 4G7QB 1IQ8A 4CD7A 1NCIA 3QNXA 1MF2L 6FABL 2K1MA 1CDGA 5JBDA 4RCAA 3STEA 3SSJA 2O5YL 3B2MA 3U8GA 2VLMD 1QAPA 3GRIA 3DX6B 2PPFA 3B97A 1B3JA 4IMKC 4FXFA 3TYEA 5TE4L 4BUGA 3KP0A 4OZFH 5CC7A 3UPCA 4BFRA 1AQMA 2OK0H 1SVCP 4F2TA 3HAEG 4E9QA 5GRUH 4PGDA 3ZMRA 5TTRA 4Z7VF 1B0RA 4GQ0A 3TYUA 2WLIB 4LTSA 3VOFA 2ZSWB 1TVLA 5HANA 2BO0A 4X7SH 3AWGA 4JUTA 2PGRA 3TT3L 1S7RA 2LTQC 5CIPH 1MCIA 2AXHA 1A5SA 2C4FU 5FA3B 4XVSH 4XNDA 1LO4L 5IY5B 4PWIA 2ITEA 1SGKA 1ZA6B 1OAKH 5ISZA 1UZ6E 3BUDA 4JG9A 4W9ZA 3O2VL 1UVQB 4KI1A 4GZJA 1JZGA 4I6KA 5F9JB 5ISZE 4UB0L 1ZT7B 3QUMB 4R4FH 2EO1A 1MDAA 2Z7ZA 8PAZA 3NGBB 5CFHA 1NGYB 3LEXA 4UT7H 4APXB 5LYRA 2EINB 3GBML 2X0HA 2Y3AA 1UWIA 1QXLA 4Y5XB 1HESA 4P5TA 5D2NA 4XVTL 3WS6C 1TYRA 3PJWA 1JPHA 1UD8A 5JTWA 3EYOB 2BSCA 1NDVA 4LQ1A 2PKDA 4S11A 1QBMH 3HPJB 3QQ3A 1W5QA 4N90D 4BF9A 3JVAA 5D2NE 4AD1A 4AQ1C 1RJLA 2N7BA 1UP2A 4ML4A 4NC2B 2QDHA 2Z8RA 1WWCA 4GMEA 4NZUH 4OCRL 4OGXH 4L64A 1LT7A 1P6BA 3SO3B 3AUVA 5ABZA 3CHFA 2AQ2A 5ANHA 4X60A 1P48A 2NSOA 1AKJA 1TQVA 4QXTB 4JICA 1A5MC 4AL8C 4GQBA 5I1HH 3X3FL 4ZUWB 1OSEA 4EMZA 5J6GB 3M5ZA 5AOZA 5GGRA 2WMIA 2Y5QA 1QOXA 5C09A 1VGKA 3G6DL 1X5IA 5K9CA 3UAEA 3S4SG 5C09E 3UZEC 1CB7B 2FO4B 2Z65C 3F6IA 3RPBA 5I1GL 3G08B 1O4UA 3Q1SH 4O18A 4AMAA 1P7KB 1NOLA 4MZ2A 2ERJB 2JK5A 4BBWA 3UJIH 4PYSA 2PDHA 4C6DA 1BWLA 2R56L 2DW5A 3QJFB 3RGVA 2IPKA 5F7HA 2MKWA 1Q0XL 3IV3A 4F0LA 1AL7A 1UZGA 1X4ZA 4CVUA 1WK0A 2W59A 1ZENA 4DYJA 2NOYA 5CZXD 3NVTA 4XPBL 3UIZA 4JY4B 2YFNA 1DQQB 2FHBA 5EU6A 1QKZL 2A0LC 4Z1YA 1QOKA 2J75A 2X1QA 3DESA 4KDTC 5EU6E 1Y5WA 2PCFB 2XVLA 1Q85A 5IOPB 3MWCA 4LVOB 1CB2A 5FJPA 4NZFA 4KXAA 5KUMA 1O6SA 3EDFA 5GJNA 2DU2A 3K72A 1RCXB 4N9OB 1ENUA 4U31A 4I90A 3IDJB 3W7KA 3BKJH 1AHWC 5FPIA 2C14A 4NZ1A 5RUBA 4G7VL 6TAAA 2A7PA 1VR6A 3BUVA 3R8HA 4FF9A 3B3DA 4AVHA 4RMWA 2R1XA 1BMGA 3BVNB 3WY2A 3F7YB 5AOJA 3GS4A 3WY4A 1NC2B 3CAFA 1U41A 1YYCA 1A7OH 1R3JB 1WDWA 2QHRH 1YQVH 1EP2A 4EANA 2VIRA 4NFDA 2E47A 4FXSA 5KBNC 2PETA 3NACH 1OCRB 3EGSB 4K71B 1HILB 5EO9B 2PA6A 4UM9D 3RAJH 3LEYH 3A21A 2EPNA 1SLVA 3V7AE 5HVHC 2C7FA 1IAKB 3IB4A 4KJPC 5FFOA 3ECVA 2JFCA 5CEZL 4KGLA 1P6WA 3NL5A 3QA3B 2OP4L 4JO8A 4K15A 4TRPL 1S9VB 2ZXDA 1NEYA 4HNTA 4NY2A 4RRPM 4X6FA 3NZGA 4AZ7A 4AGPA 4EZLA 4FQIH 1YEEH 4JQXA 3W56A 2G2RA 3OJMB 2BSSA 4IMCA 4Y5YC 1JVLA 4LVHC 1QRNB 4HWBA 4NC1C 4O8RA 1VEMA 3TXAA 3US9A 2WYIA 4GJIA 1FCCA 1A5AA 3O7UA 5EU7C 2NW2A 4ZOEA 1QG3A 2J8FA 3TC3A 3JUZA 3IDXL 5C0IA 3MCKB 4ONHA 1H60A 2OQYA 1T66D 2QDEA 3A4FA 4U6XA 4W9KC 3ETBJ 4N25A 4EZJA 4JTQA 2GB2A 4FTDA 4YQXL 3L9CA 3CXHK 3K1KC 5I3FA 2XBDA 1Z44A 1QFPA 4CU8A 2D3LA 1BG9A 3W07A 3S5LG 3D46A 3MU7A 2Z6FA 3BO9A 4EN3A 3RVTD 1OV8A 5LIYX 4LCYA 3LK6A 1KM4A 1CW2A 1N7MH 5ICZB 1HXJA 1EJVC 2WBJB 4N9GB 1DVFB 3BRDA 2R27A 4KKLC 4ODBD 1T03L 1EEZA 2OKTA 4EI6A 5GQBA 1G9EA 1T22A 5C08B 4JIQA 4HSNA 2ICEB 4ZMAT 4S3EA 3WJXA 4PJ8C 1QYGL 5D6CB 5ANMA 3UG8A 1DHKA 1SDYA 2UXGA 3OGCB 5EY5A 4MA7L 2VDMH 2J5LC 4AQEB 5FYJU 5ANME 5JQ6L 4DJMA 1P5UC 3ZDXB 3LKOB 4LGXA 3HI6L 4JBSA 2BOEX 3KRSA 2Z93B 3FN0H 4QHLB 2KDGA 2JSFA 5KTEH 1R9XA 1OARL 3NEVA 2ZCZA 2VELA 2XFXB 5AW4B 2WK2A 1VF5C 3AQZA 4AIXA 3AACA 3FU3A 3V1HA 5C9ZA 2IPTL 2OMYB 1K8IA 1KBIA 3WLJA 1B57A 2XINA 4QXWA 4MIMA 1OZQA 1F2QA 1MEIA 1ED3B 3R8QA 4BINA 1JCVA 4G9FA 4MJ5B 5A3HA 4HG4J 3DVIA 2WUCL 3OM3B 3W81A 2XQYK 3TTQA 1ZWIB 2IBBA 1MEXH 4G9FE 5ESAA 4WOZA 2XICA 2E1DA 4I7VA 2OMZA 2BOLA 5F7NC 2A6IB 3FRUA 1GW0A 3CFTA 2O30A 4J2QA 3V79C 2B7NA 4GCAA 3BPCA 3ICJA 4NI6A 2WZMA 4RFNB 2E9GA 1G4PA 1JJUA 3OGVA 1QPXA 5ILTH 4IHOB 3VA8A 2FTPA 4QNWA 2A85A 2A2QT 3BVVA 4X9YA 1DFBL 3KWXA 1JV5B 4GUFA 1ZEAH 1US0A 2BVTA 5DLLA 3ELQA 1T6WA 3RX4A 4JQVC 5DSCA 4OV9A 4YBLB 5D7JC 4D9QE 1V0NA 3O3BA 2LV4A 1VFBB 3DX7B 4Y4HB 3G6JA 4AZIA 1KYFA 1ISWA 2AJSL 3KTSA 5HHOD 2Z35B 4GK8A 3LDBB 4PJCB 3G6JE 4YDIH 2FTWA 4E8GA 5DJYB 1A5OC 3UJTH 1RD6A 2PR4L 1JPSH 2P4AB 3ORWA 4Y9MA 5KVGH 1CZ8L 1R9FA 4QY8A 4K9JA 3QORB 3FOMA 2FZ9A 2WO4A 5JIQA 3MYOA 3DAQA 4O16A 3PFUA 4EVNA 2AV1B 5JMUA 3MLWL 4BQ6A 1RUPL 2OXHA 1TZIB 3W9DB 3WFBH 4KWVA 3J27A 2DMCA 2XWCA 5LIUX 3BDYL 5K9OB 1U92A 2FVMA 4U4IA 1E2ZA 2BLEA 2O6FA 4AQZA 3GGWA 1VIWA 4KKNA 3NCBB 4JM2A 3TYAA 5J13C 1ZBVA 2W9DH 1OBAA 1EBGA 1TQSA 3QB7C 2I60L 4QO1A 2QDGA 3L3HA 1KN2H 3WFEH 4LVFA 3FBKA 4KWWA 4OCSL 1HTIA 1UOZA 1I7UA 2H3NA 1WF5A 3TVMA 4NNAA 2DZTA 3WUZA 4FIQA 1CFSA 4XBMA 3WIIH 1U3JA 4XD4A 2Y07L 1RIHH 4AM0B 1E6PA 4QM1A 1OE3A 3QHZL 3RKDC 4EXPX 3M7SA 3ULVD 1GOXA 3D39D 1UUSA 3CG8A 1JXFA 4OOZA 3FSWA 3N4AA 4A7VA 2GW5A 4D9RE 4PI2A 4HVBA 3DNKA 4ZFMA 4OIBA 4WTWA 3ML8A 2LU4A 1YMYA 2G30A 2A4EA 4HEPA 1JAKA 3OHXC 3LI0A 1NSNL 1OD8A 3BWZA 3HHRB 1OWRM 3N1PC 2X1SA 5JW3L 5MI0C 3W88A 5SWQB 3BC9A 3OPSA 1TR1A 2CAKA 1TENA 2EUZA 4PLOB 5D7IB 4ENZA 5IHUL 4ZRGA 2FX9L 1MPAH 4OVUA 4W9HC 1IIKA 3E5PA 4CCZA 3QJAA 4NKIH 4JDEA 2GVGA 3UTSD 3M1OA 4JX0A 2RFGA 2WO3B 1MFCL 3IMSA 3QJTB 4LUYA 4RGMB 4Z0XB 2WM0A 4DM2A 5A6IA 2XA8H 3X12B 3PSWA 4XD3A 3KRZA 1U2YA 3S3BB 4GOSA 5KSVB 5FESA 1UR1A 4YC2C 4LP5A 2GQAA 4DVBA 3UG4A 1WJ3A 1XJBA 1UXSB 1UJPA 4HXBL 5HGAB 1I4FA 5HWJA 3MLZH 1IC7H 4WWOA 2YUWA 3TE9A 1UJQA 2YN3A 4YSUA 3CZGA 5IJKC 1UJTA 5FSEC 4ATLA 3IM1A 4JTUA 4OZHF 1JWSB 4WDIA 2IFFL 5IT2H 3AS2A 1JCNA 1QLRA 1SXZA 3M43A 2JLLA 4XN4A 5T3XD 3BE1H 3KXFD 2KQNA 3DOHA 4UV4L 1KF9B 1AJ2A 3H8AA 4G5ZH 3E6FB 4KWUA 1ZAHA 4PJ8D 3GRWL 3NCMA 2NX5A 3CYVA 4XP1L 4XMZA 1X7SA 1D9KB 1FNLA 3ILQD 2NX5E 3UXKA 4H9ZA 2MHAA 3QZPA 4YZWA 1INQB 5T91A 1YEWA 1B2WL 4U6HA 1IGCL 4N68A 1ZVHA 2CMRL 2DJSA 3AU1B 1AD9B 4BM7A 2VENA 5AW8B 3RM4A 3NJXA 3OVGA 1I82A 3LPPA 1XIGA 1EV2E 1DWAM 3Q45A 3VG0L 4AVFA 4PS7A 1ZAIA 4W89A 5D09A 1FE8L 2W62A 3ULSB 1WBXB 3WKZA 4ABVA 4LF1A 1JNHA 3C86A 4LLWA 3RIKA 2H0JA 1GIGL 1WDRA 1TV3A 3FSZA 2YLHA 4YXGA 1KZQA 2YGVA 2VDIA 3ISRA 4FFTA 2LT9A 3WN5B 3BQUA 4D6CA 2E6AA 5E5CA 4L1WA 3D0VB 3MLUH 4WFED 5AC5A 3SYPA 2Q3OA 1H3PL 3V9CA 1Q8JA 2EUXA 4NHUA 4FAAB 2YDQA 5DD6A 3WTUA 3KZ8A 5AVRB 3FIGA 1UM5H 2VXQH 1J5SA 1DQKA 2WXQA 1CICA 2GLKA 2PCEA 1GZPA 3IPWA 3L23A 1JRHI 5D4HA 4ODTL 2FH8A 2C4XA 1L9OA 2F7PA 2OR2A 3R12A 5CEZE 1PW3A 4R3UA 1TQBC 1KC5H 3N2XA 1FG2B 4AMCA 4D6EA 2E9BA 8A3HA 2V2WB 2EPMX 4NZRH 5DWUH 1ZAGA 3QQ0A 4DRSA 1B6UA 3TBYA 1RHFA 4OLUH 4BK8A 4XH2B 5I3KA 4PJIA 4DBSA 3I6GB 3RWCB 2ICWA 2AZAA 4MCYA 2B7PA 4PJIE 4DJFD 1NFKA 2VDKL 4XNAA 4TXVB 3TO4D 5D7JD 2VN4A 3WQDA 4BKTC 3NSMA 2J1ZA 4MPKA 3QFDB 5K59F 3MY9A 2X89D 2MTPA 1VCBC 3AUOA 4JW3A 2YCEA 1NCDH 3ZKMC 4X7DC 4NFCA 4KKCC 3LIZL 3NJKA 1KFEA 4TUKH 2AXJA 4XCEB 2IBZX 4M61B 3QCTH 2YBGA 3DFYA 2ZZ5A 4MZRA 1JPFB 3NMEA 3FT2B 3G22A 2J1KA 3QY8A 1WAEA 4WKAA 2YZRA 1CC3A 1UGKA 3REWB 4R9HA 3WTSA 5J9PA 5G2WA 1GORA 4JZNB 1CLXA 3UCDA 4DEUA 4RAUA 2G2NA 3ES6B 3GIVB 1A0CA 4TUUA 1RURL 3EOUA 4M1GH 3T0EB 4L4TA 1K8XA 1WIOA 4K7FA 5M3WA 1VYPX 4QAMB 3W7PA 2YL5A 1JP5A 4L4TE 4DXKA 3V6OC 3H8NA 1EFXB 3WXWH 4C4KT 5FKAB 3LRSB 4YIQB 2PDQA 5GZOA 5LGYA 3TA3A 1YMHB 1YPIA 4QCIB 4P3CL 4NKOA 5F7WC 4A21A 5CPMA 3R0KA 2F19L 2W88A 3ZDWA 2IQDA 2DQIL 1F42A 1MKFA 5EU3A 4B5NA 1N6UA 2DM4A 3FFSA 3I7SA 3PHSA 3GMLB 3CSYB 5HTSA 5AW7B 3AALA 2YJQA 4PLJD 1PZ0A 5FHBL 4G8GB 3O0FA 4MUPA 3Q44A 4HC1A 3ZZLA 2IKIA 3RAOA 4AZGA 5FD0A 4AYFA 2VCBA 4PLKD 3MREA 2HT4D 5E5LA 2W95A 2WC4A 3I6LD 4L4VB 3E2HC 2J1WA 3ZHKA 4QUOA 2VD9A 2WQVA 3LH8A 2INEA 1WXZA 3C2VA 1J05A 1FN4A 3CQKA 4XCYA 5DMYA 3KVQA 3QOMA 2TSBA 5FM5M 2HBVA 4X42A 1XGQB 4GLEA 2VTFA 2OEMA 4YCPA 3T2OA 1FHNA 2MUCA 4MD0A 2F61A 3N25A 4K23L 3GS0A 3APNA 1BIIA 3TYBA 2VR3A 4A7TA 4BE6A 5JXEC 4FB7A 4J8QA 5AFDA 1YTKA 4DP6X 2XWEA 5ADPH 3VD1A 3M7OA 4QD2E 3SUWA 1K5WA 2WPBA 4G3YH 2QF8A 1FFPA 5C2XA 3UBPC 1LK3H 1J2WA 2AS5M 2VB5A 5FX3A 4PBGA 1J1PL 4MXQD 1GYUA 4KVNL 5BVPL 3SBFA 3OIXA 3II2A 3IJ6A 1JFQH 4M8VA 1IC4L 1XCQA 4GUPB 1HYSC 5CEYB 1VD6A 3V5HB 1E5ZA 3EZ4A 5HY9B 1LL7A 1GH7A 1SXSA 4K3JH 3UZQA 1E9ZB 2IWKA 4M5ZL 2P48B 5F4WA 4PMFA 4NJ9L 1EUAA 5E9XA 1SQMA 4FEZA 4OBRA 5HBBA 4F7MA 3QHOA 1MHHB 3B2PA 4L1GA 3N2OA 4FXRA 3IK2A 4WCYH 4G7YL 3HNVH 1KGXA 2FPTA 5GZND 5KVMC 1P4BH 3W1NA 1FDYA 5IIEB 3BD4A 5CFAA 1KB5B 2FDMA 5D7KD 1UOLA 4N6RA 1BX2A 1AXTH 4MPQA 3CH0A 2V17H 1TCDA 1XU6A 1XMEB 2P42B 2Q8BL 3QEQD 4JO1L 4YU1A 5HJDA 1CN4A 3KPQB 3N43B 3WK1A 2YA1A 3VNIA 1OD9A 2WNZA 4UM9B 3NQIA 3HS8A 3CNKA 1TQCC 3LS5L 1E1CB 1Q0EA 2UWEA 3A5VA 2WXHA 1MNUL 1F41A 1VRSA 1A5NC 1BZDA 3EKZA 1XVSA 2HT2C 4CSZA 2UWEE 3MROB 1OL0A 1FX6A 2NXGA 2Z7KA 1M04A 5C7XH 3PNUA 3N19B 3CFDB 3VTRA 4S0TD 4FO4A 4Q52A 1M3UA 2XVNA 1ZBCA 3WH7A 2ZZ3A 4ERSH 2APTA 1CFTA 3FQNA 1Z5LA 3K6IA 2C1IA 3TJLA 1N8OE 1SMDA 4UOQA 2NUXA 1L6GA 4PJHA 5TE7L 1F4AA 3VYPA 5HINA 2VCOA 5F4XA 2CUAA 4P4KC 4PJHE 3ZXWA 4MQXC 5LWYH 4Q7BA 5DTFB 3B9DA 3X1BA 4JPGA 5J8LA 1KV7A 2HDJA 5DJAA 3B8IA 1DJXA 2FJHB 3WBWA 2OLDA 4GISA 2V7NB 3TR9A 1A6ZA 4P59L 3OKLA 4B2DA 3FMGH 5JHDB 4YXHH 3S8FB 5E8PA 4ACZA 4PUDA 1U3HA 5HDRA 2XFGB 1GY2A 1TZGH 2AJUH 4KKAD 2AJVL 4KQ0A 4XNMA 3QQ4B 1NIBA 3GEFA 4L3ED 4PYHA 3KYAA 5D1QC 2COQA 2X05A 2MEJB 2LLEA 2BRRL 1QSFA 1UQSA 4ZB2A 2VW7A 4DEPC 1MAMH 3DJZA 4X99B 2ZOOA 4X4YB 1QSFE 1QO5A 1SDDA 3WD2A 4M7LH 1JWMA 1WD9A 8XIAA 1VGEL 1DIOA 5C9JA 2E0PA 1FNHA 3DTXB 1EP3A 4YHLH 2NNFA 5GS0D 1L3WA 3WLTA 1UD6A 4O4WA 1UXWB 4FQCL 1NCUA 1CLCA 3LHYA 3KGRA 5J6SA 2V7HB 5CSGA 4JQIA 5JOPD 3G6MA 4WY0B 4RDWA 4ELKB 3FTVA 4YDKH 2F5AL 2NY3C 2LTQB 1UUNA 4AYGA 3D09A 1W32A 1OCQA 3NZ8B 3RZCC 1B1YA 5DJDB 2BX5A 3GMRA 4HZMA 4CQAA 2I9TA 1V3JA 2CERA 3IU4L 2NQ9A 4R6UA 4ZQRA 1PG7H 1S78C 1A3ZA 2VQ1B 3UJJH 5B1BB 4HU0A 1HIML 1EAPA 2I9LA 1VLXA 1E6QM 4FLQA 5TFSH 1DIEA 1Y6KR 5K9JL 1OGTA 5FL0A 3H2PA 2CZEA 4P3DB 3C60C 5JHLH 1A5FL 3GSUA 1OAYL 4EF9A 1GGIH 2WVUA 1LE9B 2HPOA 5J5EA 1CVRA 3U2SB 1K9FA 1FORH 3I6KB 4EACA 3UTOA 1TJHH 2VLLB 4AQ1B 4XOBA 1EO8L 3R06A 1PB0A 1XW8A 4BK5A 3MMTA 2DIAA 2IFGA 3EB2A 3C61A 1GGCH 4ZTPL 1HP5A 1WBZB 1K1DA 2OSYA 2GT9A 4LBUA 4EEEA 5A6SA 1RIVL 3MO1B 5EBLA 2H2PC 5J56B 2EYTA 1PWLA 4QXVA 5T1KB 5I19L 5FSDC 2IBZY 1RFDH 4ISVA 4AX6A 3BH8B 1M3IA 4LAQL 2DD8H 4PTUB 5I1JH 4YIWA 1QLEH 3D4GA 2KZBA 3I6TA 5HHOB 5DZPA 3NPUA 1XIBA 2XWJB 3FRPB 5BMFL 4U28A 4OD2A 2BDQA 5EO0B 1TZZA 2HVOA 1C92A 3UO1L 2YEZB 4UMCA 1WC7B 4PGEB 3TN0D 1UB3A 3OAYK 4H2AA 4XAKE 3QSTA 3T09A 2A7RA 2FBJL 3PZUA 4Z76A 3MJYA 2JEQA 4Z7NF 3Q0HA 2E9JA 1CG9A 1P9MA 5EEXA 1IT9H 1E4KA 4QHPA 3JWOH 5KAQF 2ZFAA 2YMOA 1Q9OA 2XYBA 1LXMA 1OGAA 4YL4A 2NUTA 5CD3A 1PLCA 2R4RL 5C2CA 3RNKA 1LWIA 4I87A 1OGAE 4IIQA 1TUPA 5HVFB 4HJTA 1XF4A 5KVDL 4OFYA 4HZLB 2OYMA 1ET8A 2NNRA 5EO1B 1Q6CA 1BEYL 1KYDA 2ZUUA 5KAQG 2ALRA 1EC8A 5EFIB 3NCCB 4WU7A 4QI3A 1WUEA 3ITVA 3NSNA 3ZE0E 4I48A 5JBEA 1I8AA 1AHWB 2CLPA 3H7RA 2VITA 1HH9A 1XSJA 3CZSA 2V2HA 4DVRL 3O63A 3T7VA 1IV8A 1CQYA 3ARBA 3WDIA 3P4NB 3I9IA 2Z31D 4WEEA 5DRWA 1H5BA 1Z6JT 3R7QA 1HKKA 1BFVL 2PPCA 1FNEA 4K1WA 1H0GA 4CEUC 4OQTA 5SWZA 2ZF8A 4AUBA 2J20A 5SWZE 3GK8L 2YQ2A 1KWKA 2XWTA 1JDCA 1BZQK 4WW2F 4Z7UF 4O5LH 3CDGB 2AI0H 5HVHB 3IK4A 2QCCA 1R3IH 2IMMA 2NLIA 4EX4A 5IKCA 2V2TB 1BGXL 1T5WA 3CHOA 3HPZA 4PWGA 2NR6A 4NJAL 4NLAA 1TB3A 5KSAD 3THML 2VEKA 3CTLA 5I3HA 5HHQA 3CUPA 3RNQB 4C1LA 5F3HB 4YE4L 3IVSA 1S5HB 4HA3A 5BOPA 3F3HA 2VSMB 2EVHA 1M42A 2VOTA 4L7ZA 3T0VA 3R79A 3WN6A 4M5YL 2ZYIA 4Z0SA 4Y5YB 1BZ7B 3UTSB 2YQBA 1H0IA 3PP4L 4LVHB 1AH0A 5A7BA 1E9LA 1JYXA 3UT0A 1KUMA 4PJXA 1X7TA 3CFKB 1WA2X 2P50A 2IF7A 1S7UA 2ARJB 1XF2A 5FGSA 3B56A 4Y1TA 4PJXE 4AY8A 1U8KB 3PWIA 2EG8A 1R33A 4GI8A 1LD9B 3TW7A 3WQPA 1E9OB 2UZXB 3WKMH 4Y9BA 5ABEA 5EN2A 1A3XA 4QRPA 4L18A 2H90A 1KJMB 3Q6GH 1LWRA 1I2PA 3MBFA 4RLDA 4QRPE 4RMVA 2JNZA 2XPZA 1CXFA 1TPC1 2VDQL 1VFMA 3TCSA 2E67A 1WKYA 1HZKA 4PRDB 5L7XH 3C52A 5C9XA 3P2VA 1OIFA 3WLBB 1XLHA 2WXPA 3N06B 1ID5I 5DVMA 2BVUA 4BI7A 4FYTA 4J3OH 4XSMA 5LNDA 5D72L 1UCWA 2YPKB 2DQ6A 5CINH 3NAVA 2NNAA 1V55B 3C2YA 3DEQA 5HDQH 3X3GH 1U91A 3ZE2F 4PJ8B 2J7DA 2FSEB 1VP5A 1UJ3A 4YSRA 3SDXF 1RAMA 3AMKA 5DLCA 3ULUH 5EIIA 3WJYA 2J5LB 1WBHA 2DEPA 3N44F 4X5LA 1GQNA 4W68A 1GZJA 1KFBA 3US0A 4JHBA 1P5UB 3UABA 5FYKE 3L5XL 3L13A 3WIFB 1OP4A 1ZBWA 2FEEL 3L6FA 3VXSA 1KCVL 4U1NA 1AGCB 4JY9A 1V6WA 4GUGA 3GI8L 2W0PA 5IV2A 1X5HA 5IB2A 4GYPA 2ZDRA 3VXSE 2NY3D 4XXCC 1XFBA 4HAFA 3PXHA 1ET7A 4ZMXA 2XXGA 5BZDA 5IOKA 1RZKC 4C83A 5J04A 1ZCOA 3DHMA 3RLHA 3QWRD 4R88A 4LXFA 4JJ5B 1KY7A 5F93C 2UV8G 4G1EB 5I1CH 1PU0A 3OMIB 3I75A 1D7FA 1A21A 3EUUA 2A4CA 3JV6A 3RF9A 3CE1A 4CGTA 1QVOA 5LBVA 4I4WA 1XR8A 5IVZA 2YUZA 2EPOA 3IVUA 3SGZA 2ITDA 4M8QA 3LMJL 2G9HB 5CZXC 3WFDH 3LHAA 1CT8B 1PYWB 1XH3B 3VFMB 2V0TA 3QXVA 3TVAA 3ELFA 3MC0A 3MLTB 5HYJB 1SHSA 2B31A 2OJ1A 3L4WA 3BW9B 5HATA 4NNYA 1GQLA 2EDMA 3ZUNC 5FF7A 2CM6A 1P5VA 3ECUA 2WQRA 4U1KB 1WIUA 3PWPA 2HNEA 5EORH 3ULAB 3OU8A 5JZ7D 4P2OD 4YR6A 2HX9A 3BVTA 5DRIA 4ODXB 1DQJB 1NBZA 3PWPE 3OAWA 4LALA 3CXDL 1RZJH 2CLVB 4I0CC 5LBSH 1OAZL 4J2PA 4E41A 1TR7A 4TQTA 3UXDA 4LEXH 2H2PD 5CZTA 4LF3A 2J8TA 4E41E 1DQWA 1CL7L 4Y1AB 1TTAA 3MOQA 2BSBA 4QRRB 4DZ8B 1J5DA 2OEJA 1CU4L 3I7RA 4O02L 4WGWB 2FL5A 4NNXA 1HFUA 2ZX5A 4LLYA 4IX0A 2JKPA 5DLML 3L5AA 5B3NA 3GKWL 3WHXA 2ZZUT 4ODUB 1Y65A 2Y61A 2JCCB 4A2SA 1OALA 1OP3H 4XPTH 3FA4A 4MDJA 2X4PB 1D5ZA 1B0GA 5EUKB 4S3DA 3PWJA 3KBFA 2PDYA 4XX5A 3OZLA 3N9KA 4NUWA 1A8ZA 8CGTA 4AXWB 3HZVB 3SY6A 3PBYA 2P76A 3QJQB 2EDXA 4IOSD 4XZHA 1A66A 1OF2A 4YSEA 3F7JA 4D3CL 3UEQA 5FFLA 4Z2LA 3ZTDC 1JDFA 2HKHL 4IOIA 4FFVD 4NNPL 5DYOB 3WNOA 3VXRA 5ES4B 1Y1UA 3ALWA 3V4VB 3OZ9H 4M7SA 4R7DB 4YSAA 1QPKA 3VXRE 1YDYA 3U4EB 3TZFA 3SQSA 1LJMA 4F48A 5FB8A 4ZFOA 4ZS7H 5J13B 4J4PA 1I3RA 4H2HA 4N2AA 3WQWA 4M93C 1U3NA 5F71A 4DGYH 4OM1L 3SCVA 2VYRE 3TMLA 2IDTA 4ONGH 3CU2A 2WYTA 3QUXC 1RERA 2Q6WA 4U05A 1VFHA 4MDRA 3QSKB 2NXHA 2CNYA 3EH3B 3H0TA 1IKFL 5ESVA 1JGVL 5JORB 2UY4A 3RVTC 3AG2B 4ZENA 1KIRA 2UXVA 2UZYB 4XMLL 3TC6A 3TIEB 3ZGIA 1TUXA 3MBWA 4U49A 5CJOL 3HRZA 3K6OA 2QSVA 1DQUA 4DKEL 1KXTA 1ONXA 5JW4M 4YDVB 3OHXB 1S8DA 2VZTA 1GPWA 2Y7GA 1CLKA 1EGJH 4R7OA 5BZAA 3TSDA 1MMFA 1IVTA 1H1YA 4NO0D 3LCLA 3FYYA 5I71C 1UM6L 2B0MA 2VGLM 2VVNA 5HMDA 2JELH 5BQDA 5MI0B 4LRSA 4PTTA 4Q8TA 4KWOA 1VACA 4HKZA 1AXSA 4NSKA 1WUZA 2LAGB 1QPRA 4FGMA 3FOLB 3TT1L 1M7OA 3NCOA 2DZBA 4NPJA 1SPDA 2UV3A 4MMZC 3M47A 2F5BL 4NZ3A 3GIPA 4BWLC 3MOBH 1XIDA 1J9YA 3NABH 4EXKA 1OY3B 4LFHG 2QQKH 2D31A 2V3DA 1AOZA 4JD4A 1KB9J 1MCPH 2BIMA 4G8FB 2H9AB 4TIMA 3Q2VA 1QW7A 4YC2B 3PV6A 4Z2IA 3V16A 4AIBA 3U7YL 3OXSA 4D8OA 1B3YA 1XLEA 3NO1A 4TQEH 4ZUUA 3VILA 4B9YA 1FWIC 3NQMA 3PF2A 4LDCA 3S9YA 2C15A 3H56A 3QDGB 2C16A 2RH9A 3OZMA 4K9EL 3P7YA 1HCZA 3HPLA 3O2WL 4F37K 4E0CA 3M0XA 3FB8A 4IXXA 3IDMB 3AZTA 4PUBL 1H6UA 3TWAA 4F33B 3MFGB 5BCAA 5DT1L 1KXVA 3KS0H 4IPJA 1G69A 1UYQA 1AR1C 2XZCL 4GKSA 4NUQA 1F4WL 4XWUA 5I2IA 5FK9B 3KOXA 4N2LA 1U8MA 5LHDA 2FQEA 3QEQB 4CJ0A 1FWSA 5L6YH 2OMXA 5TK4A 1R0AH 2QUUA 3NO5A 1EANA 1Q1JH 3KAOA 5D70H 3IMBA 5E1QA 2VCAA 3LN5B 3V4LA 2B0SH 1XLAA 1KELH 1C8QA 2IPUG 5AZEH 4UQDA 2AK4B 4MDIA 2PCXA 1F07A 4X8CA 4KC3B 2NUPB 3FO9B 1BAFH 1LQSR 3GZKA 3WQCA 3H4FA 1LP9F 1MNNA 2CKBB 4N7QA 2VDRH 1K70A 5IBTL 3T4AC 4MAYA 2NLJA 3S2JA 3V0WH 2ZT9C 5DVKA 1E28A 4WUKL 3KVJA 3FU7B 4CC1A 1J2BA 1TREA 1MXGA 3WQ5A 1YEDA 3AREA 5LCVH 3CZLA 3M6DA 1JRHH 4Y16D 4ZQPA 1QR1A 4Y8EA 2XN9D 2I85A 3V4BA 1O5RA 2HROA 2E46A 3RWGA 3ZBMA 4KO9A 3IF1B 2G3MA 3MRIB 2FJFA 7ODCA 3O07A 5IUCA 1DLHB 1KFGA 2CUMA 5FYJD 4KCTA 3FUKA 1QFEA 1CFNA 1TXKA 1TQBB 2Z9TA 3ZLQC 1KIPB 3BGMA 3P9LA 5AYYA 4GRWH 1XG4A 1H09A 5IB3B 3C6EA 1NCBL 2DZAA 2YD5A 4H9UA 1VRDA 3V4PH