3CTTA

Crystal complex of n-terminal human maltase-glucoamylase with casuarine
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
862
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Total syntheses of casuarine and its 6-O-alpha-glucoside: complementary inhibition towards glycoside hydrolases of the GH31 and GH37 families
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase
total genus 274
structure length 862
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3cttA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cttA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3cttA01
4P7OA 1SMDA 1BF2A 1F4HA 5EFFA 2XIIA 2XSAA 3WH8A 4BZYA 1NP0A 4GO9A 2CKSA 1XV8A 3B8SA 4IPLA 5A8QA 2YOCA 1E0XA 3UEQA 3ZT7A 5BYWA 5BXPA 2ZUMA 1V0LA 2BHZA 3LXBA 2PWFA 3UCQA 1CGWA 5CZKA 4UQAA 3MUAA 3MANA 3CZJA 3KE0A 1ESWA 1W2PA 2WK2A 3AS1A 2J47A 3N15A 3T2QA 3WF4A 1HI7A 3K8LA 1VRXA 2DT1A 1R34A 4KMQA 2V38A 1UKSA 1JYXA 5CGMA 3VILA 3EMQA 3TTQA 3KLKA 2MANA 3GBEA 2X05A 3VD7A 4D6FA 4PTWA 4D6IA 5A6BA 1OD8A 1OCQA 5BXRA 1V0MA 5M3WA 3AIWA 4OKDA 4W5UA 2NW0A 1P6WA 3QR3A 1M03A 2VO5A 4JFUA 1QWNA 3MUZ1 2W61A 5KEZA 4OIFA 3LPOA 2X2IA 2J79A 5FOOA 2Y8KA 3W81A 4J27A 2GK1B 2ZWYA 4QLLA 4TTGA 1Q6FA 1W9PA 3WDRA 1B3VA 1G5AA 1TA3B 1UR8A 4P8UA 5I2UA 3VGFA 1PSPA 3AIUA 3W37A 1ISYA 1W9VA 1CLXA 2EBNA 2BXZA 2WCAA 3VIMA 3VDAA 5D4YA 6TAAA 1GHRA 4KH2A 3ZM8A 2VQUA 5TD4A 3AS2A 2Y24A 3NYDA 1JG9A 2C7FA 3VM7A 1NQ6A 1LWJA 4MNMA 3LMYA 2EO7A 1FA2A 3VMNA 4AMWA 4FF5A 4NRRA 5A95A 4GZJA 1QI4A 5ABGA 1M04A 3GH7A 5A8NA 3UR8A 4JL1A 3AIEA 3IGUA 3BUPA 1UWUA 4UFHA 5EB8A 1HKJA 2DH3A 1PE31 4WKHA 1CTNA 4ZXLA 1CXFA 5E1QA 3VIGA 4ZE4A 2XFRA 1UOKA 3MSDA 1XD1A 3WDHA 1E43A 2VUYA 4UR9A 1UUQA 2DIEA 1HP5A 1V3MA 3W6LA 3WQ6A 3DDGA 3WNOA 1GZJA 1V02E 3VM5A 2D73A 2VRQA 3W29A 1TZ7A 2J7GA 4S3KA 2W92A 4DWSB 3WD2A 1S46A 5IHSA 1W1TA 3SUTA 4X0NA 1E5NA 4PCSA 2EPLX 2WYSA 2BY2A 4NRSA 1NH6A 1E1FA 2J7EA 1V02A 2WHKA 4AD0A 1BYCA 2XWEA 2PC8A 1D3CA 4HMDA 2F2HA 2PB1A 3POCA 2JEPA 2X09A 4D1IA 2WMGA 3WBEA 1GUVA 3AXXA 2XN1A 3PZ9A 3LRLA 2ESCA 1ZS2A 4UFMA 1ZU8A 5AYBA 4F8XA 4NZJA 3CHDA 4PMZA 4KGLA 1RH9A 1NP2A 4CCCA 4NZCA 1BHGA 1V6WA 3UERA 3AMLA 3PTKA 2XFFA 4B15A 1R87A 1AMYA 2GDVA 1JXKA 2EADA 4TVCA 1ZL1A 2WPGA 2D1ZA 1B90A 3VIFA 2D3NA 4DO4A 5AC5A 2F8QA 3GNRA 1QBBA 1X1NA 2VQTA 4HOWA 1UR4A 3W25A 1VIWA 4IPNB 4ACZB 4QLJA 3BLBA 2PWDA 1EHNA 5HDRA 1H0GA 3LPGA 4AMXA 2XHYA 3BAYA 4HMEA 3VGEA 5BWFA 3WENA 4U5IA 2JALA 1KQYA 3ZO9A 5KZ6A 3AIBA 3AZTA 1D2KA 5JIPA 1JZ3A 1UA3A 2D22A 4GO8A 4U3CA 3DDFA 4LGXA 4D6CA 1B3YA 4OOUA 1HKIA 3BSHA 1OWQA 1LL7A 4D6GA 3H54A 1K9FA 1MXGA 1G01A 3GXFA 2VRJA 2BY0A 1HJQA 2Z1KA 3O2LA 3GYCA 3N13A 1FP8A 2YL5A 4AZ5A 2XVPA 3DYPA 1PIFA 1QVBA 3L4VA 5ABHA 5A6SA 3OLEA 1B2YA 2BVTA 2V5DA 1HX0A 1JZ2A 4XX6A 4UFJA 4CN1A 3FHQA 1TUXA 4QCFA 3WKZA 2FGZA 3OIHA 3BGAA 2PBOA 3D5HA 3WD4A 3GXNA 4HZ7A 4HA4A 1V0KA 3WDJA 3WH9A 1TVPA 3MSGA 3VGGA 1QHPA 1HJUA 3WD0A 4FNTA 2J74A 1UQYA 3K4DA 3VVGA 4Z2IA 1MYRA 3QGVA 1HN1A 1K9EA 1C92A 1UWIA 3QOKA 4DM1A 1TFVA 2D0FA 4HOXA 4HTYA 2BY3A 4AD1A 1E72M 3AIVA 4U3AA 1GVIA 2Y2WA 4HU0A 2ZX5A 3WNPA 1J0ZA 3WUGA 1SMAA 1T0OA 1VFUA 2CBJA 2FGLA 4ZFMA 2FHFA 3FW6A 4CN6A 1BGAA 3VSTA 2ZICA 4OOZA 3NSNA 2WBGA 1C8YA 6CGTA 5CSUA 3WD3A 3AQUA 1QNQA 5D8WA 1V6XA 2YIHA 1UWSA 4WLCA 1SYTA 2YLLA 4EK7A 3BMWA 2J7FA 4GI6A 1VENA 4PBGA 3BLPX 1ZB5A 5BRPA 3M6DA 2W62A 3FY1A 1PIGA 4BQ4A 2XVGA 1W2VA 4KGJA 3W82A 3HG2A 1GOKA 2XSBA 2PI6A 3G6LA 2CBUA 3HG3A 3ZR6A 4PTMA 2VRKA 4UZSA 4HZ6A 3U5UA 3M46A 4BA0A 4HA3A 4CU7A 5CXPA 1WAWA 1UASA 2AOSA 4OBRA 4CD7A 3VDCA 4KRUA 1ISZA 2A3CA 4U2YA 7TAAA 4AZIA 2F61A 2WHJA 4C7GA 2YBTA 1G9HA 1OB0A 1JF6A 4U5KA 4J7RA 4AEEA 4LX4A 2CBVA 3IAQA 3AYRA 4B9YA 1VJSA 1CGTA 3MMUA 5LA0A 1K9DA 2WKLA 1GQJA 2WC7A 1VEOA 3W6MA 1WCGA 3AICA 2PBGA 4CVWA 3EDKA 4B3KA 5AYIA 3VSVA 1LLOA 4AZ6A 3W24A 2D3LA 3OGSA 3LRMA 1VJZA 1ODZA 4DO5A 1JYNA 1OSEA 1V6VA 3ARXA 3TTYA 3F5JA 3L4WA 3DX2A 2OYKA 3EMZA 3WSUA 1KXTA 2JFEX 4AD3A 3WQVA 4UFIA 3BVXA 5A2CA 4OGZA 1KBKA 3L4YA 3VX1A 3VSUA 4W8AA 3WF0A 1H49A 5HNNA 3K8MA 1JDAA 1J18A 2E0PA 3ARPA 4JHOA 4JKMA 3D51A 5LA1A 1HXJA 3WL0A 3EJTA 3UR7A 3CUGA 3S6TA 1DWIM 1V3HA 2WZHA 3VIJA 4PSPA 1MVYA 4HZ8A 2WW5A 1NARA 1JD9A 1H41A 4QLKA 2X0HA 3SUVA 2Y8VA 3IANA 3DX3A 3CIVA 3RJXA 3BUBA 4OUEA 3AI0A 2WC4A 1E70M 1LL4A 3U5YA 2AAAA 1JXJA 1HKMA 3WF2A 1OGBA 3TOPA 4V28A 1B3ZA 1V3LA 3PTMA 4D6HA 3AHYA 1KGUA 1CBGA 2W66A 4LXFA 3CH9A 2CETA 4N0RA 3I3DA 3WEOA 3ARQA 4PN2A 3DX0A 3BLKA 3RM9A 2FHBA 3SUSA 6A3HA 2DQXA 1Q4NX 1B9ZA 3QHNA 4AIOA 1C93A 5HPOA 1CIUA 5BXSA 3QOMA 3SURA 3BSGA 1VFOA 4HPHA 3OB8A 3OGRA 3GXMA 1VBRA 4W89A 3L4TA 3WNLA 2V5CA 2PF0A 1PX3A 4NZFA 5A6MA 1R8LA 1TE1A 2E9BA 4P7NA 3NCOA 1UWTA 4M24A 2DSWA 1W32A 1BLIA 1DWFM 2WVSA 3W53A 5GQBA 1WDPA 5GNXA 1KTCA 2J7HA 3CC1A 1O6IA 1JZ7A 3PZOA 1CPUA 1MFUA 2EPOA 1Q6CA 4B3LA 2CITA 1ZBKA 3A3HA 4EAMA 2BHYA 2E9MA 2DIJA 2FH6A 2HISA 4W85A 3AFBA 2WLZA 1UKPA 1TQVA 2GFTA 1LF1A 1R86A 4RE3A 2O9TA 2CKRA 3WFZA 3WIJA 2VVNA 2ZXAA 1E40A 1HL9A 2XN0A 2WMHA 3MUY1 1E0WA 2VZUA 2QV4A 2WMIB 4Z2JA 4MADA 1EXPA 2OW6A 3VX0A 1UR9A 3WL1A 3CPUA 1HVXA 2YFOA 4DO6A 1B3XA 3ZIZA 3CHFA 1HKKA 3NDZA 1JGIA 3RIKA 1W9UA 3ZQ9A 3BAKA 1XSKA 3LRKA 2JIWA 4FLOA 3RCNA 3VD4A 4LYPA 1PEZA 1PAMA 1EO7A 4F9JA 2CNCA 2J7DA 3VOCA 1LQ0A 1E73M 3VD3A 3F4VA 3KEHA 3WNNA 1VF8A 4CVUA 3EDFA 4PCTA 2ZUVA 1E6NA 2GSJA 2OLHA 5LA2A 1W9XA 2ZX8A 1GHSA 1GQKA 1LG2A 3N11A 4JL2A 3WH5A 2G3NA 3GH5A 2QMJA 3ARVA 2WVVA 1XH2A 1J0IA 3KLLA 5FL1A 2VT0A 1M53A 3CV5A 4CCEA 3MKKA 4BF7A 3BCDA 5AY7A 2PWHA 4P8WA 2D2OA 3CZNA 1UKOA 1DHKA 3SEPA 4V27A 3L2LA 5HOSA 3PHAA 5FCZA 3AJ7A 1F4AA 1KGXA 2ALWA 4W84A 1AQ0A 1MXDA 4A3YA 1JDDA 3VMPA 3MU7A 2XG9A 4D1JA 1TVNA 3II1A 2F7OA 1KB3A 1G1YA 1WE5A 3ZSSA 2J4GA 3GH4A 1G94A 3RJYA 2E4TA 1WB0A 2ZUSA 3PZMA 1B31A 1FH8A 4PMXA 4W88A 2BVDA 2UY4A 3L4XA 3OLIA 2WXDM 1GOWA 4W8LA 3CUIA 1UZ4A 2E8ZA 2CYGA 3CBWA 4ZE5A 3ZT6A 2WCSA 4HA1A 3THCA 3IJ8A 3S2CA 5JBFA 4EE9A 1UD4A 1WZKA 1HJVA 5A8PA 1HJWA 2VOTA 5FL0A 2XTKA 1EIBA 2RGLA 3SUUA 4BQ2A 4F9DA 2WMJA 4DWSC 1XHGA 1U30A 2DSVA 1JDCA 2EEXA 3CZ8A 4R27A 2J25A 5CGTA 2W67A 1TQTA 1KWGA 3BVUA 1E6QM 3A22A 3AHTA 4DUWA 2GJXB 1KXQA 1QNOA 3D4YA 1CDGA 1XCXA 2ZXQA 1JFXA 1H2JA 5E0FA 1XYFA 1R47A 3O6AA 2DT0A 5CPQA 5FD0A 4AD5A 3SUWA 1J10A 3WQ8A 3VU2A 2FYVA 2YDSA 1M7XA 2ZOXA 1ITCA 4TTUA 2OW7A 2BNJA 3CMGA 4IUGA 1GORA 1BTCA 4L4OA 4E8DA 3EDJA 3VO0A 3ZT5A 2WLYA 4FLRA 2O92A 2VI0A 2QPSA 1OBAA 4AISA 4PMRA 2VZVA 4JZ5A 2OSWA 4LYQA 3WY1A 1YHTA 3WMSA 5A6BD 5BCAA 3BVWA 1KR0A 5IXEA 1TA3A 1UWQA 1JZ4A 4U33A 5BROA 1SR0A 2F18A 3OGVA 5IDIA 4MJ2A 1OM0A 4AW7A 3NUKA 3L4UA 1HJSA 4W87A 3OZPA 4CGTA 3A23A 1GJWA 1OGGA 5M5DA 1BPLB 1V3IA 3LX9A 3FN9A 1M01A 4GINA 2A3AA 1E9LA 1GONA 3WNMA 3I3BA 4OBSA 3WH6A 4AD4A 1LWHA 5E6ZA 3RILA 2J7BA 4Q22A 3W0KA 1BYAA 5I0DA 3B9AA 4Y7EA 2FDMA 1LL6A 3LXAA 3CMJA 1JAKA 3WQWA 4MB3A 2J7CA 2XN2A 4ZENA 2EXOA 3ARUA 2VR5A 3OZOA 5IFTA 1FHDA 1IZKA 1VEMA 3OLGA 2BY1A 3RPMA 2CBIA 2XWDA 2YA1A 4XB3A 1R7AA 1OT2A 3ALFA 4UFLA 1MQPA 4D72A 2XUCA 4IISA 4AZBA 2VZOA 3IK2A 1JL8A 1PX4A 1XH0A 4Z2GA 1VAHA 1US2A 3BUDA 2WBKA 3ZJ8A 1V0NA 2IGTA 3AXIA 1CWYA 3B9EA 1ODUA 1MWOA 2ZUWA 1V3JA 1PJ9A 1AQMA 2ZE0A 1E6PA 2WWCA 4P7RA 1FFQA 1AVAA 3A21A 4ATLA 3EDDA 3GXTA 2DSKA 1V08A 5E6YA 2XVKA 5HXMA 1XRVA 4PMDA 1KCKA 3TTSA 1C7SA 1LG1A 3VD9A 1JIBA 4J3UA 1EO5A 1GVYA 4CUCA 1C8QA 1TQSA 5I77A 3SCRA 3AHZA 3CHCA 2ZXDA 1FHLA 2G3IA 5AC4A 1L8NA 4NX0A 1VEPA 4YHGA 4UQBA 1O7AA 3VKKA 7A3HA 1CXLA 1Z32X 1BYDA 2NT0A 2F7QA 1U2YA 8CGTA 5CQ1A 5JUVA 4M82A 1CGXA 4EKJA 1W1PA 2WZEA 1BFNA 1GQLA 1UZ1A 3LPFA 5CPTA 1W1YA 4C7DA 3SCVA 3N1AA 1BVZA 2WM0A 3EJUA 1ISXA 1QPKA 2AMGA 2DH2A 1US3A 4FLSA 4EANA 5F7UA 5D9NA 1SFSA 1NWTA 4MDOA 2W5FA 2CHOA 3FXYA 3MO4A 1E55A 2ZIDA 4WKFA 1B3WA 2VURA 2X2YA 4FK9A 3WF1A 2YDQA 4MTVA 3HZ3A 2WSPA 4CN4A 1L0PA 3ARSA 3VNZA 1HP4A 1XGZA 2VL4A 1EOKA 3AISA 5A6LA 3PTQA 5E0CA 4GXPA 1HVQA 3KZSA 4YPJA 2PWEA 3N17A 5A2AA 3VIPA 2ZX6A 2FH8A 3VIKA 2WKGA 3BVVA 2J8FA 2XPKA 1QOXA 4H7VA 3K8KA 3BAIA 5D9MA 3CZLA 2V3FA 4H8VA 2VMFA 1FOBA 4LPCA 1HF6A 1BQCA 4RE2A 5DT7A 4H41A 2J62A 1KCLA 1JNEA 1H3GA 1I1XA 1ZJAA 2A3EA 1GCYA 3DYOA 1CXIA 1DP0A 2V3EA 4H04A 4NF7A 4DWSD 1PX8A 3AMDA 2BXYA 2ZUNA 2YKKA 5HPCA 4CD5A 4GPNA 1GW1A 3SCSA 4GI8A 1HL8A 3VMOA 1I75A 2YFNA 2WAGA 2CERA 4HP5A 4NXSA 1V6UA 1JYVA 2ZUUA 3HN3A 3T0DA 1E5JA 3POHA 5I78A 4H8UA 4F66A 2YL9A 2NT1A 1E6XM 5CLTA 3WY2A 3J7HA 1NOUA 2O9PA 3GDBA 4YN5A 5DF0A 3BAJA 1R33A 2CESA 4M80A 2OYMA 1N82A 1SZNA 2CEQA 4J3XA 4OZOA 5ABFA 2JF6A 2WB5A 2F1BA 1XH1A 1DTUA 3WH7A 5A1AA 1Q6GA 1ISWA 4RE4A 2DDXA 3SCQA 1KBBA 3AXHA 2QHAA 3SCTA 4PMNA 1KXVA 4HU8A 3KL0A 1V3KA 4PMUA 3VUPA 1C90A 2GJPA 1O7DC 3WD1A 4U31A 3HJEA 1RP8A 1ZBCA 4QP0A 3DX1A 1E15A 1HT6A 4ATWA 3WMBA 2PSPA 3WBAA 3A24A 4M81A 4BQ3A 2GDUA 3UG3A 3NIYA 3NJ3A 3W28A 2VJXA 3THDA 2Z1SA 2UY3A 4PUEA 4Z2LA 4A4AA 3U7VA 3ALGA 1QI2A 4UQ9A 1V03A 1ZBVA 1E4IA 5JBDA 4TOQA 5ABFB 3W26A 1OIFA 1B1YA 4AZGA 1Y7VA 1QI3A 3EMCA 2V3GA 2V3DA 1YQ2A 3VIHA 3GTNA 3DHUA 1JAEA 1WP6A 4TVUA 2VZTA 1CGUA 4BCEA 1KFWA 5ABEA 5E70A 1C8XA 3ARWA 3WNKA 3VGDA 3WUBA 3ZJ6A 1QW8A 1CXKA 3D50A 3T0AA 1IT0A 1MW2A 1QBAA 1WDQA 3AIQA 4L4PA 3EJRA 4JIEA 3MI6A 2WNWA 1BG4A 2XVLA 4UOZA 1QX1A 4UNIA 4UQCA 4HPGA 2OYLA 2WWDA 4JFSA 2XYLA 3AYSA 4JKLA 2O9OA 4AIUA 2TAAA 2X0YA 1DWHM 2VTFA 3AHVA 4W93A 4UZUA 2VCBA 1C7TA 1TQUA 4ML4A 4TX8A 4NXKA 3WEZA 2VCCA 4BQ5A 4AXNA 1E4NA 1C91A 7CGTA 1PZ3A 4P8VA 2F7PA 1LJYA 3JUGA 1MFVA 1UA7A 3FHAA 2WMKA 5EFDA 1BAGA 4AC1X 4MDPA 2O9RA 1RD6A 1PZ2A 4MJ4A 5DT5A 5I6SA 5DO8A 1W9DM 1H09A 5IHRA 4JCLA 2YBUA 2CPUA 3N04A 4MNJA 5IFPA 4W7UA 3T0BA 1JI2A 3DHPA 2VX7A 2HVMA 4CD6A 3VD5A 3WY3A 2VZSA 3VIIA 4ATDA 3N18A 2YA0A 1EQCA 4ZXOA 2ZX7A 3QHOA 1PPIA 4DUXA 2GK1A 2XM2A 3AS0A 4WK9A 4DM2A 1E4MM 3CZKA 4PYSA 4V2XA 4CCDA 1CNVA 2ZXBA 3T2OA 3WELA 2BV9A 2OWXA 4MB1A 1UHVA 4PEEA 2E40A 4CU8A 1EA9C 4FNPA 4DWSA 3A47A 1J01A 4BS0A 1E3XA 5GPRA 3PZIA 3CZEA 3BAWA 2J75A 3H55A 1E9TA 1DWAM 2DPEA 3PZQA 1UYQA 4OJYA 3GBDA 3VNYA 1EDQA 1W3LA 1X6NA 3ARRA 2ZUTA 2DT3A 4UCFA 1X6LA 4UTFA 5FKYA 3DYMA 1FH7A 1CENA 4H8HA 5EBAA 2EJ1A 4UQEA 2IXVA 3S5YA 4LQ1A 2E8YA 1FFRA 2CHNA 4QFUA 2A3BA 1NWRA 2G4FA 4UFKA 3D4ZA 1OIMA 2RGMA 2VC9A 4FLQA 5D8ZA 4AZ7A 3CZSA 5A6KA 1WO2A 1TR1A 5I3DA 4C7FA 3HMCA 2X2HA 3N12A 1MW1A 4MB5A 2D0GA 3SCNA 2OSXA 3AMCA 1FP9A 3ZMRA 3WMCA 2YJQA 3VINA 3M7SA 4ACYA 4AMCA 3DC0A 1W9BM 1CYGA 1WPCA 3FNDA 5A69A 3RM8A 4M1RA 1MQQA 4X0VA 1FH9A 1XSJA 4PMQA 2W63A 3GZAA 3KL5A 3DECA 1QNSA 4TX6A 3TV8A 1EDTA 1BYBA 4TUFA 5CLWA 3PZVA 1KQZA 4J3WA 1MW0A 2IXUA 2EPNA 3OLDA 4PTXA 4RL3A 3S5ZA 1JNDA 1Q6DA 3CLWA 3SCPA 5BXTA 3VIOA 2CIPA 3A4AA 4NI3A 1E4LA 4E8CA 4AZCB 3N9KA 1JYWA 3IAPA 4AYSA 1W3KA 4R5EA 1J0KA 1UQZA 3D52A 1W1VA 4CKQA 4JKKA 1W3HA 4CD8A 2J77A 3ARYA 3F5KA 4UOQA 2YA2A 4N42A 3WEMA 2WVVB 1K9TA 3NDYA 3M07A 3T2PA 2PWGA 3PZGA 2WHLA 3ZOAA 3K46A 4WSJA 3AMKA 2ZX9A 3OG2A 4WSKA 3ZJ7A 1D7FA 2VNCA 3ARTA 5DEZA 2WHMA 4CD4A 1IZJA 3RMEA 2WVTA 4M29A 1OD0A 4QDMA 1W3JA 4W8BA 1XSIA 3PZUA 4MB4A 1NOFA 2BVYA 5A2BA 2GJXA 3NSXA 2EACA 2F1AA 3U7BA 2B31A 2YLAA 4UQDA 3HG4A 1JZ8A 5I23A 4JFTA 3EJSA 1A3HA 4MPKA 2FE0A 1UH2A 1I1WA 4W5ZA 1MW3A 1VB9A 2QF8A 3BMVA 2NSXA 4MNKA 1QWUA 2D0HA 1RP9A 3UETA 2W4XA 1MQRA 4P8XA 5A8OA 2GVYA 1ISVA 2Y5EA 1QI5A 1VFFA 4PRWA 3W27A 3T09A 4HOZA 3AMGA 3OA5A 1OT1A 1ZBWA 3TONA 4TXEA 2UY5A 3PN8A 4FNSA 3MV01 3GNOA 1GPFA 2WANA 2QLYA 2XGBA 3CHEA 1NOWA 4AY1A 4QAWA 3CUJA 4GI9A 1KTBA 1GJUA 3WUFA 3AIRA 2QMKA 4GZEA 1UH4A 1NM9A 3L4ZA 5A6AA 1GOQA 3ZSTA 5A6JA 3UG5A 1KR1A 3H53A 3PZTA 2G41A 3EYPA 5CJ5A 3BUIA 1WDRA 1E0VA 2WSKA 1ECEA 1E6RA 2JIEA 2Q8XA 2BFGA 3MMWA 2YL6A 5A8MA 4DUVA 5C8BB 3CUFA 1A47A 4XUYA 1JI1A 4U2ZA 5E9AA 1KWKA 4TVDA 4J28A 4GQRA 1J0YA 3WN6A 3HU7A 4IM4A 1ZJBA 5ECUA 2OWCA 4JFVA 1ITXA 4PSRA 5BRQA 2IUZA 2JF7A 1H0IA 1CXHA 3AROA 2A3HA 2EQDA 5EMYA 4M56A 1CXEA 2VX4A 3K4AA 4H2CA 4JFWA 3GNPA 5HBFA 2VVSA 1TG7A 4E2OA 2X8RA 3AHXA 1PCPA 1H1NA 5I24A 3SCUA 1HNYA 1GNXA 1J0HA 3BCFA 3I3EA 4AIEA 5DMYA 3VGHA 2D23A 2D20A 2Y4SA 3VTRA 1EOMA 4D6EA 1HJXA 3BC9A 1UKTA 4S3JA 1RPKA 2C0HA 2J8GA 5C71A 1E56A 1E6SM 1HIZA 1OINA 2VX5A 3GXDA 1CECA 2DT2A 4W86A 3BUQA 3RM4A 3KL3A 2X2JA 1CEOA 3VDHA 4KRTA 1U33A 1WZLA 1AQHA 1GOIA 4PTVA 3MV11 4ZEPA 3EJQA 1UKQA 3T08A 1WDSA 4A3HA 3O9NA 3W38A 1PS3A 2UWFA 1W91A 3FAXA 5GNZA 3IJ9A 2EABA 3AZSA 2JEQA 3WF3A 1EGZA 3A6OA 2DEPA 4UOJA 3SCWA 3D3AA 3VPLA 3E1F1 2DSUA 1B30A 2YDRA 2XIBA 1XC6A 1TCMA 5CPSA 1H4PA 3L2MA 2CXGA 1DEDA 4JCMA 2XGIA 5C70A 1E3ZA 4CU6A 1QW9A 4FNRA 1E6ZA 4B16A 5A3HA 1J0JA 5CG0A 3BH4A 1GOMA 2G3JA 4J3SA 3CO4A 2ZWZA 1C3FA 1HTYA 1VFMA 5GNYA 3VGBA 4AD2A 3UESA 4D6DA 5JIWA 3A5VA 1UD5A 2C8NA 4GKLA 2W91A 2J78A 2XM1A 2CCRA 3U57A 1WKYA 3FAWA 4XZBA 4FMVA 3PBGA 3ZJKA 2VR4A 3HG5A 1VBUA 1DWJM 1E1EA 1BG9A 1CZ1A 4PUDA 4E4PA 2GJRA 4PMOA 2EPMX 4GIAA 1BSIA 5E09A 4D6JA 9CGTA 3EJPA 1BVNP 3WQ5A 1KGWA 4F79A 4WIWA 3RO8A 1UG6A 1R75A 1UD8A 2GUYA 1Q6EA 4J3VA 1KXHA 3IJ7A 1UD3A 3UG4A 3WUEA 1XCWA 3PZNA 2WMFA 3WFLA 4AWEA 3GXIA 1DWGM 4ACZA 1EH9A 1K6AA 2VCAA 2XJ7A 1R85A 4PMYA 3DX4A 2OWWA 4GQQA 3ECQA 1UR2A 2BHUA 4WJXA 3AOFA 1QHOA 1CGVA 3WDQA 1QNPA 2DSZA 2F7RA 3RDKA 2EAEA 4HMCA 3A4XA 2QPUA 1UR1A 4MNLA 1UWRA 3MS8A 4PMVA 2WZIA 3WQ4A 2XVNA 3CTTA 2BS9A 1H5VA 4YHEA 4QCEA 2G3MA 1EQPA 1TQWA 3BXWA 1JF5A 4WKAA 4W7WA 3G6MA 1NWUA 8A3HA 4WF7A 1PS2A 1JD7A 1J12A 4FNUA 4J3TA 1G0CA 1QNRA 5M03A 3TP4A 4KWUA 1R7OA 3K1DA 4FNQA 4K68A 3WY4A 1GOOA 2D24A 4LYRA 3MMDA 1XD0A 5D9PA 3QHMA 3TA9A 3GXPA 1H11A 2E3ZA 3SCOA 3BVTA 4Q7NA 1XYZA 1E71M 4JAWA 1HXKA 2G8ZA 3APGA 1UR0A 1V6YA 1NWSA 3LXCA 3TTOA 5DFAA 2UY2A 4B9ZA 3WDIA 1UH3A 3GM8A 5M17A 1JZ6A 3AS3A 3VDBA 1BGGA 1TMQA 3EDEA 2E9LA 4X9YA 5I5RA 4NSBA 5A94A 4AZCA 3KWXA 3BAXA 3MUIA 4D71A 3ZR5A 2EPKX 1UD6A 1JZ5A 5CSYA 3B9DA 2XFYA 2X1IA 2WVUA 5JBEA 1CLVA 1R46A 3A4WA 3W4RA 1PBGA 1CGYA 4MAZA 4AEFA 4XV0A 4P7QA 2WMIA 2DGAA 1EDGA 5FIPA 3SIMA 2WC3A 4Z2KA 4XZWA 3CZGA 5I79A 3OBAA 2VX6A 1HWWA 1OGSA 1UD2A 3WDPP 4GZIA 3F5LA 4Z2HA 5D9OA 4JHZA 1WNOA 1JFHA 3NSMA 4W7VA 2JE8A 3CGTA 2FHCA 1WZAA 5LYRA 4M8UA 1IV8A 3ARZA 2WCGA 1QI0A 3CUHA 1J11A 1QHZA 1EHAA 1GQIA 4AYGA 1B0IA 4URIA 3EBVA 3LPPA 2OSYA 1J9YA 3AZRA 4P7LA 1WZMA 2YL8A 4AZHA 4MAVA
chains in the Genus database with same CATH superfamily
5EOQH 1BTMA 1SMDA 4RFNB 4P7OA 4CCZA 3K74B 5F72S 1X5MA 4HC1H 1F4HA 2WXFA 3LV3B 4UNUA 3SE8H 1FE8L 4A2GA 2Q3RA 3A9BA 3TNMA 4ILSA 3TW7A 2B81A 1KCVH 1BVKB 3SRDA 3D08A 4GO9A 4EZLA 1A14L 5FO7A 5A8QA 2BJML 1EZSA 4FA3A 4L23A 1E0XA 3IXAB 3UEQA 4V1DA 3SDXE 4IYKA 1P0EA 3TSDA 4Y4KC 4OFIA 4WV1B 4NWTL 2BHZA 1TIMA 5GJSH 5DI8A 1LK2A 1DUYB 5CZ0A 4NPYB 3BDXA 4G8GD 1BQ5A 5D96B 1NAKL 4QHUB 3FTSA 1BXCA 1S78C 2FT7A 1LQ2A 2IEPA 1ESWA 4ENZA 4XZHA 1KB9J 3T2QA 2J47A 2F54B 1OP9A 2FJUB 1SN0A 1CLOH 4MAYA 4U0QB 1I2RA 3KAOA 4JN7A 3DH7A 1HI7A 4Z8FH 1XCQA 4KTDL 3M7WA 3TLLA 4AUJA 1PL3A 3NXFA 4U6YA 4C90A 4H1ZA 1HZHH 1R34A 3PWNA 3QDGB 4ZT1A 1E7VA 3HAEH 5DJ6B 5SX5H 5CGMA 3H4FA 4F2UA 3IXTB 4Y9OA 2WKOF 3TTQA 3VILA 1KJVA 3CV7A 3CEUA 3BHBB 3P5YA 2PPAA 2VR7A 2MOQA 3ILDA 3KJ6L 1FKXA 1NY1A 3ETBF 2XHNA 4WGWB 2DZUA 3CPGA 4GQ9L 2HJPA 4JB9H 3LV6A 4FABH 2CO7B 4DN3H 3GSVB 4NKMA 3G77A 5A6BA 2J8OA 5D04C 1SLUA 2ED7A 2O5NA 1AGCA 1TFHA 3AIWA 3F4NA 4PULA 3OL2A 1N7ML 1P6WA 3N85H 4AM0A 1KBLA 3GR4A 5GHWL 1PKYA 3MUZ1 3D87B 1ZEAL 1AQDB 2ZP9A 5KITA 3DGRA 5D93B 1KT2A 1MI5B 5ESVA 4APXA 5CD3A 3MJ8B 1UB6B 3FCSB 2VXQH 3LZPA 4HF5H 3JTSB 4XVUD 5DFWH 3LPOA 3QZNA 3CCHB 3KBHE 3BUYB 2I7GA 5BWAA 4J27A 4PRRA 3G6JA 2AHIA 3MBEA 3ROOA 2XPYA 1KPRA 2Y07L 4H6RA 2IFFL 4XB8A 1S5WA 1U8HA 1YXYA 5SWQB 1I7RB 3NCEB 2AQRA 4PJAF 3LS5H 5H8DA 4ZMOA 4QHLA 3G1FA 1P7HL 3ISYA 3SKNB 3MA7A 3T3PB 3QZAA 3AQDA 3QBTB 2ZZ7A 1FBIH 4YYFA 1DBKH 1MJ8L 5T3ZH 4A8RA 4V2CB 5I2UA 1TUPA 2UY6A 2A21A 3EBAA 3MACL 3AIUA 1BOGB 3ZMEA 5K9JH 4Q32A 3IGFA 2MCG1 1G6RA 1NKGA 1ISYA 1W9VA 1T0MB 1DE4B 3EOYG 1NSNH 3N17A 2G2RB 4N4QA 2EBNA 4NJHA 2ZCZA 4Y2OB 1G7HB 2B0SH 2BXZA 4XCEB 4XBEH 1XLAA 2WCAA 2KDGA 2DU2A 3QK0A 1SFHA 4MDJB 3PPGA 2R0WL 2PYEE 4JQIA 3JR2A 3COOA 1KEGL 4GS7B 1EJXC 1T5XA 1BVLB 1U3ZA 3QUYD 4ADUA 4EIUA 1KRAC 4KY1H 1L3WA 5ALBH 3AWGA 1XLHA 2L5HA 3CB8A 3TCLA 1JCJA 4ELMB 5KYXB 2Q3AA 3VM7A 3B6SA 1EUNA 1NQ6A 4C91A 3HIZA 4FMKA 2NZ9D 1G87A 3WLBA 3Q8CA 3WSQH 3NPSB 1MLCA 4AM0B 1FWDC 2Q6WA 3LMYA 2EO7A 4LBEB 4RGOH 4IK7A 3R0UA 5F4WA 1YEEL 3S3CB 2JKEA 4FF5A 1SJEB 1UXLA 5EF0A 3W2UA 2H0JA 4CNTA 2QT3A 4YXHH 4PGEA 3TO2B 3ZIYA 4LSQH 1KCRL 4H88H 1W0MA 3CCHA 2CIIA 2WNXA 3Q44A 4PRNB 4ZTOH 3GH7A 3BLDA 5CP7B 5G5IA 3UR8A 5TDPB 3BKMH 1O9ZA 2C3XA 3RPKA 5E8DL 4OCSH 2A9CA 2ZUXA 3BUPA 1R9FA 5F6HJ 3ITVA 5CBJA 3PGFL 1R3JA 2V30A 4LUSA 3OTRA 1ORQA 1QSEA 5EU9A 3RDTB 4WKHA 2DEWX 5G4OA 1CXFA 4ZXLA 2WSYA 4YCPA 1UOKA 1IC1A 1I9EA 1TTAA 5I3JA 1WGOA 2VUYA 4L3EB 4UR9A 1KFAH 4PG2A 4Y6GA 3PJLA 2BNUB 5AWNL 1KJ2A 5IBTH 2EE0A 4UUIA 3LLDA 1F3WA 2ADIA 3WK3A 1F6AA 2YUZA 2NXYD 3DDGA 4LWWA 1NGYA 4JE0A 1G7HA 4BKTC 1NFDF 1GZJA 1ITUA 2FQDA 4MDJA 3PHSA 4MF4A 1IQWL 2IGFL 3U7AA 3DBXA 3W29A 1VCGA 1J9TA 2W92A 5F1NB 4GIOA 4DWSB 2P80D 3IFNH 1NAML 4NAJA 3QVQA 5M94B 4HCIA 3T4YA 3KCJA 3SUTA 1F9CA 2NTFA 3WX7A 1CF8H 4LV4A 2WKOA 3IB4A 1BF8A 2QSCL 1E5NA 1RPUA 4XN7A 3U4EA 1FWCC 3ZVHA 3L45A 5GGRY 5DHDA 1O12A 4NCC1 2GUUA 4MHHG 4GGHA 1SJEA 3MRDA 3EH3B 1NIBA 3ITGA 5F9DC 1A3RH 3HNVH 3ZRFC 1XIHA 4F3HA 2WHKA 3LEPA 2DZVA 3P7YA 1WFOA 5DX7A 5I18H 5B7YA 1HYRC 5BMFH 1D3CA 4A2EA 2JJTC 3AT9A 4R84A 1OCNA 1JPHA 1I7TB 3QJZA 1RQ5A 4LAUA 3TO4B 3MRIA 4HK3J 1XLCA 1WVZA 4EP8C 2BSBA 3MYPA 4GSDL 1EBPA 1PS9A 3MP5A 1NPNA 1ZLVK 3KJ4C 3OWRA 1HKLL 4Z3JA 4U1LB 5JMOC 3D0CA 4QJ3B 4EZMA 2Z4TA 4J4PD 2P7TB 4M61A 1JXDA 3ESUF 5DHVH 3MCKB 3D39D 3ELFA 3LRLA 4PUBH 1HILA 1XQLA 3QFJD 1FN4A 3UVAA 1YJDH 5I1CH 4NRZA 3SI9A 2P5EB 4G6CA 1G9EA 1A5UA 1U8LA 3QUMB 3MUCA 3E80A 3APYA 2NY3C 4UTBA 5AYBA 2DS4A 3JT2A 3N0AA 1TPUA 2YXXA 5A16B 2ISVA 4PTDA 2AJUH 2PCFB 3AXMA 3KRSA 4CCCA 4L4TA 1AZNA 1BHGA 2EUZA 1FSKB 2AQ2A 1HFUA 2FL5A 4G5ZL 1SVDA 1TV3A 2X41A 4U1HA 2IMRA 4XKYA 2V9UA 3EGSB 3JWNE 1IGYA 4WJ5B 3A6BH 1CTMA 3MGTA 4WUUA 3BIKB 4FQIL 3BN9D 3RKDD 1U8KA 3FOMB 3FQ1A 2ODIA 2VEKA 2HUEA 4LF2A 1SQ2N 2CO4A 4LL4A 1AMYA 3MCMA 3RY5A 1AR1D 3QYNA 2ZZ5A 3ALPA 4YU1A 2P8MB 2FKPA 2EIMB 4JHWL 4QJ5B 1G4PA 3HFTA 3BKCH 1JHTB 3WE6A 3X1FA 4HHAB 4TIMA 3MV9E 3DV6B 4ZGYA 1T6VN 2EC9U 2GTQA 4A63A 3WMLA 5AC5A 4I77L 3WJLA 4JRWA 4GMEA 1QVOB 1QBBA 2VQTA 3Q5TA 5ILTL 5ALCH 3JWNC 5I1EL 1JULA 2GW5A 3V8OA 3GG0A 1Q7QA 2V8ZA 4IPNB 2L7QA 1V93A 3DI0A 4MMZC 3OJMB 4R8WH 3TIMA 5HI4D 1AR1C 2UYLB 1FNGA 1NQBA 1JGUL 1HIMH 1LEKA 3KTSA 2HG0A 4FQXD 1E5BA 4DW2H 3EWCA 4R7NB 1H0GA 3U48A 5KBMA 4W6WB 5IJDC 1GZHA 1I60A 4AMXA 1PZDA 1Z2KA 3KP1A 5BWFA 1DN0A 1YAIA 4U5IA 3WUZA 2P46B 4EXKA 4LDLB 1KQYA 4IFKB 4QG9A 5IBXA 1CL7H 1W72A 2N7BA 4HNCA 3MBED 2YPKA 1QTPA 3FB6B 3AIBA 1K70A 4G6FB 1D2KA 1MUMA 1KOAA 4N2GA 1BGXL 2J1ZA 2J8UF 4GO8A 4U1HB 3LZRA 4I5UA 4XXWA 4AWUA 1CI3M 2JKRM 5LN8A 4Y89A 2WOYA 3VFVB 3P0YL 5JVLA 4YNYA 3BSHA 2PGFA 2B0MA 4GYPC 3WLQA 4PVMA 2NQHA 4A2SA 4X6BB 1TF4A 4Q6KA 1OWQA 4Q58C 4JEQA 3UTTA 2WLHA 4JD4A 1G7MA 1HHGA 2YGNA 4D6GA 1PLBA 1VA9A 3H54A 3T0XA 5IIEA 4LLWA 4PJEF 2BIIA 2LQRA 4FP8L 5A5WA 4PV8A 3EFFB 1G6RL 3T6QC 4P5TB 3S42A 2YAFA 3NSFA 5FYLD 2WWMC 4OVUA 4YHYB 3ZN6A 4GSQA 5LNGA 1Q85A 1TYGA 4IJ3C 3TN5A 2V4LA 4UNTA 2W5PA 3GYCA 1VHCA 4JDBA 2APSA 2BH0A 1FL6B 5ANMA 3R0KA 3JWDL 2W9DL 2ZTBA 1TENA 3QWRA 1AK5A 3RZWA 2GFBA 5ECVA 1A7NH 2DN7A 2AVFA 1JNLL 2Z24A 3HJZA 4GJ1A 3XISA 4WRHA 2AJVL 3DIFB 3ULUD 4RNIA 3MRHB 3H2QA 1X5AA 4UFJA 3FHQA 2J2ZA 2NLJA 2NPLX 4GP5B 5L0QC 4CQ9A 3GIQA 2JXMA 1NC2A 3ABSA 3BGAA 3O6MH 4NAMA 4X4XA 4C54A 1XDTT 2F58H 1CFVL 2B59B 1W72B 2FNBA 3UWYA 3D5HA 1EAOA 1OAKH 1TJGL 3LA4A 1ET5A 1TELA 5DRCA 1SBBA 1TPXC 5FEPA 3I84A 1E9ZB 2X4NB 1JPMA 3CHQA 4MBOA 5J4MA 1XBVA 3V0UA 3GSXB 5HMEA 3GDKA 2V17L 1G9MH 1O75A 1X5FA 4I48A 3U0PA 3ME0B 3HV9A 3VXMB 2BB0A 2H3KA 3A4EA 4NBXB 1XUUA 5MHSD 4HNOA 4QEHA 3O07A 4IMCA 3H4HA 3B5GA 4DX3A 2Z91A 3VGGA 1QHPA 2QUVA 3MSGA 3R1GH 1JGDB 5BV7C 3PREA 5A6TC 2CSPA 5B4MD 4N2CA 3TIEA 3UAJC 4U49A 3W5NA 1FA4A 3DOSA 3E2HB 5ESQB 2J74A 4PJAA 3K4DA 1UQYA 1UROA 3WIFB 4IIGA 3UA4A 2HKHL 2VABA 1MYRA 2P5NA 2KLRA 1K9EA 2HN7A 1J8HE 3CFCL 3CHSA 2M1KA 3EF7A 1Q9OB 1H7NA 4AWSA 5MHBA 1KY7A 2G5WA 4KPLA 4GI4A 1U2CA 1XGUA 1RUMH 4I3GA 4M43L 1X7QB 4ZQKA 3TOYA 2D0FA 5D93C 3IPWA 4HTYA 1XLDA 4MD0B 3NQFA 2BY3A 5D2WA 3TWAA 2FIKA 2C71A 1L6XA 3O6KH 4BJLA 4N2MA 3GHEL 1R5IA 3I75B 3LEXB 4YE4H 3AIVA 1WIUA 4JAMB 3NABH 1J0ZA 1WGVA 4WHCA 3CQQA 2GVLA 4PJGE 1IFHL 3VOIA 2YD8A 1SMAA 2G3XA 1VFUA 1NC2B 2X6UA 3II3A 2ZWNA 2CBJA 2VLKB 3MYJA 1E2ZA 5JHLL 3IFOA 2RDXA 2H9AB 3P2TA 6PCYA 4DGYL 4FQQB 4JTHA 3E0FA 1SO3A 4Z0BH 2AQWA 4NX5A 2WBGA 4O1FA 2IBGA 3SJVD 2ZA1A 1XZWA 4EACA 3BD3A 4JY4A 4FFWD 1LP9A 2WV3A 4TRPL 2IG2L 4JIQA 1ZT1A 2QTEA 3RUGF 3TJHD 1FZKB 5HHXH 1KSRA 4WLCA 1SYTA 4XBJA 4C83A 4L9LB 3RITA 3LQAC 3B0XA 1EC9A 5D96C 4FKKA 5F89B 3CH8A 2PDJA 2Z6FA 3FT2A 4YE0A 5PAZA 3M6DA 4RX4A 5CIPB 4ZVJA 2Z64C 2CUIA 4S0SD 5K59E 1W2VA 3VA8A 4APQB 3MCOA 1FFNB 3DX5A 2EKCA 4GA8A 1AY1L 2HK0A 3I7SA 1CDJA 3GI9L 4KX7A 3F83A 4WGVB 4X99A 4JTCA 4MSWB 1B0RA 1XGUB 4EIBA 1I4FA 4R4NC 1X7QA 2QR0B 4YXKH 2DIKA 4O10A 2VRKA 4FX8A 4H8WC 2E1WA 4J3OF 1TIWA 2A4CA 4JO5A 4OLXL 1KDJA 1VGEL 3PAYA 3UZVA 2PU1A 1UJ3B 5I1GL 3U5UA 1A3LL 2WUCH 3IU4H 4BA0A 4CU7A 4R7XA 2F1EA 2WQPA 1K72A 3V36A 4ETYA 3SGKC 4ZG1A 1NCBH 1RJCA 2YW3A 3DETC 3L5MA 2W60A 1JGEB 2ADGB 5F7BA 3EW3B 4FTDA 6FABH 5I17B 1WAWA 1P7BA 4O50A 3HBPA 5I0YA 1O7SA 1XG3A 4CD7A 3H2PA 4U2YA 3GIVB 4Q8NA 2F61A 1IEHA 2P5PA 1G9HA 1OB0A 3B7YA 2HTMA 2YBTA 5KZDA 5H8MA 1HL4A 4PYSA 1DYSA 2L7JA 4J1UB 1A9BB 4GNKB 4J7RA 4KRPD 4PRIE 4DP1X 1GQNA 2JGYA 3EBIA 4LX4A 1G84A 2AKRA 1KLGB 2IWFA 3VFUA 5AKQA 1NBYB 2VDNB 3UVIA 4LSRH 1OANA 4M4RB 3PL6D 1KIPB 5DEJA 5KJRL 1K9DA 5D7JD 1NCCL 4HSOA 1NIUA 4Y9MA 1D9EA 2Z7ZA 4CBZA 1BKHA 4F9LA 1PIIA 1VEOA 3CC5B 3DRQB 35C8L 1KCXA 3W6MA 1AG0A 3QUXB 3QEUB 3D4GA 1G4EA 4JTSA 3QIBC 4ZFGH 2O93L 3QDJE 4RUBA 3MJ9A 3VSVA 1MCKA 2DQHL 2YD0A 5I73C 2AZAA 5I74C 3UZWA 4AZ6A 2DL2A 3W24A 5HYJA 5FR3A 2D3LA 4AVIA 5D9SB 4W68A 3OGSA 3L54A 1B6UA 4HJUA 4GUPB 4X5WB 4AEOA 3P0XA 1C12A 2LU7A 2BIOA 3AU1A 3T65B 3LG3A 5I30L 4IRSB 2HVBA 5D8JL 3MLXH 4JN2A 3SE8L 1IM9A 1BYOA 1UQSB 4OIBA 1ZNNA 4B92A 5CEZH 3R10A 3V18A 2OYKA 4EX4A 3WSUA 1KBGH 4ZFCA 5DK2A 3MRBA 3V4PH 3T8VA 3ZYOA 3MV9B 3WQVA 5I1HH 4I7VA 1NANI 3SDCC 3VQ2C 3BP5B 4HSNA 4Q9QL 2R2CA 4IDJL 4PS4L 2H6PB 3MHFA 3WF0A 5M2FX 2VJ8A 3R7MA 4H25B 4C4UA 4NBYB 5B38B 2G0LA 3IKCB 5KBDA 1FUYA 1T1ZA 3ZDXB 4POYA 5DEGB 1TPB1 4L3CB 3UGRA 2ARJQ 4CBPA 4PUMA 1PFOA 3VKCA 4KJPD 5JW5A 1OSPL 1GKPA 4FG6D 3UXIA 4HGKC 1GTNA 4MS8C 3SPVA 4F58L 2Z1VA 2ZRZA 1NBYA 2WCPA 5JTWA 3NBNA 3NZQA 5EORH 3NZ8A 3MI3A 2CIKB 1ZTVA 3OJVC 3S9DB 3V4LA 2XNAB 3CMOH 2XV6B 4HHGA 3DFQA 3QPKA 4KKBC 2CLVA 3SKOB 5JPNC 2WW5A 3SUVA 2VLKE 4QXTB 4UBDD 3LNDA 2X0HA 4QLKA 2Y8VA 3IANA 1ZJIA 3P1VA 4BFBD 4UV7L 1RZIB 3MRKA 3HMJG 2K1MA 1VS1A 3IAGC 1I8LA 4XPGH 4XMVA 1A53A 3CIVA 1F42A 4LSQL 4FCHA 1P0DA 4OUEA 4WWOA 2XKNA 4IQJA 3R0NA 4JDEB 4QGTA 2E6DA 3D39A 5HDBE 3OGCB 4AGPA 1LL4A 1DBML 4H00A 5H4YA 4IKKA 5EOTB 4J40A 4IRSA 1OGBA 5KWYC 1FL5B 3TOPA 4V28A 4YPGA 2D8KA 1B3ZA 2WQDA 1M05A 2TSAA 2UV3A 3UFIA 3EGJA 1KGUA 1KFKA 1AOZA 4HPJA 1DPMA 4D8AA 5IM7A 3NESA 4N0RA 1J8HB 1EHXA 1TE6A 3BGGA 2BIMA 3TYUA 2KL6A 5FFGA 3XIMA 1HYSD 3SQSA 3TW9A 1RUPH 1UXWB 4N8VG 3F84A 3TH4T 5HYQA 3IIXA 2QPFA 3I02B 5FA3A 5JHDD 2YRLA 1KZQA 2C16A 6A3HA 1TTBA 1GC1L 3MRCA 5JW5B 1N9PA 3BKCL 3GS4A 3V9EA 3IJEA 5D7IA 1CMOA 1C93A 5HPOA 3L21A 5D33A 2GTWA 3G5EA 3BKJL 3H3BC 2PP1A 3VWJC 3UTTE 4Y9AA 3MSYA 5BXSA 5DRZA 3NZ8B 4JRXA 3TZVB 1TJ2A 3IGHX 3VXUD 3F00A 3OC5A 3D09A 3BSGA 4BFNA 4GG6A 1Y5XA 4NO2A 3GIYA 2Q86A 4ZW5A 1I45A 3WQFA 1JE6A 3CFMA 3OKKB 3E12A 3TA3A 4IKJA 4R8WL 2PTTA 5JHLA 3WNLA 3EBHA 2HB0A 2PF0A 3S48A 1J1OH 5LSMA 4P5TC 1BQUA 3NCOA 5DHYB 1UWTA 2VEIA 1CBJA 5F2GA 1R2TA 4PP1C 5EUKA 1JTTA 2ZNWA 5C0ND 3IJYA 2AJYH 3QEGL 4B7LA 3A67H 4MJIB 2BOBB 3W53A 4MD4B 5GQBA 5GNXA 1T0NB 2DLGA 5EIIA 3FCTB 2G9HA 2HKFL 4RE2A 2B1OA 4J12A 4K9EC 5FHAL 2CO3A 3TH6A 3CC1A 1I2QA 4RETB 2YS4A 3ABQA 1ICTA 2EPOA 2AEPL 4DJMA 1QRQA 2FATH 3HS0C 1Q6CA 3ITTA 5DLCA 4B3LA 2CITA 2HT2C 2O5XL 5T1KA 2NX1A 1ZBKA 1UMLA 3R4DA 2VLMD 3UTSD 3WZ0E 2NR6A 2V82A 3UTPD 4PJXB 5AEAA 5DD5H 1SN5A 3OKOB 1MCJA 3I6LE 1ADWA 3JWNH 1E9QA 3GPSA 43CAB 2HISA 5SWUA 3PWGA 1UKPA 1TQVA 3GO1L 3QG6A 2GFTA 3QA3B 5FYLH 2O9TA 4RE3A 3ABKB 4UB0H 4AWTA 1D5XA 3KXFA 3B2VH 4R3SB 1NCAH 2ZXAA 4JFPA 4YHZL 5C1MB 2XN0A 1E42A 4RAVA 2PODA 2VZUA 1S78D 1T03H 4LYKA 3RGVB 4Z2JA 3T1WA 1VADA 2PD9A 3QS3A 2WPBA 3LRSA 5AW3B 3VFGH 1EC8A 1UR9A 2BNQE 3WL1A 4C6FA 1HVXA 2YFOA 3GJFK 2YPLD 4DZ5A 3KGUA 1R5VA 1O6VA 2DQEL 4PJ8A 1WICA 3VSQA 4B9PA 2PFHA 4OUIA 5HHMB 1FH5L 3T3PE 5CKGA 1JGIA 2DYPD 1W9UA 1XF4B 2GUOB 3U4BL 2Z6JA 2H0FA 3PLYA 3PP4L 3MC5A 4O1BA 1A1OA 3VUSA 1U58B 2XOTA 1XSKA 3PWUB 4G6JH 2ENQA 4ODSL 2XC8A 4MJIA 5CAYB 4X50A 4FLOA 3BZEA 1OYBA 1WKEA 2JIWA 3KTXA 4H0HB 5DJAB 4PUWA 4EWND 3KYNA 1XB3A 3D85D 5E6ID 2HWZH 2OB3A 2FBRA 1TYRA 1M7IB 2MQCA 3NSDA 4XO6A 1EO7A 1YECH 5G2NA 1NF7A 1ZP3A 4P2OB 2CNCA 3II2A 2Z93A 4QT5B 1LQ0A 3BLOA 3VOCA 4N0CC 1I3UA 3KPTA 1TPWA 2JF1A 2R2HA 1P69B 5EH1A 1LO4H 2EKSA 1E28A 3UIYA 1BFVL 3VD3A 1XR8A 4N1CA 1EEUA 2GUBA 4JZJC 3W0WA 4A55A 3G3LA 2VDMH 5DJ8A 2EJAA 5CJXA 1OD7A 2I9TA 1I7UB 3GMPB 5G4EA 2OLHA 3DENA 5TGBA 3KPQB 3M0JA 1W9XA 3UROR 1GHSA 2WXPA 1GQKA 3SN0A 2CRIA 1LG2A 2R83A 1LRNA 3DLQR 2LGNA 1ZHNA 4JQ3A 4PUBL 3N11A 5C9ZA 3B06A 2XTJC 1N2RB 5LHEA 1R4XA 1PLCA 1AMXA 3ME3A 3KNBB 2WVVA 4GG6F 2F74B 5EEXA 4BH7A 1ES0A 1WBJA 3DROB 4K7PH 1A66A 3H22A 4C6OA 1JMXA 3MKKA 1PSCA 1IGMH 2EO9A 2DLEA 4OZ4B 3GU2A 4I1NB 2AGTA 5CP3A 2AGKA 1B4TA 1XCTB 4PJ8B 2C9RA 4CMMA 3MWCA 2MKWA 5CBAA 4MA8L 5FA4A 3V2AR 3SEPA 1TQCB 5A6IA 1V27A 3NJFA 1YO4A 4JFFA 5CMAA 4Z0SA 1BVWA 4Z7QB 3SZ8A 3TNNA 1G9NH 2HNEA 1NMAH 5FCZA 1Z1WA 2TRSA 2JKNA 1LP9E 3MOAH 4WHBA 2YSSB 1VCVA 3D18B 5F7EH 4MJID 5HPMA 3BJFA 5DZAA 5HGHA 1TSHA 1MXDA 1GT8A 3S46A 4A3YA 2Z0UA 3VMPA 3N41B 4IJBA 3E3HA 3DIDA 3STZA 2HLAA 3PPHA 4PG9A 1ZTXL 1TVNA 1TQBB 3II1A 5TPWH 1ILSA 2ADYA 2F7OA 3N55A 4WI0B 1ACZA 3RRXA 1KIQB 2NY5C 1XR9A 2GGEA 2ZCLH 4LLMA 4E9XA 1IIHA 4QF1B 1OG0A 2J4GA 4O19A 4MKMA 4AYBA 3AUJA 5C0DB 1G94A 2VDPB 4ZDHA 4UIKL 4XVTH 2E4TA 3C60C 3ZTDC 2AVGA 4MWAE 3GRWL 3NCJL 3VRIB 2OCJA 3I74A 4F57H 4PMXA 3ZFHA 2JCCB 4W88A 3QLLA 4OQVA 3F2CA 5I2IB 1NEZG 5BOPA 2WXDM 4XNUH 1E51A 2DVXA 2DF3A 5LBVA 1PSKH 4MAUH 2V68A 4W8LA 4OY9A 2CUHA 3BIBX 1QBMH 4GXVH 3ZHNA 2BMBA 4ZE5A 2IWEA 4K8RL 2NW3B 1TTJA 3T5WA 4XTRC 3WN5B 4CMHB 4KFOA 2Q8AH 2WXMA 3CH1B 3GXUB 3ZE1B 3D06A 2AEQH 1RURH 3FIGA 3STBA 3CFCH 4S3CA 3MJ7B 2VAJA 5FL0A 3ES7A 1WC7A 4C6IA 1IBZA 2WQAA 4JFFB 4L1HA 1R3KB 1AP2A 1G6VK 1WUZA 3B56A 4OLUL 5F21B 2OO6A 2J6WA 4OJFH 1NBVL 2OP4L 4XNZC 2V6AA 5IM51 3WIIH 2Z25A 3SUUA 1DEEA 3P67A 5EZOL 1F3RB 4BQ2A 1XUZA 3GNXA 3F7VA 1L9NA 4P5MB 3EXLA 4XAKD 4QRTB 3RWJB 5AD0B 4Z95L 3H12A 3MUHL 4O8RA 1ITXA 4QQ3A 1HCZA 1UJ3C 3KDMA 4RWYH 2PDBA 4G43B 4KTEL 3TQVA 3AUOA 1AHWA 1QYGH 1X9RA 4US6A 4KRZA 5JA8B 4O1AA 1LP9F 2J25A 3NG5A 2YZ1A 2KMWA 4GKZA 3AM8C 3M17B 1TQTA 4HQQH 5JW4N 1E6QM 4D0BB 3AHTA 3HFFA 4JPVL 4KRMB 1DXEA 4UTBH 2BW4A 1KNOA 2A1WH 3MBWB 3D0VB 3WL9B 5E8EB 1Q7ZA 1RSYA 3Q6GH 1NKRA 4YL2A 1HJCA 1H2JA 1JPGB 2Y1AA 4N2BA 3VRIA 4WTWA 3NTCL 4LVHC 3V5KA 2NQLA 2FIRT 1KTLA 4H8WH 4HULB 3PP4H 2J43A 3EOSA 3H2AA 3NH7H 3N15A 3GW3A 1EUTA 1F8TH 4HWZB 3GSOB 2CDGB 4QR7A 3SJVA 3V0HA 2A6IB 3H3KA 3S37L 4AH2B 5C7XH 4IF2A 2R23A 1NL0L 3INUL 1J10A 4G9FD 1EXUB 4N3TA 3IWUA 2R9HD 3U9PH 5IQOA 1S2CA 3KOYA 5E1IA 3WQ8A 1TZAA 1UWXH 4JFHE 4DQAA 2FYVA 3VI3E 1F3JA 3VXGA 4P2QA 1L7IL 2DLHA 3MRQA 1SOKA 5EBMA 1O9VA 3SPCA 2J88H 2QGCA 3AY4C 1LO4L 4Y8FA 3VGAB 5BOJA 1Z6KA 2NLIA 1E7UA 4XAPA 3QC0A 2BNJA 1YYLH 2IWGA 1E0OB 3CMGA 2KHAA 4GRWH 2EEBA 1T21B 4GABA 4L4OA 4ZSTA 3S5OA 3WQPA 2GY7B 4E8DA 4R7LA 4FOKA 3Q1SH 43C9A 4ML9A 2DP3A 3ZT5A 1OE2A 4IRSD 2Q71A 2EDTA 5EY5A 2QVIA 1K4DA 5CFAA 1IBYA 3P2VA 1BBJB 5EFIB 1BWWA 2OSWA 4Z7QF 5JDSA 2R0KH 1Z9OA 2NY1C 5IOBA 4PP2A 5DANA 1ANUA 1S8DA 2EXWD 3JYBA 1QFEA 1MRDH 1GVSA 3BVWA 4GUOA 1KR0A 5IHBA 1JZ4A 1TA3A 3NIFF 4O2FB 1EP3A 1B9BA 2TRYA 1JJKA 3VKAA 4EUPB 4U33A 2F53D 3DRTB 5T5NF 2F08A 4NPJA 3B2DC 1NGXB 4MA7H 3LB6D 5D7IE 2FDSA 4UAHA 1K8DA 1X98A 2H32B 4IRJC 1FAIH 1KZYA 3CU1A 5IDIA 1OM0A 3MJ6A 2TMDA 3NUKA 5BRZA 1K03A 1AXSA 4TQTA 1ONRA 2CO2A 2E3VA 5L6YH 3A4FA 3HC0A 1OGGA 1IC7H 2J1XA 4L65A 3FQWB 5CKSA 4C58B 2FO4B 3L5IA 4Z6AT 1QMLA 1QEWA 3FTYA 3L2NA 4KRPB 1V3IA 3FQNA 4WFEE 5FGRA 3W6YA 3PL6A 3QQ3A 1S5MA 5JO5B 4Z3FA 4DJDD 2HPIA 4ONHB 1OOAA 1A7OL 3GSQA 1FZOA 2QSVA 1F6KA 4MCYA 1E4WL 1IO4C 4ZD3H 2WQVA 4OBSA 2R0LH 1YXCA 1JK8B 3VH8A 4AD4A 2QPDB 1AL7A 4X98A 1M3UA 3BG3A 2IADB 5I06A 2XZZA 2RDTA 1UBPC 3NO3A 3B9AA 1HL5A 5AOKA 3ULVH 5BJTB 5J13C 2A4EA 2BZDA 4QHMB 5ICYA 4RZCB 4UUJB 1V5XA 4QKXB 1GMIA 2CZVA 3GE7A 3W74A 2PRMA 4HB7A 2IPGA 4QI3A 4TQPA 4WJKB 3RWGB 5LKYA 2IF7A 3QZPA 4MB3A 4U1KB 2IPKB 3BRFA 2AERT 4JY5L 1AC6A 1GOHA 5HP5A 4K38A 2DJSA 4K15A 4XZUA 5DUPH 2VWTA 4ODVH 4H2AA 4C6MA 2VLJD 3GGWA 5B1JC 3BQUC 3BZ4A 4LSUL 3V0TA 4KDWA 3HIJA 2VR5A 2HLEB 2HP4A 4ZZ9A 4P2RE 1PQZB 2XZQL 1EJUC 1XICA 3NZUA 1KPUA 4FXGA 4PJFE 2OEMA 4YWSA 5GS0L 1PGRB 1LE5B 5F7YC 2JQXA 1KXTB 2PZNA 3HF3A 4PWFA 1KRMA 2XV0A 3LBMA 5LGYA 3KPMA 4DP9X 1XF1A 3C2OA 4P2VA 3MHGA 1TU2A 1TPFA 3PAOA 4WFHD 4HCRH 4X9GA 1SO4A 2FO8A 3P77A 4TVPE 2DTMH 1H5BA 3S5SA 1XI3A 1U3JA 4F20A 1KEML 2FZ8A 4OVXA 4UFLA 1JUEA 1FCGA 4KQ3L 3VACA 2BFVH 4GE8A 4IP5A 4NUWA 3LHPL 4M6NL 3CNYA 4OFYA 4XB7A 3C8NA 1HH6A 1W3IA 3REVB 2E6JA 1GPOL 3O6FA 1JCMP 4AZBA 1BX2B 2IDQA 1EFQA 3C5SB 2IADA 3H8NA 4KKCD 2AJSH 1ECQA 1PG7H 1TJXA 4D8PA 3FA5A 4S38A 4JQIL 2VLJB 1L9TA 1SY6A 3OZLA 4NKCA 4DP2X 1P1ZA 3LB0A 3GIZH 5GZNC 1US2A 4K9EH 3BUDA 1FVPA 2OMUB 4RRPG 1V0NA 4AT6A 4DO7A 5FCSH 3AXIA 4PP1D 4CL7A 2IPTH 3B9EA 2WLIA 4DFIA 4YZFE 3L12A 3L3IB 1JNJA 4JW3A 3HE7B 2RQ8A 4IRJA 1W0YT 1QAPA 4ZXBC 1AGFA 1TTPA 4ZUSA 5BOZG 1IXNA 5HI5D 4I4WB 4K71C 4QXWA 5BS0A 4G9PA 1AQMA 2ASHA 3WG6A 3CVIL 3W2MA 5F1OB 1RK6A 5DMNA 2A9ML 3DJZA 3NZ1A 4U6HA 3ARBA 3MLXL 1BV8A 1T03L 1AVAA 1M1XA 2RCSH 2BGNE 2DJXA 3QEZA 3NA4A 2RDWA 1RHFA 3HPXA 4H2HA 2IV9A 5IB5A 4S3BA 3GSUA 3W84A 2V2TA 4LF3B 1XLBA 3SCMB 3HO8A 1A5BA 3HLAA 1EWEA 3B9NA 1EB3A 3VXMD 5LG6A 1PKLA 1BJMA 3FJ6A 5AZ0A 1SJHA 1J5CA 2Q09A 3P77B 3KPLA 3PE9A 1H5BB 3SN1A 3SRFA 1EBHA 2HTLC 2OX5A 4DESA 2N1TE 3P9LB 3Q9PA 1LEIA 1GVYA 5F9JB 1DLFH 4JUTA 3SCRA 3NSJA 1EFXB 3FQ4A 1Y1UA 3AACA 4JKWA 3V4PA 2I27N 3KCPA 4U4MA 5JHBA 1WTLA 2BHFA 1HK6A 5IB1B 1J5DA 5IQMA 2WNZA 2A9AA 3TPUB 4ABWA 4POZC 5FUOL 3BH8B 3MCYA 1AA1B 3ABGA 4NLHA 1JXGA 3O15A 4PGZA 3EYOA 3T2NL 3SE4A 1N0LA 1BWVA 2I7OA 4I77H 5DURB 4M82A 4PMJA 4R33A 5CQ1A 3WLSA 3W2DH 1W1PA 2RAMA 1EYWA 1WAPA 1D6VH 2WZEA 3P3BA 1BFNA 5LIXX 4JDTL 1UZ1A 1D9KC 3CPLB 4IKIA 4BCZA 5E0QA 1FWTA 1W1YA 3FCPA 5AC7A 1MPAL 3FPXA 1ECZA 1TVLA 4RX0A 5D30A 1XGYH 4FNLL 5KVGE 4PPTA 3RVUD 1BVZA 5JXED 4NWUL 3FO2B 4MXQD 1HKFA 2AMGA 3H3PL 9XIMA 2IVFC 2J1WA 1D8WA 5AENA 1QUPA 1RZJL 5HHQB 1JCTA 1GY2A 4I0PC 1QBLH 3GMMA 3ILQD 1KCUH 2WNGA 2ZF8A 3MV7E 5FYJL 5I8CB 1P7KB 3VFVA 3C0QA 1A4LA 2ITDA 2PRLA 4HJFA 1VACA 5EWIL 1WUEA 2W8CA 4F2EA 3LIZH 3QR1A 4ZUUB 2VDLB 4XSMA 4YHZH 2EE9A 1POJA 2CHOA 3FXYA 2OTWB 2ZIDA 1S7TB 5ICZB 4P2QE 3TN0A 1CW2A 4WKFA 5EB8A 5EO9A 4ZTYA 4Q0XL 2C4XA 5CEZE 3H9SE 1UOZA 4I90A 4MTVA 1J1XH 3E6EA 1BGXH 4KY2A 3G3MA 1S5TA 3M47A 3PWLB 3SDYL 4DQOH 3MOAL 1E4HA 2NR6C 3PK7A 4GUFA 4BK9A 1GWJA 3AY4A 4N9EA 4EF9A 1GZPB 2VL4A 3IGKA 2BVWA 4PBEA 3AWOA 1TKWA 4JPWH 1UM5L 3H2WA 3KLHC 1YZZA 4QXGH 3OZ9L 4LCIL 3KZSA 4YPJA 2GJ6E 4Q89A 1DORA 2XZCL 2E25A 5HYSA 2EHHA 2J5LB 4YDLC 1IEBA 3ERXA 3VIPA 2EH8L 3CDZA 2B3IA 5J6HB 3EGDB 1HEZB 2FH8A 3VIKA 5IF0A 2WKGA 3H70A 5CJBA 4KXZH 3BTNA 5MEQA 3IBEA 4H7VA 4R2GD 3ZE2F 3BAIA 1ZA3B 4TM9A 1Q0YL 1RULL 5JW3L 4AZ8B 1ASOA 1WS7A 4GKNB 2X28A 1NDVA 3LMJH 2P80A 4EIGB 3FGCA 5D7KE 2BFVL 2FZ3A 2DQTL 2UZYB 3NCBB 4PRHA 5I9QB 4OI7A 3PV7A 1NLBL 3NQGA 4NZ5A 4D9PA 4UILL 4HH9B 1KENL 4WHTA 2A3EA 3DYOA 1GCYA 3I6KB 1IC5H 4NQCE 4UIOA 1SUXA 1VPOL 4K8RH 5K9OB 1A50A 1H6FA 3T0EB 3DO7B 2C1IA 2CU0A 3CFKA 3C6LA 4AF0B 2BXYA 4WXZA 2OZ4A 1JOIA 4DQWA 1ZT7B 4L18A 4GS7C 4GH1A 1GW1A 5KTLA 3PG8A 3R8HA 3VRJB 1AS6A 2ID5A 4GI8A 5J5EA 4CADA 2ZTJA 5E2TL 1RVGA 4ZTPL 4N5ED 1BXAA 4I18C 1A1MB 3SE3C 4YSAA 2CERA 2VXQL 4HF5L 3UC0L 3IMSA 5DZ9A 2ZZUT 2FIQA 3RURA 3JVFC 3CSFA 2NY5H 5FYLL 2QHRL 5C0BE 5EO0A 3CFBB 3BPOB 3QIBD 1MEXH 4QRPE 3VB8A 3POHA 5CLYA 1PDKA 3T0DA 1E5JA 1OADA 4GQGA 2X4UB 3UJIH 1RV8A 1BFOA 1MRFH 1EAQA 4H8UA 2QCLA 3LEVL 2N56A 3L9RB 3MV7D 2DWSA 3BE1H 5TK4A 1IAIH 2CG9X 1HEZA 3QORB 1CD9B 4GISA 2ZF9A 1R33A 5KSVB 4OT7A 2ENJA 2PYED 5HI5C 5CEZD 1HXYB 4F3FB 3LEYL 1O5QA 2ZAIA 1MY5A 1XLIA 1MQKH 3S98A 1RFDL 4OZOA 5D7HA 3S2JA 4X8GA 4GO6B 4TUJA 3V8CA 5EMMA 2F1BA 4WI3A 2EAWA 1AE6H 1WBZA 2NNXA 3RTQD 4EOWL 4AQ8A 3RPIA 1Q6GA 1IGIH 3CAFA 4RE4A 3DDMA 4M93C 1TQBC 2VXSH 5K9OA 3SCQA 2DM4A 4KEZA 4AG4H 2LE9A 4M1GL 1CD1A 2Y1VA 4QYOB 5ICXA 5CSZB 3X1NA 5E5CA 2Z4QB 1NAMB 1INQB 3WEBA 2VC7A 4FZIA 5G2HA 2JJSA 3RWFA 3N19B 1V3KA 5TJWK 1T66D 4JUSA 4PMUA 2GG1A 3QIUD 3EHBB 4CJ0A 1YYML 4ZO8A 5H4ZA 3VUPA 1JPIA 1FIEA 4R97C 4O17A 3RY6C 2X3BA 2QEZA 2A3TA 2E76C 4U31A 5DUJA 4YXHL 1EUAA 2HT3C 1TZ9A 2NXYB 5BQDA 1F61A 1RP8A 3W7RA 3F2DA 2ICWA 5F7HA 3WEXB 2JELL 4WNQA 3I50L 5C7ZA 2OL3B 2FO1A 4QP0A 2R15A 1E15A 1HT6A 5HMSA 3RPTA 3O41B 4N90D 2DQCL 2YJLA 5KSBB 3H3PH 5TNVA 3WMBA 1YTKA 3FO9A 5K9DA 2PSPA 2Q3ZA 2P43B 2WJ7A 3KFTA 3ULVF 2R91A 3C61A 3KLSA 4HJ0D 4LMQE 4GH3A 3O45A 5IWLA 5IGXH 4K7PL 1D8CA 3QI9A 3NJ3A 1MFBH 1KCUL 4HPOH 1TREA 3H6AA 1GYUA 1URIA 4KVCH 2VJXA 1MIML 1YVLA 2HV5A 2JI3A 5AVVB 4BFJA 3GFXA 4M6UA 3THDA 4Z2LA 4PUEA 4Y2DB 2Y6TE 4R7WA 3U1PA 2PURA 3TR9A 1S5NA 3V5OA 4WV1A 3HE6A 1QI2A 1V03A 1BM7A 4P2RB 1VFAB 3AABA 3L7FA 1E4IA 5JBDA 4AHQA 1LQSR 3HM7A 5I1LB 1IKOP 4JZJA 5FW7A 2GGHA 1RA0A 1WBZB 1Z9AA 3LSOB 5GGVH 5F0PB 4GBUA 2K3TA 2XKUA 2W9MA 4P5RA 4U3XA 4OCYL 3EMCA 3QW3A 4K8RD 1ERNA 1RU9L 1QA9A 1MWAB 4HGWB 4JG5A 2V3DA 4F33B 2NY7L 4F9LC 1IC4H 1VDGA 1YQ2A 4ODUA 4XZ4A 3TK7A 2B5IB 5JXEA 3TXAA 1XIEA 4LHUA 5CEXB 7PAZA 1TNMA 1IXPA 4ZCWA 2HS8A 2ZTKA 3TBSA 2A0LC 4M02A 4Y19B 4N8VB 4OD1H 5E03A 2YAOA 4YTQA 5DD0L 3W9EA 3LZ3A 4L8DB 2B4GA 4B9CA 5FJUA 3FUFA 5ABEA 4WOZA 3DXAA 5E70A 4D9LH 4HCDA 2MH4A 5MEOA 2YBRB 1C8XA 4ONGH 3WNKA 3WUBA 3ZJ6A 3B2MA 4MQXC 3ESNA 2WMPB 3BEWB 1ETZA 2NYKA 3CXDL 3O6LL 1TTUA 3DFTA 1MW2A 1TT6A 3TIDB 1WDQA 4XC1L 5ENLA 4CQ8A 4G70B 4PBDA 2BBFA 1UADC 4L5FE 2J21A 3DEQA 3VUAA 2DMHA 2WNWA 1KCSL 2IH1B 3JTSA 2VKZG 1XGDA 1YN6B 3R19A 1ZCRA 1RV6X 1UP0A 1RHCA 4D3CL 1BD2D 3N2OA 5HHOD 4JR5A 4UQCA 3AAZB 3RX3A 4NGHL 5GS0H 3T77A 3QLDA 4FA8A 3MLSH 4JFSA 3HRZC 3KS0H 4FQXA 4BK5A 5GGSA 1KMGA 1PTGA 3L13A 4JKLA 4XN4A 4B7IA 1MVFA 2BODX 3AYSA 4QE4A 5IGXL 4O4YL 1ZANH 5I9QC 1DVTA 4JZJB 5I30H 5IJKC 2W07B 2J6EA 5L9DL 4DZ8A 1DWHM 1M1BA 3BO8A 1SXAA 5I1DB 5HJLA 2VCBA 5GRXG 1YMHB 4AGNA 4UAOC 3Q2CA 1WA2X 2MFNA 5KSUB 3BV7A 3QORC 1TQUA 3HMXH 3GB6A 4DP6X 4TX8A 1OP5K 3K0WA 1HOCA 1W0WA 4I3SH 4G6AC 2BWGA 2DV0A 4JRYE 1E4NA 4Q8TA 7CGTA 4U6YB 4N0YL 3HNTL 5E99H 4JG1L 2UWEF 1WAUA 4P8VA 1T5XB 1VSCA 4Q6JA 1KRCC 1XZ0B 5DJ6A 3FHAA 2WMKA 3CQHA 5EFDA 1M6OB 1EJWC 4AKOA 3S8WA 1DFBH 4AC1X 5BOFA 1OX5A 1ETZB 2FUTA 4TRPH 3TA3C 4YVUA 4AE0A 1AZ2A 1HH9B 1U92B 2A7RA 3FXGA 2A6NA 4ANUA 4XP4H 5DT5A 5FKPB 1W9DM 2DWEB 2E27L 3O6FD 5J8LA 1J8HD 4GQ0A 2FMNA 1JI2A 4YZWA 3DGGB 5DS8B 4ZAKA 2QHLA 4XX5A 5GGTH 4KAQH 4LCUB 5ECGA 2YK1H 2BSSB 2HX8A 2MJWA 4K94H 1JCYA 3MA8A 1SVZA 1TTRA 5KG9A 1ZLSH 3MROA 4FF7A 1X5KA 3CLFH 2QVNA 2YA0A 3NJJA 3VXSE 1EQCA 4ALAL 2G2NA 4ZOCA 3RDTA 3WJJA 2ZX7A 5FA5A 5E2VL 4QXVA 2NNFA 2H6RA 4ODVL 4LRTA 3G6JB 3QHOA 2DPKA 3AS0A 3BLFA 4Q2ZB 1BWMA 3EA3A 1UG9A 1E4MM 4PRPB 4OZIF 4K3EL 4QHLB 3ZLFA 2K0RA 4G42B 4FI4A 3K2UL 1F6AB 4AE1A 5AZEH 1H9VA 4YO0B 3UYOD 2XG4A 4KZEL 3FSUA 4V2XA 4CCDA 3NEXA 4JHAH 3L9CA 4N0FB 1E4XL 3T9WA 5AVZB 5HHOB 4OM1L 3PV6A 3K6OA 2DQUL 3F6LA 4YK4B 5F0LB 1UHVA 2DQIL 4CU8A 4YLBA 2ARJA 3VOFA 4P3DB 3TH2T 2DQ6A 3A47A 5BMXA 2I9LA 4BS0A 3BWUC 5GPRA 3B7RL 3HUJB 3LN3A 5FB8B 4ZW8A 1GZGA 2E28A 3BDBA 3GINA 1E9TA 1B4RA 1DWAM 3W73A 4NWTH 2DPEA 4K5PA 3PZQA 2YGOA 5E2UL 1UYQA 5GGVL 1FLRH 3NVDA 3U2OA 4JDTH 2RHEA 3CQIA 4YLQT 3U2SB 3P3RA 1TPDA 4MD5B 2WWOA 4M7LT 5F7AA 3ARRA 2ZUTA 1J2WA 1MUCA 2PWUA 1KV8A 4L1SA 3OKNB 4UCFA 4IBVA 3B2XA 4LVNB 3GKFA 1DBBH 3MRIB 2VXVL 4UTFA 5FKYA 2BSCA 1FH7A 1IU1A 1CENA 1HO4A 3DGCR 3M0XA 1TETH 2A6DA 4PGEB 5EBAA 2VDRL 4UQEA 5DD0H 5HGGS 1E50A 2DM3A 1A4KB 4PRNA 4R4BB 2BX5A 4ADSA 4OVVA 4DRSA 4DYJA 2A3BA 1NWRA 25C8H 2IH3B 5DD6B 4GRSA 2NQCA 4YHMH 2M2DA 1FCQA 4U3HA 2DQMA 1EEZA 3SDCA 1OIMA 3JV5A 1HILB 4UI2A 1JCXA 3FYIB 3S4SB 3O0KA 4PRPA 1DQUA 5TQ0L 3TXZA 5A6KA 1FCVA 5KVEH 1CQYA 1V79A 2JK5A 2Y1YA 4BFKA 3HG1E 1TR1A 2HCVA 1N3NB 2CKBH 1RD5A 1MW1A 4N0FA 5EEVA 2Y2YA 4MB5A 1JQXA 2D0GA 3E2VA 3SCNA 4PB3A 2YLKA 4F5CE 2XIMA 3WXVL 4O12A 1LHZA 4RPPA 3WMCA 4AQAA 4HLZH 4YCOA 1FSKC 1IGYB 2YXGA 2ESVE 3DC0A 1QQDB 3K2UH 4B9FA 1O6SA 1W9BM 2WTRB 1NGYB 4XWOC 3BLIA 2V5RA 2QCNA 4NY2A 1X5LA 5A69A 2D2JA 3FUMA 4GW1A 4KK9D 1GJIA 1S9WA 3WTYA 1NMBH 3QIBA 1L6PA 5I74B 5A2JH 3QIWA 3WNIA 4G56A 1P7QA 1JHTA 3WE6B 1XAKA 4ES4A 5CC3A 2QCHA 3DV6A 5E23A 1F8MA 4Q4KA 4PUJA 2GVGA 1SXZA 3SGZA 2PGWA 2B1AL 2ODHA 1OP3K 1SVCP 2IXUA 3OAUL 2EP6A 1XT5A 2ZPKL 3OKNA 3UTQA 3E9AA 3OOQA 5JXQA 3DJRA 3SCPA 5C07A 4IHOB 4X4YB 1D7BA 4K2UL 1K8ZA 2Y7GA 1PG7L 5FO9B 4IQHA 1LO0H 3KOWA 1WLHA 4E8CA 3QE5A 3LTVA 4LV9A 2BS8A 1YY9D 3E0WA 2X9XA 3TA6A 1XINA 2W9EL 1GGCH 5DCBA 1XH3A 1INDL 3IV3A 5JORB 1RIHL 2R39A 4LLQA 4LU5L 2LABA 4QDGA 4NQDB 5C09D 1IL1B 4AYDC 3BICA 3L3KB 1ADQA 1XGTA 4X5RA 4O1DA 1M56B 3MCKA 3OWEA 4CD8A 3HTLX 4IJCA 3F5KA 5AKSA 1Q72L 1T5WA 1K85A 2E68A 1FGVL 3J2PA 1NZRA 5GGVY 2Y9RT 3QEQB 2P5WE 1FXQA 3W7OA 4N1HB 4FERA 3OEXA 5DFVD 3QUMA 1EC7A 3RWEA 1NMCB 3IE4A 3CVBA 3ZKND 2YD2A 3MLYL 4QTIH 1A0EA 4PUUA 4A2RA 3IJHA 1PZBA 5GRVL 5IOPA 3PZGA 5BZWB 4N6FA 4BF9A 9RUBA 2DQFA 3P61A 4BGLA 3E7JA 3QIBB 1NGWA 5KJ4A 1F86A 3EG9B 2F15A 2DY3A 1SFLA 3US1A 4GY7A 5D7JA 2MCAA 4R83A 3QRGH 4LLWB 4ZXBD 4AIZB 3AMKA 1KTDA 1SYSB 2O0TA 1A5CA 5GRVK 4OZHE 2PXYA 4LCIH 4OECA 3STFA 2VNCA 4J6IA 3HUJF 5E9DD 1IZJA 1YPZF 3FFCD 1T40A 3TFBA 2RUSA 3PUGA 2WTPA 4H1LB 2ZDRA 1QKZL 1YE4A 4RNJA 4OCXL 2PGEA 4QDMA 2YR1A 1GS6X 2R2BA 2KQMA 5C07E 2YD3A 1B0WA 1S2EA 3KVJA 1A8ZA 4XO5A 4UR8A 1EFZA 2BVYA 5F9OH 4XP5H 3VWKD 1MCRA 2DW7A 2GJXA 1OCWL 2EACA 2F1AA 1AG6A 4PJXE 5DK0B 5KVFH 1XYCA 3BQUB 4M7JL 3W56A 4A6YH 4DF1A 3AG3B 4A2MA 3PJSA 1XR2A 1MCPL 3WD5H 1DVQA 3SIZA 5ANME 3BCJA 3O6YX 4QGCA 4WW2B 3EJSA 1A3HA 4MPKA 1QT1A 3PFQA 4X4XB 3W1XA 1Q0EA 5K9KB 1I1WA 5E6UB 1I3GL 1XGTB 1SJCA 2QF8A 2XH0A 1CF8L 4R2GB 5F44A 3DV4B 3QXVA 5D72L 3TA4D 4MNKA 5JIDA 1QWUA 7FABL 3ZHDA 2X4OA 1QTSA 2D0HA 1RP9A 2WXKA 3P4LA 3TFKC 5IR1A 2AEWA 1R3VA 1MAKA 2GVYA 4UWQB 2Y5EA 1QI5A 1MH5A 2VLLA 3GRWH 2BP0A 3KLAB 2GSGA 5FYJU 3T09A 3DVNA 3V0IA 2CLOA 3OA5A 4EN3A 4OZFB 4UC5A 1Q9WB 4FNSA 4GOAA 4OZFH 3AQXA 1GPFA 3D30A 2QLYA 2WNKA 4A2HA 3KYAA 3IXAA 4V1DB 3R13A 4HPNA 2BZ7A 4GXVL 1MRFL 4J8RA 2QVMA 3CUJA 5CHNA 4L3AA 1Q9OA 4YL9A 4H1LA 3FZUD 1JFQL 3UTTB 4A7GA 1QACA 1IKNC 4Y19D 1SYVA 2BIHA 1TVBB 4YHNA 3KMDA 2OQLA 1XRTA 5FEXA 5AC8A 4Y88A 3UWUA 5GGQL 3KD4A 4PRAA 3H53A 4YQXH 4JAMA 5CJ5A 1P4UA 3A12A 3PZTA 3ESOA 3BUIA 5IB4B 2GYSA 5KBNC 2WSKA 1E6RA 3FYYA 4R7OA 1Y18A 1W17A 1X39A 3CFIC 3DFNA 5FAGA 3N44F 4EZJA 3F4DA 3MMWA 1XIMA 2AJZA 5EGRA 1N70A 3D12B 4MRCA 2V81A 3CUFA 1T89C 1MFNA 3MRHA 4XUYA 3DPDA 3F8UB 4MA1C 4G3YH 4PJDE 1WJ3A 4NZ8A 4WI4A 5E9AA 4ADIA 5J3HD 2J27A 4A3UA 1OPGH 3LMJL 4ZPVB 2B1AH 3LYEA 4Y4KD 5I3HA 4GYJA 3RVXD 3N4AA 2EDLA 2X4OB 4BHYA 4N6EA 1IAII 1ZJBA 4MWFA 5ECUA 4L4VB 4QHRA 4JFVA 5LNVA 2X70A 1BKSA 4XC3H 1HI6A 4W1TA 4CRPA 2YMOA 3MJ8A 1RSFA 3BP7B 4L9LA 4FABL 5KYNA 3E2QA 1A6VL 4HEPA 3MBXH 3RVTD 1WFJA 1S9VB 2EQDA 2FQGA 3NIFB 2OFQA 4WVRA 3F12B 3FMGH 4I48B 2VD8A 4B4FA 4HAGA 3GRWA 2WZTA 2CO6A 4N2YA 3FO1A 3GZOA 3T4AC 5D70L 1XDJA 2VX4A 5G4MA 2GBUA 3ZDYB 1IEIA 1PYFA 1JUKA 4ELMF 3AREC 1MCHA 5ETUA 3ORWA 2OA9A 2Z7GA 5HBFA 2Z2AA 1FCUA 1OP5H 1BLNB 2Q6ZA 3E2RA 4FLHA 3QHFL 2X8RA 3AHXA 3UZVB 1FLTX 3ZTNL 3EJYD 1R9XA 3KOZA 2WUBL 3FLUA 5FS5A 5FUZH 3IYLW 2HQAA 4HNUA 4H9YA 4B5EA 1A5LC 5LHFA 3D2UD 1L6GA 3KXFD 1A6ZB 5IWLC 1YKWA 3OBEA 2HG5A 1J5HA 3GBNL 1J0HA 2XDHA 1W1IE 3I3EA 3LN4B 5DMYA 5IRPA 2W65A 5EUOF 4GRMA 4LIQE 4N25A 4RFNC 3LGGA 4HU3A 5B22A 4H5SB 2D20A 1B4JL 3N5AA 4H20L 4L5ZA 2C1PA 5G4WA 5CAKA 3QO0A 3JSSA 1EOMA 1I0BA 2ORBH 4NHUB 5LBSH 4H4IA 1NSNL 4MLRA 4D6EA 4OCRH 4J1UA 4ZZFA 4ELMA 1AS7A 2X4QA 4YWGL 1AR1B 4DXVA 4WUIA 2OV0A 4H4NA 2PDKA 1XIGA 4MMZB 4W86A 1P2CA 1SFDA 4YJZL 5IHWA 1EKOA 4HWEL 4XNYH 1D6EB 1JHLH 1Q1JH 4YHIB 1G4SA 1S9VA 3OP2A 4HIEA 4JTDA 2LOEA 2J44A 1TX0A 3E3QE 1NINA 1FNHA 1U33A 2RH0A 3H4GA 5JPMB 1JV2B 2FJSA 2RIKA 3SSGA 4KNQA 3V0FA 3B4YA 1QK2A 4LAQH 4FZ8H 2Y0FA 2XT1B 3QEHA 5FM5O 4PRPD 1XEUA 1R3QA 4GQBA 4LP4A 5D1ZB 3AALA 2KZWA 1KCSH 2V9RA 3O3AA 1WDSA 2NSMA 2H2SC 3ARFB