3CTTA

Crystal complex of n-terminal human maltase-glucoamylase with casuarine
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
864
structure length
862
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase
publication title Total syntheses of casuarine and its 6-O-alpha-glucoside: complementary inhibition towards glycoside hydrolases of the GH31 and GH37 families
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 274
structure length 862
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3cttA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3cttA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cttA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3cttA01
1V6WA 1WCGA 3ARUA 3WF4A 3CBWA 4AYGA 2ZUNA 5E09A 4QAWA 1KQZA 3UG5A 3F5LA 1B3XA 3WNLA 2D20A 5A2CA 2E40A 2DGAA 4ACYA 4J3XA 4NXKA 2Y4SA 4AZ6A 4QCFA 2WM0A 3WH5A 1CEOA 1GPFA 3T08A 5BXTA 2XN0A 3VGEA 3WELA 3VSTA 1TQTA 1C92A 4TX6A 2ZUUA 4GI8A 3WQWA 2TAAA 3SUSA 1PSPA 3HG4A 1FP8A 4NRRA 4QCEA 2FE0A 4NRSA 3W24A 4DUXA 4A3HA 2ZX5A 1XRVA 3PZQA 3RPMA 3BAJA 4J7RA 1NOUA 3AZTA 4GZJA 1QVBA 1W1VA 2J75A 1TG7A 1ECEA 2V5DA 5C71A 1LLOA 3RJYA 4CN1A 3WDIA 1XYFA 4KGJA 4FLQA 2A3CA 1BVNP 5JBEA 2GK1A 5A8QA 2YKKA 4FNUA 1HJUA 3PZTA 3JUGA 3DDFA 2WKGA 5AYBA 2JEPA 5I3DA 1WPCA 8CGTA 2VCBA 2W4XA 1GOIA 3AZSA 2EQDA 2D0GA 4L4PA 1CDGA 4JFSA 3FN9A 3WEOA 3VX1A 1R85A 2YA1A 4F9DA 1KGXA 1ZBWA 1WZAA 4UQCA 1J01A 2CBJA 1C93A 1RD6A 2D1ZA 2GDUA 2GK1B 5TD4A 3J7HA 4H8VA 5ECUA 2Q8XA 3WDPP 1XSIA 1W9DM 5HNNA 3VD9A 1J0YA 1J0JA 2FH8A 4PSRA 1GOMA 1QHZA 3VOCA 3MUZ1 4EK7A 1HI7A 1J11A 1W2PA 2X0YA 3VPLA 3VX0A 3CMGA 4H04A 4JAWA 2OW7A 4LPCA 4W5ZA 4XX6A 2EAEA 1UA3A 4M56A 5A95A 3WY1A 2EPOA 3PZNA 1YHTA 1UR8A 3DYMA 1EGZA 3AIVA 1GJWA 5I6SA 3UCQA 1EDQA 4D6IA 4WK9A 1VFUA 1WDQA 1H09A 3ECQA 2D0FA 1E72M 4LQ1A 2V5CA 3PZ9A 2GDVA 3WD0A 5I5RA 4MDPA 1KCLA 1R46A 1QW8A 1GOWA 1J0HA 3HU7A 3HG5A 1XYZA 4JFTA 1HJXA 5HOSA 2YBTA 1QNQA 3AMKA 3PZGA 1J0IA 2WC4A 2J7HA 3I3DA 3MI6A 4P8UA 5DEZA 3MMUA 4U3CA 3RCNA 2XIBA 4D6EA 4PTWA 1KQYA 2J8GA 3ARPA 3L4WA 3EMCA 4ACZA 4GQRA 2WLZA 4RE2A 1V3HA 4HMCA 4HPGA 2EBNA 1XH2A 5GPRA 1C8XA 2V3DA 4JCLA 3WKZA 3GZAA 2Z1SA 1C7TA 3WF0A 2BHZA 1JZ5A 3WDJA 4HP5A 3BVVA 3VDBA 1XV8A 4HOWA 2WHMA 4U3AA 2PWHA 1LG1A 4GZIA 2EJ1A 3DX2A 3ZJ7A 5LA1A 1TQVA 4HPHA 2DT3A 2CEQA 2EADA 2OWWA 3IJ8A 4XV0A 2NSXA 1JD7A 3WF3A 4ACZB 2GJPA 2J7DA 1TA3A 1JZ6A 3BVXA 4DO5A 1MQRA 2E3ZA 1R33A 4DWSD 2E0PA 1Q4NX 8A3HA 4TX8A 2VUYA 3LXBA 3WD2A 2GUYA 4C7GA 1UG6A 4D1IA 1B31A 2XSBA 3MMWA 4KMQA 1WZKA 2YLLA 1R8LA 4DM2A 3WL0A 5A2BA 4AC1X 5CLWA 1US3A 2VO5A 4CUCA 1JI2A 1TFVA 3THCA 3RIKA 2V3GA 4LYRA 4MJ2A 3D52A 3WNKA 3M7SA 1KXTA 3PN8A 4UR9A 1TA3B 3M07A 5A69A 3WD3A 3W29A 2DEPA 3WY4A 3PHAA 3QHMA 4MADA 4CCEA 1UKSA 1E0XA 4BQ5A 1RP8A 3WEMA 3TOPA 2W91A 3WQVA 5CPSA 2VOTA 4GIAA 4PTMA 4W85A 1X6NA 2XSAA 1ITXA 4DM1A 3H55A 1HTYA 3A5VA 4FLOA 2OLHA 2D24A 1VFFA 3AHZA 3W38A 2WWDA 1GCYA 3GXPA 1HJWA 2X2HA 3CLWA 3AXHA 1HJSA 1G1YA 4JCMA 4W93A 2BY0A 2PWFA 4PSPA 4HU0A 1CXHA 1UYQA 2YFNA 5EFFA 2EO7A 4MPKA 1FH9A 3MMDA 2WBKA 4M82A 3ARXA 4ATWA 3ZT7A 3CC1A 2VVNA 1K9DA 2BXZA 3OB8A 2WAGA 5BCAA 4HA3A 4AXNA 2WW5A 1UASA 5GQBA 3CMJA 4Z2IA 5C70A 2XVNA 1NP0A 1GOOA 3GBDA 3MO4A 3CZGA 1JNDA 4A4AA 2VZVA 3BLKA 4TVUA 1W3JA 2QHAA 2BXYA 3BAIA 1QX1A 2DH2A 5CLTA 4HMEA 4TVDA 2NT0A 3DX0A 2UY2A 2JF6A 1JZ7A 1E1FA 2WWCA 1J0KA 1DWIM 2F18A 5M3WA 4M24A 1HJVA 1KR0A 1CECA 4B15A 4GINA 2QPSA 1NWSA 2YLAA 2G41A 5FOOA 3O6AA 1UD8A 2VMFA 1OM0A 3AIRA 1QNPA 4BQ4A 5CSUA 4NZJA 1WNOA 4QLJA 4GZEA 1V03A 2O92A 3T0DA 7CGTA 1AMYA 2CBUA 3G6MA 4AZGA 1NQ6A 1WKYA 3AHTA 1PS2A 5AYIA 1WO2A 1UH3A 4KRTA 2J7BA 4JFVA 3ZM8A 4PYSA 3A6OA 1UD2A 3MUAA 1J0ZA 1KGUA 2E9LA 1WAWA 1GQJA 4JIEA 2V3EA 3AXIA 3UR7A 4HU8A 4MB3A 5FIPA 1TQSA 2XIIA 1UD4A 1BYCA 4UOZA 1E9TA 1HKKA 1EDTA 3EMZA 3AYSA 2DIJA 1R34A 2F7RA 5E0FA 4PTXA 2DDXA 2XGBA 2CERA 5LA0A 4AMCA 1NOFA 1E71M 2G3IA 4MNLA 1KGWA 3WNNA 3W26A 1E4MM 1KXVA 4OZOA 1VBRA 1CIUA 1TCMA 4EKJA 3WDHA 3OLDA 1HVQA 4P8XA 3VNZA 1MWOA 3T0BA 2FHFA 3SIMA 4JL2A 4ML4A 1XC6A 4KRUA 2YA0A 3AI0A 4M1RA 1R75A 3AZRA 1ZJBA 6CGTA 4AZCA 4EANA 5BWFA 4LX4A 1UR9A 3T0AA 2V3FA 3BSGA 1KWKA 1CZ1A 4H41A 4R5EA 4UFHA 3PZMA 2YDSA 4E8DA 1VRXA 1OWQA 4CU8A 3VDAA 1MW2A 1TVPA 5A8MA 1X6LA 3EYPA 2Y8KA 2DT2A 4D6DA 4KH2A 2EXOA 3VM7A 3TONA 2X8RA 1HWWA 3GM8A 4P8VA 1GHSA 4NZCA 4FF5A 3VSUA 4IUGA 2ZE0A 4CN6A 4AZCB 5DO8A 4PMVA 4WSJA 2EABA 2FH6A 3ZMRA 1GW1A 2BHYA 4AW7A 3WUBA 3WNPA 2DH3A 3LPPA 3U7BA 3RILA 2BHUA 2BVTA 1OD0A 4AD1A 1VAHA 2NW0A 2C7FA 3SCSA 3UERA 1B3VA 2XG9A 3W0KA 3ZQ9A 2UY5A 3T2OA 1E6QM 1ZBVA 4QP0A 2F7OA 4CD4A 3OA5A 3A47A 2PF0A 2WMGA 1B2YA 2YIHA 1E40A 1TZ7A 1XSKA 4PTVA 4TVCA 1O7DC 3OZOA 1NWRA 3L2MA 3NUKA 1DP0A 4TTGA 1QWNA 2VCAA 2ZWZA 3U57A 1HN1A 3WUEA 4WIWA 4WKHA 1PAMA 3W53A 1CGUA 5JBDA 4J3VA 3WMSA 3AROA 2EACA 1GOKA 4S3JA 3BCDA 1IZJA 2DT1A 2PC8A 3AFBA 3LRKA 3DYOA 2RGMA 4FMVA 3QHOA 2WK2A 1I75A 3OBAA 4JHZA 5E6YA 3MSDA 3TTOA 4TTUA 1H2JA 2WHKA 4P7QA 2G3MA 5D9MA 4GI9A 2J78A 3PTKA 4HZ7A 2JE8A 1QOXA 2DSZA 4FNQA 4WKAA 3VGFA 5CSYA 4M8UA 3POCA 4A3YA 1D2KA 1XD0A 4W7UA 3EDDA 3T09A 2PWDA 2CBIA 4PMOA 3VNYA 4PMYA 4YHGA 3W81A 4GO8A 3CZLA 1FH7A 2X2IA 3BLPX 2WXDM 1CTNA 2W5FA 1W3LA 1JYVA 1V6VA 1VB9A 2XGIA 2AAAA 5EFDA 1SR0A 4JL1A 1IT0A 4X0NA 3AICA 5D8WA 2D3NA 4GKLA 3EBVA 4F9JA 5I79A 2VTFA 3MUIA 4J3TA 9CGTA 4JHOA 3RMEA 1XHGA 3NYDA 3BAYA 4M29A 3VIJA 1E6PA 1DTUA 3WQ4A 1WDRA 2G4FA 4ZFMA 1EIBA 1QI0A 1BQCA 1K6AA 4W89A 1OGSA 3EDJA 3DC0A 3CUGA 4AEEA 4W84A 1F4HA 3BLBA 4TXEA 4W8AA 2PSPA 2VURA 3DHPA 3G6LA 3DHUA 3L4ZA 3CUJA 1NOWA 3CIVA 3UR8A 4OJYA 3HG2A 1JZ3A 2ZX7A 5BXPA 1Q6DA 1DEDA 1VEPA 4MDOA 3ZJ6A 1ISYA 2W92A 1J9YA 5DT5A 4B9YA 4BF7A 4PMNA 2XHYA 1V6XA 4UFMA 3WBAA 1V02A 3SCWA 4MNMA 3CZJA 4IPNB 2J79A 2YL6A 2F7QA 1QWUA 3SCNA 2D23A 4UQAA 1MW0A 4HZ6A 5FCZA 1CGWA 5CZKA 1HX0A 1WZLA 3BSHA 3TTQA 5BXRA 3WBEA 4FNTA 1FP9A 2ZUTA 3POHA 1UWQA 5E6ZA 1MFVA 1UA7A 4AZHA 3GXIA 3K4AA 1QNOA 3WL1A 1NH6A 5I2UA 4F66A 1EHNA 2MANA 3WF2A 1D7FA 1J18A 3N13A 2VI0A 2QMKA 1TUXA 1CGYA 2WSPA 4J27A 1MVYA 1XCWA 3CHDA 2A3HA 1GQKA 1HNYA 2OYMA 4J3SA 2VT0A 4URIA 2WMJA 5A2AA 3D51A 4J3WA 4GQQA 2VX7A 1C8QA 1UR2A 4CCDA 4FLSA 2PWEA 1B90A 3S5YA 2XM2A 2QPUA 5ABGA 2XFYA 5EBAA 3SCVA 1OD8A 4KGLA 1BYDA 2W66A 2VQTA 1OCQA 2WHJA 2EPLX 1GNXA 4WJXA 3OIHA 5I77A 2ALWA 3I3EA 1UQYA 3GNPA 3O9NA 1V3IA 4W87A 3GXDA 3WFZA 3MU7A 2J77A 4TOQA 3AS1A 5LYRA 4M81A 1LJYA 2D3LA 3DX3A 4D6GA 1GVIA 2OSXA 3BAXA 4H2CA 2VVSA 2VR4A 1PS3A 2CPUA 4AD2A 3DX4A 3L4XA 5EB8A 2VCCA 1A47A 3OGVA 4E4PA 3QOMA 3FY1A 3BVWA 4WKFA 3MSGA 4XUYA 2WYSA 1V0NA 2HVMA 3NSXA 4UFLA 3GXNA 1KTCA 3A23A 1WE5A 2OSYA 1BYAA 2W61A 2YOCA 1JYXA 4CD8A 1B1YA 3A4AA 2CKRA 3T2PA 2IXUA 3APGA 2WCGA 4X9YA 1ISXA 4V27A 2BY3A 4Y7EA 1UH2A 1NARA 5E1QA 4PRWA 1MXDA 1UR1A 4OKDA 2VL4A 1HF6A 4FNPA 4H8UA 5EMYA 3CZSA 5M5DA 1ITCA 1DWGM 3VIHA 1EO7A 5AC4A 4CD6A 3W82A 4CCCA 2CXGA 2VX4A 3WF1A 1W1TA 2XWDA 1S46A 3RDKA 2ZXDA 2Z1KA 3ZR6A 1JL8A 1ZJAA 4NI3A 4ZE4A 1SMDA 1PE31 1OINA 1TQUA 4Z2JA 5BYWA 3UG4A 3VGHA 4AEFA 1CXKA 1CPUA 1G94A 4CN4A 2VRQA 3CZKA 2OW6A 5D4YA 2C8NA 2UY3A 1SYTA 1UOKA 2O9TA 3N15A 3ARQA 3VO0A 4AYSA 2WLYA 5GNXA 5DMYA 3CUFA 1E4NA 1XSJA 1E15A 5JBFA 5E70A 4AWEA 3VU2A 2DT0A 3CGTA 2ZUWA 3W4RA 1FFQA 2O9OA 3WH9A 3AS3A 4H8HA 3OGRA 4AZIA 5A8NA 1NP2A 1MFUA 1W9PA 1R7OA 1LWJA 1J10A 5CJ5A 2JIEA 4UNIA 2Y2WA 2VC9A 4JKKA 4W88A 3WDRA 2RGLA 3DYPA 3KLKA 3HG3A 1DWFM 1G9HA 5GNYA 4UFJA 3CTTA 1L0PA 1VFOA 1UWUA 3VD4A 4BCEA 1R7AA 2VRKA 5I0DA 2HISA 3CPUA 3D3AA 3AMGA 1LF1A 1QI4A 2CHOA 3GYCA 2E9BA 3I3BA 2D73A 2J7GA 3F4VA 2EEXA 1OB0A 4UTFA 1B0IA 3U7VA 1GONA 5DF0A 4D6FA 3WNOA 2WVTA 4U33A 4U2ZA 1GVYA 1W3HA 3KL3A 1OBAA 3SUWA 4IISA 2CBVA 3PZIA 3BMVA 4N42A 1GOQA 3PTMA 1W3KA 3EDKA 3N04A 4HTYA 3EJQA 1KBBA 4UQ9A 2ZX6A 1V0LA 1Z32X 1R87A 1UKTA 1EXPA 1C3FA 2WZIA 3W27A 3KZSA 1OGGA 2ZIDA 4MTVA 2CETA 4TUFA 1A3HA 3CHCA 3VIPA 2F1BA 4Q22A 4CD5A 3GTNA 2DIEA 4OIFA 1GUVA 3QHNA 4XZWA 3EDEA 1W2VA 2F2HA 5BRPA 4UFKA 3DDGA 4MB5A 3U5YA 1B3WA 5HBFA 3ARWA 1VEMA 1JFXA 3BCFA 1ZB5A 1GZJA 1C90A 1RH9A 1PPIA 5HDRA 1PCPA 3ARVA 1CLXA 5A6KA 3LX9A 4AMXA 1UZ4A 3LPFA 5FKYA 2IGTA 1UHVA 1EA9C 1PEZA 3CH9A 1CXFA 3BUIA 3LRLA 4UQDA 4X0VA 1GJUA 2J62A 1RP9A 1B3ZA 5DFAA 4YN5A 1BYBA 3ALFA 3WH8A 3PZVA 3AIUA 2VNCA 1PJ9A 1HP5A 1W91A 2BV9A 1GHRA 1QNRA 3SUVA 3A24A 4P7LA 2UWFA 3UEQA 3LMYA 3S2CA 3KE0A 2JF7A 1LL7A 5CGMA 4M80A 2BVDA 3ARRA 3GNRA 2FYVA 1E3XA 4HZ8A 2W62A 4FNRA 3EDFA 1JD9A 2XYLA 1E3ZA 1LL4A 4PMZA 1O7AA 5A6BA 1E4IA 5M03A 1PZ2A 2WPGA 1W1YA 2D0HA 4PN2A 1QW9A 4CU7A 1XD1A 2XM1A 3VD3A 1HVXA 1PX3A 2PI6A 3VGBA 2ZUSA 1W9VA 3ZJ8A 3TP4A 3SCPA 3ALGA 5KZ6A 1CXIA 1CGXA 4P7NA 1UKPA 2X2YA 1W32A 1CWYA 1WB0A 2O9RA 4OUEA 4NF7A 3CZEA 3OLGA 1E43A 1E70M 1UKQA 1E5JA 1EOKA 1JDCA 3L2LA 4QLLA 1VJSA 2X1IA 2WMKA 1OIMA 4B3KA 4UCFA 1JG9A 4K68A 4OOZA 4S3KA 4YHEA 2X05A 3MV11 3IAQA 2ZXBA 1HXJA 2VJXA 4MB1A 4PCTA 1O6IA 1LL6A 3TV8A 5A6MA 1ESWA 1BG9A 1VEOA 2J47A 3VGDA 4C7DA 1PZ3A 1MQPA 2YDQA 3VM5A 2X0HA 2CKSA 1UQZA 2IXVA 1EO5A 4EAMA 3ARTA 3HMCA 2VZOA 3VVGA 3VMOA 2A3AA 2J8FA 2VX5A 4F79A 1JZ8A 1B9ZA 3L4UA 1JIBA 1UWSA 1QBBA 5IFTA 4HOZA 1JGIA 1UWRA 4UOQA 3VIGA 1N82A 1U33A 1H49A 4NSBA 2YFOA 4L4OA 1PIFA 1JDDA 2YA2A 1F4AA 3SCQA 1KBKA 1E6ZA 4PMDA 4PCSA 4B3LA 3N12A 2OYKA 4HA4A 2WZEA 4AY1A 1EOMA 5CPTA 2J7EA 3K46A 1UR0A 2GSJA 3EJTA 3GXFA 3M6DA 1V02E 3OZPA 4RE4A 3ZOAA 1ISWA 3FHAA 3THDA 3IGUA 1V3MA 1DWAM 1QHOA 4U2YA 4W7VA 5A8OA 5CPQA 2FHCA 5A6SA 1ISVA 4AD0A 3HZ3A 1BF2A 1NWUA 3A3HA 2J25A 5BRQA 5D9NA 3VUPA 1BLIA 3GH4A 1KXHA 3VIOA 2WZHA 4UQEA 4B9ZA 2XPKA 3FHQA 3RM8A 4Z2GA 5A8PA 3WD4A 1LWHA 4MAVA 2XJ7A 4U31A 4UFIA 3IANA 4WF7A 1GQIA 3VDHA 4BS0A 1V3JA 2G3NA 1M53A 5I23A 1JI1A 3W6MA 4PEEA 2CHNA 1QNSA 1Y7VA 5IXEA 3WH6A 4D71A 2XTKA 3VMNA 1VENA 1H4PA 2EPMX 3WN6A 2OWCA 3D50A 4W8BA 3AJ7A 2AOSA 5FD0A 3A4WA 3N11A 1GQLA 1L8NA 3WMBA 5IHRA 2XUCA 1FA2A 3OGSA 3WUFA 3VSVA 3PZOA 1H0GA 1V0MA 1QI2A 6A3HA 5C8BB 2WCAA 3WQ6A 1BSIA 2E8YA 4CKQA 3AISA 3VD5A 4E2OA 1W9UA 3BAWA 3FAWA 3N1AA 4V2XA 3UESA 2ZUVA 5FL0A 1C7SA 2EPKX 4Z2LA 5D9PA 5JIWA 6TAAA 3WSUA 1CENA 1W1PA 1WP6A 1HP4A 4LYPA 1V3KA 2X2JA 5IHSA 1AVAA 1AQMA 3SUTA 1M7XA 1UKOA 1KR1A 3BXWA 3LXAA 3A4XA 3RM4A 2PB1A 2CNCA 2OWXA 4NX0A 2WMIA 3D5HA 4YPJA 2BNJA 4Q7NA 1QI3A 1G01A 1TVNA 3AXXA 3FXYA 2WMHA 3BC9A 2YL9A 3QGVA 4PMXA 3FW6A 1XCXA 4GPNA 4FLRA 1AQHA 5HXMA 4UZUA 3VIMA 3VIFA 3IAPA 4AZBA 2YL5A 3B9DA 4ZEPA 1FOBA 3BUQA 2WCSA 1U2YA 3AMLA 4ZXOA 2BS9A 2WHLA 2WMIB 1X1NA 4IPLA 3RM9A 3VKKA 3HN3A 2ZXQA 5HPCA 3S5ZA 5BXSA 1Q6CA 2Y24A 3M46A 1E1EA 1JF5A 3KL0A 3ZSSA 3WEZA 3DX1A 1OIFA 5LA2A 2ZOXA 1B30A 3E1F1 3NCOA 4JZ5A 4J3UA 1V08A 5A6JA 3EJSA 3BUPA 3QR3A 5A6LA 1JF6A 2X09A 3AIEA 1LQ0A 2J7CA 4AMWA 1FH8A 3F5KA 1HIZA 3MUY1 1HXKA 3WMCA 1XH0A 1H0IA 1UZ1A 3KLLA 3BH4A 1H5VA 1TR1A 2WVUA 3EJRA 3N17A 3SCTA 3NSMA 1IV8A 1SFSA 2CIPA 3AYRA 1HL9A 3H54A 1D3CA 4H7VA 2XVLA 3OLIA 1QHPA 3WQ8A 3LRMA 1M03A 1JFHA 3AIQA 2WVSA 4GXPA 3KWXA 2E9MA 5ABFA 3NSNA 3KEHA 1E6XM 3VIIA 1H41A 3WY2A 4ZENA 4OOUA 1VIWA 1PX8A 1NM9A 2WC7A 2A3EA 3H53A 4CVWA 1UD6A 7TAAA 2WBGA 1FHDA 1JNEA 1JYWA 1KB3A 4GI6A 4W8LA 2YJQA 1EQCA 2F7PA 1H11A 2B31A 1JDAA 1EHAA 5ABFB 3II1A 2J4GA 1WDPA 2F8QA 2BY2A 2VZTA 1HL8A 3L4YA 1EH9A 1BHGA 2PBOA 1V6UA 2DPEA 3MS8A 1PBGA 1KFWA 5GNZA 4JFWA 1V6YA 2NT1A 2XVKA 4PUEA 3W25A 1EQPA 3K8LA 1I1WA 2D22A 3AOFA 2ZX8A 5A1AA 3WY3A 2Y8VA 2E4TA 2DSKA 3K4DA 3WUGA 1OGBA 3S6TA 4P8WA 2CYGA 3B8SA 3GDBA 1VF8A 3VDCA 2OSWA 4AZ7A 4PUDA 4GO9A 3N18A 3W28A 2Y5EA 3ARYA 1JYNA 2UY4A 3VMPA 3AS2A 4D6JA 3CHFA 3FNDA 1FHLA 2JALA 2FDMA 1FFRA 1V3LA 1ZBKA 4WLCA 3NDZA 5DT7A 4AIEA 2XFRA 1H1NA 1J12A 4JKMA 4MNKA 4LXFA 3OLEA 4IM4A 3PTQA 3AIWA 2PWGA 4DO6A 2V38A 3SCUA 1CXLA 3GXMA 4BQ2A 4RE3A 5CQ1A 1ZBCA 1QBAA 3B9AA 4JKLA 2WVVA 5CXPA 1VFMA 3U5UA 1E0VA 3L4VA 1U30A 4E8CA 1DHKA 2G3JA 1CGTA 1E6RA 3IJ7A 3GXTA 1E6NA 2EPNA 5E9AA 4HOXA 3W6LA 7A3HA 2A3BA 1ZS2A 2ZUMA 1HKJA 1YQ2A 3MKKA 1G0CA 4KWUA 3LPOA 3OG2A 2WVVB 2E8ZA 1SZNA 3UG3A 3SCOA 1QPKA 2VRJA 2J7FA 3VGGA 5E0CA 1AQ0A 3N9KA 3VD7A 1WZMA 4XZBA 3WQ5A 3QOKA 3ZJKA 4AD3A 4JFUA 3NDYA 2DSUA 3UETA 5AY7A 1E9LA 5KEZA 1XGZA 2XVGA 4NXSA 3B9EA 1CYGA 4CU6A 2VX6A 4PMQA 3GH5A 1KTBA 4Z2HA 1CBGA 2G8ZA 1E4LA 2CESA 3AMCA 2YL8A 1M04A 3BMWA 3AMDA 1E5NA 1E0WA 2W67A 4D6CA 1H3GA 5A6BD 3F5JA 3CZ8A 3PBGA 1BGAA 5A94A 3GH7A 3K8KA 4DWSA 1P6WA 1TMQA 1PIGA 4MJ4A 4ATLA 2QF8A 1NWTA 1KWGA 3L4TA 4DO4A 3SUUA 2DSVA 3K8MA 1WDSA 3HJEA 1BTCA 4BA0A 3BUBA 1DWHM 1JAKA 4W5UA 2DQXA 2GVYA 2FHBA 2XWEA 5BROA 1BVZA 1VJZA 1ZU8A 1I1XA 1BG4A 4UQBA 5FL1A 1RPKA 1MQQA 4DWSB 4UOJA 4DWSC 4HA1A 1JZ4A 3A22A 1T0OA 3CV5A 3ZR5A 2O9PA 5JIPA 3EJUA 1CGVA 1CLVA 1IZKA 4N0RA 2XN1A 5ABEA 5I24A 3IJ9A 2BY1A 3ZSTA 1E6SM 4AZ5A 5I78A 4QLKA 1B3YA 2JIWA 1M01A 1MXGA 2F1AA 1ISZA 1EDGA 4BZYA 4P7RA 2ZX9A 5JUVA 1GORA 3DECA 1OSEA 3CO4A 1R86A 3ZO9A 3A21A 4FNSA 2WB5A 5M17A 4DUWA 4F8XA 3AHVA 1JZ2A 3BVUA 2XFFA 1UUQA 2BVYA 1E56A 2BFGA 1MW3A 3VINA 1XH1A 3AHXA 3GNOA 1TE1A 4U5KA 4HMDA 1DWJM 2C0HA 2WANA 4UZSA 1JXKA 3FAXA 2JEQA 1UD5A 4R27A 2JFEX 4B16A 3T2QA 3BUDA 4U5IA 1R47A 1K9TA 4AIUA 3AIBA 2WC3A 4ZE5A 3VIKA 3NJ3A 2VQUA 4W86A 2FGZA 3MANA 1ZL1A 1CXEA 1C91A 2YBUA 3D4YA 3NIYA 3ZT6A 3TTSA 4EE9A 1JXJA 4AIOA 2D2OA 3CHEA 3D4ZA 5ABHA 3AS0A 3SCRA 3TTYA 3ZT5A 1G5AA 1KXQA 3BVTA 4PMUA 2ZICA 4V28A 4OGZA 4J28A 3WNMA 3WD1A 3AQUA 3KL5A 1K9FA 2VR5A 4OBRA 1PX4A 5D8ZA 2PBGA 3VILA 5F7UA 4DUVA 2VZSA 1UR4A 1UWTA 1ODUA 4CGTA 3CZNA 1KCKA 5A6AA 3ARSA 4MB4A 4MAZA 3WFLA 4LGXA 1ODZA 1C8YA 1CNVA 3BGAA 4D72A 1SMAA 2WSKA 2W63A 3VTRA 4CVUA 4D1JA 1OT1A 1BFNA 3RJXA 1Q6EA 2GJRA 2ESCA 1QI5A 2CITA 4FK9A 4OBSA 3SURA 4RL3A 2GJXA 4ZXLA 4PMRA 1HJQA 1E73M 5IFPA 3BAKA 5CGTA 3GBEA 2VZUA 5IDIA 3MV01 3RO8A 1W9BM 3EJPA 3ZIZA 3K1DA 1BPLB 3AHYA 4W7WA 1JAEA 4D6HA 4XB3A 3PZUA 2YDRA 3LPGA 2QV4A 3CUIA 5CG0A 2AMGA 1W9XA 1HT6A 1HKMA 4LYQA 2XVPA 3WIJA 4ATDA 2GJXB 1K9EA 3EMQA 1Q6FA 1UD3A 1TQWA 3LXCA 1BAGA 4PBGA 5D9OA 3WH7A 1E55A 4QDMA 2ZWYA 4C7FA 1UH4A 2QLYA 1V0KA 2FGLA 1MYRA 2DSWA 5A3HA 4AD4A 4WSKA 2IUZA 5AC5A 4QFUA 3TA9A 4P7OA 1LG2A 3SEPA 2QMJA 2XN2A 3CUHA 3O2LA 2J74A 1BGGA 2GFTA 4NZFA 1US2A 1HKIA 3ARZA 4AISA 4BQ3A 3WENA 3W37A 2ZXAA 2WMFA 4MNJA 2F61A 1Q6GA 3IK2A 4AD5A 2WNWA 4CD7A 4Z2KA 5HPOA 1VBUA 2OYLA 3WDQA 1OT2A 1MW1A 2WKLA 2CCRA 1UWIA
chains in the Genus database with same CATH superfamily
2VDIA 5EOCJ 4WHYG 3NCBB 4JGDA 4HUWA 5C3IA 2YWYA 4J3OF 2BMKB 4AQEA 3BZEB 3FSUA 1N67A 3DENA 1XIWC 3DLQR 2ZFAA 3ISIX 3CAFA 1E67A 1N8FA 2OXHA 4R53A 1NDGA 3MR9B 2Q7AA 3U4AA 1SQ2N 4S1DD 2TAAA 4B9GA 2Z7UA 2FFCA 1OG6A 5FJPA 5LNDA 5FGSA 3MXWL 4AHQA 4J7RA 1CDIA 2V63A 1UT1A 1ECEA 2V5DA 4TNFA 1ZT4A 4S1SH 5DJDB 1SJEA 2GK1A 1UXSA 2Z8RA 3DDFA 1HEZB 1L6YA 2ACUA 4N0UB 2WLHA 3RX7A 2ADIB 1XGDA 2CBJA 3JZYA 5TD4A 3BKCH 3F83A 2DYSB 1A7OH 3RFZC 5DQ9A 2EXYD 2DBLL 3CH0A 1EC9A 2QDVA 2O4MA 3BIBX 4EK7A 3OPUA 2BASA 3AM8C 1BPVA 2WV8A 1F6LL 5AEAA 3SPIA 3VB8A 4S38A 2ZF9A 4UT9A 4R97B 1LTXA 4K3EL 4M6PA 3LSBA 3QXWA 4LZKA 4D0BA 3REVA 1GJWA 3F8UB 3A9IA 1AXSA 5J6GA 3NZSA 2WJZA 3UA4A 2PTWA 4TUOB 4PGBB 4KKAC 4G59C 3TPUB 1KCLA 1T83C 4RMTA 1GOWA 2A1WH 3MLVH 3ES6B 4NLHA 5H37H 2VDKH 2VLME 2BRRL 1W17A 2Z8WC 5E5LA 3PJSA 4HMCA 3KRSA 3SQMA 1CMOA 3WKZA 3W1PA 3W7RA 2PW1B 2DM2A 4TUKL 3C5ZA 1ZCRA 1SOQA 4GZIA 4L9LC 4B5XA 3IJ8A 3L17A 4NYLA 1TA3A 1RU9H 2XG5A 1WT5C 3LS4H 4DWSD 4HPNA 1AXTL 2A9AA 4HK0B 2XSBA 2HCZX 2RACA 1K7EA 4O18A 5IB5A 3NJIA 3IFLH 3THCA 2A9BA 3MJ7A 5IFJB 4LSVL 3D52A 1AMXA 1OHLA 3PN8A 3ITCA 3FU8A 4M1DL 4AHPA 4AUBA 3RQ3A 3HRZA 3RL1B 3QYMA 1E0XA 1RUQH 4BQ5A 1DVQA 1H6FA 2VOTA 3SADA 3H55A 1LD9A 3ITGA 3M9YA 2D24A 4KS0A 1DE4A 3MZGB 3S0CA 4JVPA 3Q2CA 4H8QA 2JVUA 4XSLA 3V0SA 2R83A 1GOFA 1ODAA 4GVFA 4JCMA 5CHNB 1VERA 1UYQA 2X1OA 4FYSA 3U7WL 3W0WB 3TZVC 3GFUA 3WXWH 1KYOK 3QW3A 3FF8A 4APQD 4LU5H 5C0CB 5JLZB 4TVUA 3EYSL 3OXRB 1U8IB 2EE6A 1QO3A 3UJ2A 3MV7D 3DX0A 2DYPB 2UY2A 2KZHA 4WO0A 2F18A 4A3RA 1E5AA 1NC4B 5LGHL 1XF5A 5B8CC 1RUAH 2XZQH 4WO4D 2I5IA 4K5OA 3SJVA 1BZOA 3G6MA 1PS2A 4XMTA 3I6GA 4PJ5E 3MNVB 4FZ8H 5EU6B 1H62A 2BERA 2GFBA 4KROD 1UD2A 3MUAA 2PR9A 2F54E 4FGMA 4FTVD 2X1WL 2Z31A 2A6JA 3CVIH 4UOZA 4OT1L 3AYSA 3PGFL 3BFOA 2CHZA 3UJTH 1S7RB 3K30A 1T1XA 3I4EA 5B21A 4MNQA 1KXVA 2DWXA 3NA9L 4LBEA 1QYGL 2QR0B 3OTRA 2IPGA 5I76B 4TUJB 5EN2B 4PJDF 3H12A 2X4SA 4BKNA 3SB0A 3SR7A 4F2UA 4UFHA 2YDSA 4YO0B 4UTWC 4NRZA 4JR5A 4LUTB 1QHQA 3KGTA 5KN5A 1S1PA 1TTIA 2EXOA 3VM7A 2IWGA 2PZ0A 4P9HL 4LFYA 2YKLH 4NQXB 3GVVA 2GTZB 4CN6A 2VFIA 3W1RA 1X3DA 1GW1A 2N0MA 1EL3A 1NGWA 4QRRD 3RILA 2IH3B 5IVXB 3W1XA 5EPMB 1EF2A 2FLRT 4N2AA 3TZFA 4NT6B 4R96B 1S7TB 1ACYL 1LM1A 1NJ9A 1KD0A 1NTHA 2F7OA 1YTKA 3A47A 4Z8FL 1K7XA 3H4FA 1YECL 4LLDB 3UX9B 3BVDB 3L1OH 3KG5A 2KHAA 5EIIB 4PL1A 4WIWA 3AXMA 2HVKA 3SDCB 4E42A 4PJEB 4NNPL 2EACA 4WI3A 1OK4A 1PHQA 4NO3A 4WUKL 3LNEA 2WXIA 1P5BA 5JW5A 2OTDA 1Z3GH 5EU3B 4QAMB 2QQLL 2ICSA 5E00A 1ZV9A 5L2KB 4FABL 3RWHA 5F1VA 1EVTC 1F2XK 3EDDA 3CZUB 2FB4L 4PMOA 3GLAA 4PMYA 5IBLD 3S96B 1V8HA 1OTSD 4HKJB 3D05A 2W5FA 3S35X 4HIXL 4Z7IA 5C5YA 1IGCH 2XGIA 4PG9B 4JL1A 3VZYA 1HK6A 4RNHA 1ED3A 2EUZA 5LGZA 2NY4C 4RPPA 2K7PA 2EEBA 4YNYA 3DBSA 1R3WA 1JCKA 2W9EL 1FL5A 3IXTA 5DFVD 1WDRA 3A3XA 3IARA 4NKMA 5AAMC 3P73A 1ZHKB 1XDLA 1OAQL 3T07A 3GRWH 1DEDA 3F7VB 5BV7B 4Q6IC 2HLFC 2W92A 4JFFD 4U3SB 4HCHA 3CFDA 3SCWA 3DETD 4ONOA 4ML9A 1ICTA 1F9CA 4QRPE 2D23A 2P5WD 3V55A 3BARA 4CQ9A 3BUYB 2W88A 2XOTA 3C6SA 5JNYB 2WP3O 5E6ZA 5F3FA 4GKOA 2GAZB 5B1BB 2I25N 4LP4A 4DN4L 3H8AA 1J18A 2WSPA 4DKTA 1GQKA 3P80A 1V8EA 3GG0A 2R69A 1C8QA 4CCDA 3TO4C 5IHZB 1EANA 4GBXA 3MV9B 5DVMA 4P05A 5IMKA 3MCLH 1OCQA 1GNXA 4WJXA 1BJ1J 4P23B 4E41A 3DXAE 1ZHBA 3DFYA 4K94C 2J77A 4ORGA 3MREA 3BJFA 2F8IA 4W4NA 4B9IA 1PS3A 3ZXAC 3EFOB 2CPUA 2E27L 3OGVA 4JQXA 3W9EA 2P5EE 4XUYA 4ZUVB 4AGNA 4MY8A 3VG0L 3TLQA 2BRRH 3NSXA 2CBOA 4BFIA 4Y8FA 1WE5A 4JHBA 3SY8A 1MCOL 4CC4A 1H7NA 2CCVA 3TVMA 1PZ1A 4G9DB 4LCWA 2O5NA 5IM51 3OAWA 4ZL1A 4TUKH 5I0ZA 2XBZA 3KCWA 3JTSB 4O4VA 4F15C 4O15A 3QDMA 2VX4A 1RBOB 2XQ0A 3SBFA 4PRBA 3MJYA 1AXTH 1I1RA 5BYWA 3UG4A 5E9NA 1G94A 1A4BA 1U3HC 3PL6B 2Q3RA 4LSVH 1SYTA 3W71A 2YPLB 1TR7A 3QXBA 1WGOA 3MRRB 1TWDA 1AYOA 4HW6A 2R2BA 2HZHA 3EBAA 5GS1C 5FJRA 3GTXA 1G7LA 3KXFE 3E3QE 4ZMPA 2VEMA 4FO4A 4AZIA 4IGBC 1NP2A 3E8UL 5D1XB 5DZVA 3T0TA 4HIHB 4HT3A 4GUQA 2Y3NA 3IJLA 3IDIB 1ET5A 3NABL 2YSTA 4JG0L 4HU2A 4G8IB 2BWIA 1XCTB 3U7WH 3NIFE 1DWFM 3WLJA 4H0IA 3RVUD 3EYVA 1UWUA 3BQUC 5GS0H 2BPBA 5DK0A 5DXXA 3N43B 4FOMA 2CHOA 3TYGL 3EYSH 2EEXA 3K71B 1JVOA 1S4IA 2YLKA 4X63A 1OB0A 4XVUC 4AUYA 3GG1A 5XINA 1IKOP 1RQ5A 3CPRA 4YTQA 1WCBA 5TQ2L 3B3DA 1Q63A 3N04A 1KBBA 3VXUE 1I2QA 2WUBL 4XKYB 3TXAA 1Z32X 3DSNA 2WZIA 1S9VB 1W0MA 1K2DB 3IPWA 4BQ9A 3PTDA 1ILUA 4E9LA 1GUVA 3ASOB 2WNNA 3Q58A 3U5YA 3KPPA 1IL1B 2GJNA 1J86A 5D09A 4QKXB 2HJLB 1GCFA 5IQOA 3D4GA 4XG1A 4OT1H 2IQTA 4WI0A 1DBTA 3PGFH 3T05A 4XZUA 1NICA 4GFIA 3WK3A 2OZNA 1TVBB 2IMNA 4P2OA 2E74C 1GJUA 5FV2A 5DFAA 3UTTB 5FGBC 3OB0K 3NA9H 1QYGH 1GIGL 3C87A 3E3QC 1H7WA 1QJWA 3HR6A 4GP5B 4KITB 1YEFL 4WD0A 1BFTA 3NCEB 3EX1A 2KS0A 3BPNB 1PZ2A 4P9HH 3LHUA 1XGTA 5MEOA 5IROA 1HVXA 2V5MA 3OR7A 5HY9A 4RCXA 5FUOL 2XXMB 1BVKB 1CGXA 4KY1L 4MY1A 2VL5B 3O4LD 1ACYH 1EOKA 2D7MA 4RV8A 3GMOA 3L2LA 2ITCB 1YECH 1ZGLB 4JVUA 4N2CA 1HXJA 3WMQA 4F8OA 4PCTA 1EFXD 4N28A 4LPYA 3P3UA 3VWKB 2GCYB 4QO1B 3HBPA 2FQEA 2X0SA 4H1ZA 4DBSA 1BZ7A 4NNPH 3AUJA 2G2RB 1XJBA 5HQLA 1S9XA 4JM2C 4P2RD 4JIQA 2V2CA 4WUKH 2P49B 5DZPA 1LDPL 3DARA 1H49A 4PRTA 2IGFL 5BNXD 2H8ZA 2QQLH 5ELIA 2DWDA 2NY6D 3IPBA 3RGVC 1O6VA 4FABH 1LO3H 1UUMA 4KPLA 2FVKA 1G4SA 4XR8C 2GSJA 2FB4H 2Q76B 3EJTA 1I8AA 2GTWB 5FF6B 2WD0A 4ZW8A 1PKQE 4HIXH 1Q3NA 4F24A 3P0VL 1ZLWH 2BBFA 2ACRA 5BRQA 3DO7B 7PTDA 2WJEA 3VIOA 4CDGC 3UTZA 5DCEA 4B9ZA 2DV6A 2WLIA 1YMMA 3IANA 3VOJA 1MO0A 1M53A 5AC6A 4AGLA 2W9EH 1QNSA 4D71A 1H4PA 1JDFA 1TV8A 1OAQH 5EBLB 4OV9A 4GQZA 1AH4A 1FA2A 1TETL 1YCSA 2WPBA 1H0GA 3SBQA 3WLBB 4L8BB 3W70A 4QR6A 3WQ6A 4R9HA 1BVNT 2DTML 1RCQA 5DEJA 4E2OA 3N1AA 2AJZB 3H9HB 2EDFA 2ARWA 3P40A 4KXAA 2VWSA 4MYWB 3S3SA 3P8IA 5HHVH 3QZMA 2DTSA 4E9WA 3UQNA 3HRPA 4P46B 4DN4H 3EO9L 4MYPA 3PJTA 2W65B 3E0IA 5DC9B 3LUTA 3KPTA 2TRYA 2F6UA 4PN6A 3M88A 4JKNA 1Z9OA 1AQHA 3VIFA 1H3XA 4CCZA 1LWRA 3BUQA 3LNIA 1ND0A 1OSPH 1YLVA 2FT6A 4IPLA 3NP3A 1TTQA 4JDYA 3WTXA 1DIOA 3CFNA 4WW1A 4L29B 2B16A 4L4LA 5KSBB 4MWAB 4K55A 3DX1A 5CGYC 4JZ5A 2E27H 1Q9OA 1Z66A 4LOVA 2QGBA 4XZNX 3VG0H 5RUBA 4QE5A 1WYIA 3X1GA 1XH0A 2N1KA 3L3IB 3N4FA 1WDDA 2WCPA 1SFSA 4K71C 3CVDA 2GJJA 3H54A 1OP3H 3OLIA 1RERA 5DA4A 3M8OL 1F02I 4FE9A 5EIQA 3VXOB 2X3BA 4A8RA 2WNQA 1E4HA 3FDWA 3GSWB 3HCVB 3OMNB 1BDYA 4X6DE 5AVVB 5E4EB 2JCWA 2Z65C 5BVPL 1F2QA 3QJHB 4L4VA 3S3DB 2LT9A 1MH5B 4H19A 1NCIA 4KVNL 1IM9B 1R5WB 3B0VC 3L4YA 2WOYA 5EA0L 2FIKA 1PBGA 1XGPB 4ZMNA 3PJXA 5CP7B 2KDYA 2D22A 3AOFA 4OZHB 1NGYA 2XIOA 1G9EA 1BZQK 2WBJC 4PUDA 5DXYA 3KPLA 1ZJIA 3NABH 2Y5EA 4HF5H 1R9FA 4JG0H 3FFCA 2X2UA 3K1KC 3NQKA 1YJDL 2CWXA 3P77B 4P99A 1DVSA 2H2SD 3RJOA 4BQ2A 2OKOA 3TYGH 1KW1A 3L4VA 4DEFA 1XR9B 5E0QA 1BD2B 2J88L 2VIRB 1OB1B 4JDVA 3V5OA 3FT3B 5TQ2H 4CW1A 1E6NA 2WUBH 3ID7A 2B14A 5HTSA 4KEUA 5EF0A 5FKAB 5LXVA 4KZ0A 1ZSDA 1A9EB 3OHXC 2H9AB 3NOEA 5T1KA 4ZGYA 4D94A 3OKOA 1TOXA 1PD0A 4FKHA 3NZQA 3Q45A 4FQ2H 4HNTA 1AK5A 5ITFA 3NSJA 2RHGA 5FF0A 3DRQA 4AL8L 4WKXA 1PIGA 4QOKB 3CDCA 2H1PL 3G1XA 3PUOA 1GIGH 2JK5B 4H2HA 5AZ1A 4GXUN 3HJEA 4IFOA 2GVYA 2AK4B 4M61B 5E5CA 1W2KT 5I1DB 3MRMB 3V6ZA 5DANA 5DC2A 3E9TA 3UAJA 4NAEA 1JV5B 5LIYX 3TROA 1SW3A 2AKRA 1U8JA 3LBCA 5LXXA 4ANXA 3GKAA 3RWIA 4Q8PA 3D7PA 2JIWA 2HTKC 3BZ5A 2E5BA 2PS2A 1JPGB 1RURL 5FUOH 1O66A 4M6VA 1A66A 1Z6KA 1XPGA 4G70B 4OD2A 4KY1H 3OAZH 3WJMB 2CLVA 2BFGA 4JDBA 1T7VA 5E1GA 3FYOA 3CB3A 3UH8A 4MBOA 2P52A 4GW1A 3I9IA 3HZVA 1L4IA 2XV2A 3AWGA 5EU5B 4HD9A 3KPSD 2EGZA 1D3GA 4ZVJA 5JA8B 1EP2A 4AIOA 2JKWA 3D4ZA 1A8JH 4L1WA 3BEVB 3OPZL 2JKXA 3TTYA 5E2UL 2ERJC 3WUWA 1OFOA 1E9QB 4HH9B 4J28A 1LDPH 4PJHA 2C0AA 3GU9A 4J2PA 2INZA 2NXYB 2IGFH 5F7UA 4N02A 3FO2A 2VXTL 3DI0A 3CZNA 2YW4A 4WWKB 1MCNA 5I09A 1D5ZA 3TCEA 4D72A 4ES4A 4A2EA 4LHUA 2WSKA 3PQYD 3KYOB 3PWIA 1I60A 2VELA 2YMTA 2FK9A 5AYUL 4KNTA 3IDNA 2GGIA 4XNXL 4RX0A 3P0VH 1E73M 3L9CA 3AAZB 2EXSA 5DK2A 3ZRCC 4O2EB 3TURA 3WJXA 4G7QB 2ZAGA 4LUSA 2V82A 2QKSA 1OY0A 4X9FA 2QV4A 2YSSB 3TBTA 1NAML 3I65A 1DL7L 5E6IA 3TNNB 2ZVRA 5I75B 2XVPA 1LT7A 1HWGB 3U8GA 3Q37A 3U82B 3V0TA 2EC9T 1MYRA 5FEXA 3GO1L 1TETH 1JWUA 1EF3A 3TA9A 4G8EA 2J1KA 1H15B 4F7PA 1N12A 4GSUA 3EGSB 4HJ0D 4NZFA 4BH8B 2DTMH 5BS0D 3LKQB 2XQBH 1EFQA 4Y4KD 5L9DL 1XQLA 2OPJA 2GITB 2DQJL 4M7LT 5DFTA 5I8EA 1QPNA 2J12B 1RV8A 3LKRB 3TFKD 3QNZA 2CZNA 4NUWA 4IXHA 3VRLF 4KJYA 4AKQA 2GEQA 3NDOA 1B3XA 3EO9H 3TS8A 1GTFA 2DGAA 4AZ6A 2BRQA 4MYXA 1T6MA 1INQB 4PJ8D 3GFXA 4BWUA 1RJZA 2I1OA 4B9PA 1TLKA 2Y5QA 2M8XA 1YEYA 3WQWA 4CVXB 5A16A 1WBJA 1T22B 4ODSL 1RY8A 3W2KA 1JR1A 4E0RB 5EZIL 2XN9A 3G08B 2ZX5A 3S0PA 3NO3A 1XRVA 3LZ5A 2MNWA 4GZJA 4NDMA 5HJ3B 1F73A 4ELMF 3UZEA 4QRSA 4CNPA 4QRTA 3KBJA 1F3JA 1TIMA 5GGQL 4W9JC 3JUGA 2HG5A 4M19A 2O5ZL 3RUGF 1A4CA 1WPCA 4IMLA 3AZSA 3M8OH 4U6XB 3F7KA 4QXGL 5AC7A 4PY8J 1QK0A 2VXVL 3D6GA 3QXUA 5J8OA 3FF7A 3D1MC 2V4LA 5E95B 5BVPH 1JPIA 1W9DM 1JGDA 5KAQG 4X80L 5T5NF 2FH8A 4JLRB 2NY1C 4NP7A 1S2VA 4KVNH 2P80A 1TENA 2ICWA 3NJHA 5EA0H 4M56A 4PRPB 1M1BA 1X5ZA 5DJ2B 3BT0A 3U2CA 3PABA 5ECGA 4F48A 2I17A 2QCLA 1E72M 4IBLT 2Y6TE 1F3TA 2MCPL 2IDSA 4KO5A 4YSUA 5D7LD 3HU7A 3FUEA 3D69A 1RLWA 3O07A 3I2CH 3MMUA 4I9JA 1MLCA 1NCBL 2Z4TA 5BOZG 4BD4A 4MPQA 2E7CA 4M5YL 1YJDH 5L4IA 2EBNA 3QUKB 2V3DA 2Z27A 5IW1A 4G11A 3QRBA 4A37A 4F0SA 3JV4B 3D87B 1MI3A 1A5FL 4HOWA 2VC6A 3K6IA 3N42B 3NFPA 5LNVA 5DS8A 2J88H 4Y2OB 4KTYA 1I3GL 2J7DA 1TPFA 2Z0BA 4Y5VB 3VXPA 4Z7OB 1MQRA 3ONCA 4E9SA 3DXAA 3C5ZC 4RW3A 3VXSA 2NY2C 3ML9A 2NSOA 5A7BA 3SJVE 4XNQB 3M7SA 3WD3A 2P5EA 3AG2B 5DRNA 4ORIA 1TRDA 3U36A 4ICNA 4NN7B 1U8CB 4DF0A 3W7CA 3VXQA 3GAKA 3DGBA 2GK2A 3U7YL 4NC1C 5AVUB 4MQ7B 2D7OA 2ABBA 3FXIC 3JWOC 4AL8H 1P7HL 4MNQE 3HRZC 1PDZA 4MPKA 2H1PH 4L05A 5H6HA 1QNZL 3ARXA 4ATWA 1JZDC 5G4WA 2PNDA 4JQAA 4AXNA 3ITOA 4LQFL 1W8SA 1W3JA 2WP3T 4P5TA 1LLAA 3TH4T 1ORQA 2HEJA 5K9QG 3CFKB 2JB5L 2OQJB 2YLAA 4ELKA 2VMFA 5CSUA 2AXWA 5E2WL 2NR6D 2NX3A 4UIOA 3EH2A 1JZGA 3S2NA 3W1QA 2WOBA 5IW6A 3KXFA 1RURH 1U8MB 5ESVB 1UOZA 1YDYA 3HC2A 2LU7A 3VRJA 4AZ8A 1D8WA 2AQQA 1DDHA 5K9XA 1ZXQA 2P8PA 1G4EA 1GYLA 4N3TA 3WI9A 3HBLA 5FYJD 5I07A 2FO4B 1TQSA 4XWOD 1OX5A 3A6BL 1F76A 2XIIA 1T1YA 5E9DB 1ZOXA 1R34A 5AW9B 1QSFA 2KZKA 1XGQA 1GMEA 4MNLA 2VXSL 3WNNA 4GH3A 2QCDB 1BV8A 1TCMA 2J2ZA 2Z31C 1M7OA 4TQTA 3OPZH 2WLNA 5E2UH 1EAOA 3SDAD 3T8QA 3U0PA 1R4XA 2LVCA 3BSGA 1KWKA 1ZNNA 3RFAA 3ZGIA 2VXTH 1KXVC 1SQ7A 2PP0A 1N10A 3CE1A 3EYPA 5IJBC 1MELA 2XTLA 3SY1A 3VAEA 4FJZA 1OTUC 2X8RA 1ECYA 4U1HA 2HSAA 3SOBL 4A6GA 5F7EH 1J6OA 2BVOA 2YCKX 5AYUH 3G1DA 1J5CA 2NLIA 2BHUA 4XNXH 4IIZA 3SIZA 2WSDA 3UERA 1B3VA 4XBGA 4UINL 1E6QM 3QSTA 3QEUB 3MGAA 3LDBC 3QORA 3OA5A 3GHRA 3HA1A 4L2LA 4Q4EA 3GQFA 1TZ7A 3ETBF 1NAMH 1DL7H 3GMLB 3L2MA 4IMDA 2A0LD 3NUKA 4UZGA 4WWOA 4RGMB 2BSBA 4WKHA 3W11D 3GO1H 3SIKA 4N2IA 2DT1A 4M00A 5JDSA 1DLHB 5LDUA 4LLVA 3MC5A 1TELA 3MSDA 4QCIA 4L9DA 2WHKA 4B3ZA 4YDNA 5L9DH 3RU8L 3AG1B 2KBGA 2DQJH 1TFPA 4S0SD 4WKAA 3SPHA 3LNHA 2QUVA 3CVHB 3T09A 1EWEA 1SMOA 3O63A 2ATPA 1QEWA 4US5D 2I5YL 3OR6B 4NHCH 3QFJA 1V93A 4QI3A 3DOHA 4LNRB 1W3LA 4LEQA 3EPMA 2DEWX 2OQYA 1JWMA 2PDHA 4ECNA 4ZAKA 1Z5HA 2ZUYA 3HGOA 4ZMZA 3RF9A 2QR6A 4ODSH 1U83A 1E6PA 4MAUL 5EZIH 1G1CA 2RUSA 2KPWA 5EEXA 4GAGL 1R3HB 1CD1B 1LOLA 3DHPA 4R5XA 4XAZA 3N6JA 4LC6A 1L9RA 2PDFA 4LCWE 3GJFH 1FNGB 3RIAF 2Z6IA 2O5ZH 2HXAA 3QA3B 1O5KA 3S98A 4QEGA 1FWWA 1GVRA 2QUTA 2DUZA 1HX0A 5EUOB 1G7IB 1I9JL 1TJPA 2VXVH 3QDME 3B9KA 2CE6A 3BTNA 5C8JB 3QUML 3N13A 5GZOD 3HQOA 4X80H 5GJSH 1IBDA 1ZV5A 2WMJA 5A2AA 1IHIA 4GQQA 3EO1A 1OC5A 4PEKA 2PWEA 1TPVA 1OD8A 4NQSA 4U6YB 3GC5A 4TMPA 3OIHA 1HXMA 1D5XA 5GRYA 2HWZH 1ZWIB 3Q43A 6REQB 1IM3A 1XF2B 4PUMA 2BSDA 2OR7A 4GAYA 2MCPH 2YRZA 3MP5A 3DX4A 4GBXC 5IQ9B 3DGGB 5AYYA 2XTJB 3REWB 4C6MA 3NIGB 3UPWA 1KIPA 4XODA 4PY7A 5FI8A 1NCBH 2OL3A 4KESA 3B3BA 4FIQA 4M5YH 5DQJB 4CSSA 4JQXC 4KV5F 4JMXA 1UH2A 4KFOA 3ZZSA 4AAJA 3ISWA 4CC4C 3H2EA 3TVMC 1N2RA 1I3GH 5HYEA 4AX6A 1MJJB 5D2LA 1QBLL 2ZXDA 4P61A 4O57A 4PRDA 1MRFH 1OINA 2CGZA 3V0FA 6PTDA 4O19A 1O5QA 4CN4A 4M6OL 2EE9A 4NN6C 2VFDA 1MKFA 4LLMB 4O50A 4AWEA 1O6SA 1QFHA 5B7MA 3MRKA 4NPJA 1T3FA 3QIUD 1Z6JT 4OCWL 2QZRA 4OAWA 4W9HC 3AT0A 1MFUA 3U7YH 3KLDA 5I16B 4N9DA 4JN2B 4N3UA 2FBRA 5KVDL 4F0LA 3ITXA 1B4TA 4I2XB 1TITA 5I6PA 2VC9A 5CILL 4EEEA 4JO4L 1IE5A 3U0HA 1F8TL 1MRDL 3PBUA 2P3ZA 1AIFB 2ALAA 3WSQL 2HPMA 1FO0A 1K3ZA 2XWBA 4LQFH 3BN9D 2R4SL 1L3WA 1XLCA 4N6QA 4HCIA 3LCHA 2DWEB 1OBAA 1MJUL 3BJTA 4N42A 2JB5H 4IJTA 4HTYA 3NCJL 1EEPA 5E2WH 2FLIA 2G97A 3PREA 4L8DA 2JI2A 2BDNL 2D2JA 1CK0L 2F1BA 3G8EA 3GI9L 1ROWA 5D7JB 4UFKA 3ARFD 3ARWA 4YC2B 3GSMA 1NBQA 1XIBA 1ZB5A 5DWPA 5G4HC 1EEZB 3V0GA 3A6BH 5T1LB 3G5WA 2DZPA 4QRAA 1SXBA 1CXFA 1M1XB 1AC6A 1SO4A 2VXSH 3G6AA 2K3TA 5EHFA 3D2UD 3SGJA 2VLKD 1TTFA 1E4XI 2DI7A 2Y7SA 1EWDA 1G7QB 1WAEA 3TZNA 1BIIA 5I1IL 3E3HA 3P4LA 3ARDB 4IG2B 4GYJA 2DV0A 4P2OC 5IBUB 2QADD 4IYKA 2NMSA 4G5DA 2W62A 4K1WA 3CHPA 1O7AA 1E4IA 4IKJA 1XKYA 3U25A 1TTBA 3SOBH 4BWWA 5CSGA 3H3BC 2PI6A 3KP1A 3NQCA 3ALGA 2IPJA 2V69A 5BZXA 3UBFA 2RAMA 2NZLA 4ICWA 2N0KA 5FFOA 3BLDA 1VJSA 2X1IA 4HJFA 5IROC 3HE6A 1YMME 2X05A 3B2PA 4MB1A 4A67A 1XBRA 3RZCB 3VM5A 1H3TA 3LH2L 2CKSA 2HROA 2BSTA 5LBSL 4GP4B 3VMOA 5D32A 3BP7A 2BZNA 2OJ1A 4IT1A 4AI7A 1QBBA 4HOZA 1A5OC 4W6XB 3QK0A 3SQBB 4HT1L 5IT2L 1GTHA 4U1LB 1EP3A 3FGCB 4LTSA 4UQ3B 3SPGA 4EX4A 4KI5E 5F71A 2QHRL 3WD5L 1J8HD 3QAZC 2WZEA 1M65A 1LQSR 3ILQD 2RTTA 4YDKL 2CKNA 1GGOA 1XZWA 1WWWX 3GXFA 1MFAL 4FFZL 3L4CA 2I5YH 3THDA 4BZ1A 3JU2A 1ZLEA 2C7UA 4KWOA 3IJEB 1VZGA 2PTVA 2Q02A 1PXGA 3MLWL 1LWHA 1ZK9A 1GQIA 3VDHA 3QH3A 3UY8A 1VJIA 4ZB2A 1B0GA 3WH6A 4ZQOA 1QLEL 2XTKA 4GAGH 1EUTA 3AJ7A 3G1VA 4PJCA 1WAPA 2BP0B 1S3KL 3MCKA 1OFQA 1D5MB 1V0MA 6A3HA 1JRBA 2KC0A 1S7WB 5F1IB 1QDSA 1AR1C 1I8LA 3MTRA 4KNQA 3VD5A 2VRAA 4LY4A 2ID5A 4QNPE 5EF2A 3A9BA 5BXFA 1ZMYA 2REQA 1V5JA 5BO1L 3ELFA 1JNHA 3OJDB 3VE9A 3B4NA 3K80A 2APSA 1I9JH 1JCLA 1DFBL 2ZSWB 3I7SA 4RDYA 2QVIA 4UTHA 4L4VE 4U7KA 3QUMH 4W6YB 1MNUH 3BC9A 2AV7B 3BW4A 4KI5C 3CQIA 1PFOA 3MWAA 2KAUC 1QOPA 3DBXB 1FJ1A 1RK6A 3TQPA 1MWAL 4O00A 2VEKA 1KB5A 4O11A 1J7VR 4QDPA 1S1RA 4N2NA 3WEZA 1TQXA 2E1WA 1DJGA 3NCOA 3U6RB 5IG7B 3RE0A 3L3KB 2DW7A 4J3OH 5FDYA 2ADYA 3FFCE 3DURB 1H5VA 4ZUSB 4MQTB 2B7OA 1RFDH 5DYOB 3RRQA 1D3CA 3QULB 3MNWA 1CN4A 5GZND 2C26A 3E2SA 3M0YA 3UAFA 1FVEA 1W1B1 1HHJB 4O4YH 3BPOC 3UBXG 1SN2A 4NFBA 3TIDA 1F6FB 3STLB 3NEOA 4L48A 4KDTA 1F11B 1QBLH 2AANA 1D6EA 5DUPL 4ERGA 3RX2A 2EXWD 1WDPA 2F8QA 1SZGA 1KYUA 3MS8A 4AGPA 1I1WA 1NGXB 5JO5A 5A1AA 1XLJA 5GIRB 2DSKA 2CLKA 3G3DA 3OQEA 4P8WA 3EYOA 4OCWH 2KLSA 3G5XA 5GRJL 4RNRB 2EDRA 4M02A 4IRZA 1MVUB 3DUHA 3KWUA 4DJFA 3LS5L 5CILH 3L5AA 1FFRA 3B8TA 1J12A 4H83A 2F8OA 1F8TH 1MRDH 4WQOA 1JK8A 4DP7X 1VPXA 3WSQH 4LRIA 4XPBL 1TMLA 1FZOB 3D0LA 2R4SH 4HSQA 1VPQA 2Z1VA 3H22A 1E7UA 3FB6A 4BEIA 1FN4A 4MSWB 2JIXD 4MZ1A 4FG0A 3MRIA 2CZEA 4MHHG 4Z7WA 1MJUH 5E9AA 2BVEA 1YN7A 4X99A 1HKJA 3MKKA 3US1A 3NCJH 5FOBB 3QR1A 5EBUA 3DVGB 5D1QB 4X83A 4D8PB 1OK6A 3FB8A 2BDNH 3MFFB 4MXVF 1CK0H 1TZZA 3DV4B 3VGGA 3QMSA 3ZJKA 1MFMA 3KCOA 1DVFA 3U0WL 4Q33A 1G0YR 4AF0B 2VX6A 4FS9A 1SR9A 1M04A 1M4KA 3BH9A 4ZD3L 5HA7A 1YNTB 1IE4A 3QEZA 1KUMA 4F0MA 4X4XA 4HQQL 4JEQA 1P6WA 4F33B 4MJ4A 8PAZA 2O6PA 1DUYB 5JQ6L 4B53A 3NM3A 3SUUA 2ADFH 1HNGA 3GMMA 1PYMA 4EBQH 3D25A 2OS7A 1ZFJA 4XVEA 1M7UA 4PJHE 1I1XA 4KUCF 3V95A 3MSYA 3DMMB 3CV5A 5DJCA 4N0RA 3FU6A 1BVLA 4IU3B 3VFRB 1TYRA 2BSED 3HHRB 1K5NA 2XA8L 4AZ5A 1I85A 3MUHL 3UD6A 5BRZD 1EC7A 1KIQA 3EGJA 4NENB 1EUUA 3LN3A 5AW2B 1YYCA 3UAJC 1AHKA 3LHVA 4DUWA 1AODA 4GMEA 2Z2UA 1D2OA 4Z0XB 1E56A 1KTJA 1SVBA 5GGSY 4IK7A 4MF4A 5FO8A 3W87A 3FTYA 4JDTL 1NDMB 4FI7A 4PRHE 3FQXB 5CLZA 5C9ZA 3HV8A 1JPTL 2WC3A 3QZWA 4A2GA 5KYUB 3MANA 3IRZA 3WN5A 3LH2H 3JBG7 5LBSH 4GUFA 4AH7A 2JKTM 5FFLA 4GYKA 1R2RA 1OEZW 3WNMA 1YXCA 3AQUA 2R1NA 3UMNA 4J12A 5SWQB 4HT1H 5IT2H 1GW0A 2XTSA 4TQPA 5EUKA 4RPQA 4PCPA 4G6AC 5HHNB 3T1FB 1PO9A 2QHRH 3WL9B 1ODZA 1E9OA 3QQ9D 4YDKH 4I3RL 2W63A 3G04B 3D3VD 1MFAH 3RJXA 3EX4A 4N1HB 1FX6A 2GJRA 4FFZH 2QVNA 4L0PB 4ONHA 4ERSL 1T1WB 2NCEA 2AI0L 1AZ2A 2HBVA 3QYSA 4H9TA 3MLWH 5AKQA 3NQIA 4XB3A 3RHWF 5CG0A 3V4VB 3D39A 2CGYA 2ARJA 3EFDL 2DVUA 2XN9E 3SKOB 4P2AA 5D2XA 4YHNB 1BAGA 3S97C 4WU5A 4K9EC 3TU6A 1S3KH 1OWWA 3HG0A 4JY6B 4RMBA 1EAJA 5E6IC 5IHBA 4UDUB 1UCBL 4ATTA 2J74A 5D2NB 3MRDB 3DOSB 3GTTA 2ZXAA 1EZLA 1F3DH 3N43F 4AD5A 5IMOB 4X3ZA 1NKGA 5BO1H 5J11C 1HI6A 5D1ZI 4FP1A 1DFBH 4Q4QA 4CADA 2Z7KA 4HIJB 3Q2WA 3EWCA 3OKDA 3M17A 1RJQA 2VCOA 5DO2D 4DKFL 4WAFA 1PS9A 4I0PB 4NXKA 1AR2A 1R5YA 2XN0A 5EZOL 4JFYB 1PTGA 3MXWH 1MWAH 3DDMA 4N26A 3VXME 4EN3B 4MQXD 1PSPA 4FF9A 1TU2A 3C2SA 3QDAA 5BJTA 1HDMA 1F41A 5D7IA 3AITA 4NJ9L 4O10A 1W1VA 1CCZA 4KCVA 3NCFB 3O81A 3V5HB 1RHHA 2C16A 5IB2A 5AYBA 3MBEB 2DBLH 4AYID 1WSST 1L5GA 3ZLHA 2OZ4A 1X9UA 3CMFA 3BIKA 3H1ZA 3UZEC 4GKNB 1GSMA 2FWLB 1THAA 5AUMB 3WO4C 3MBFA 4MKSA 4K3EH 1XGRB 1UXWB 2RQ8A 2EDKA 1J0YA 1J0JA 5DUPH 2BNRA 5F7DA 3WYZA 1UPPA 5I0YA 3VXSE 3GE7A 3ALPA 3WG6A 5T8GA 2Y6ZA 3CFUA 5A95A 3PZNA 3DYMA 4GSXA 3TIEB 3HZYB 3VFOA 3VRIA 4KMTL 5CEZD 3ECQA 2J8UB 1H5BB 4GRWF 3PZ9A 3SDDB 3TW7A 5GRJH 2VDPL 1EVUA 2MOQA 4BF5A 3CAWA 2GT9A 2G0LA 4ZODA 1J0IA 3LD8C 4F8NA 3DAQA 2Y7MA 2J7HA 1Z7JA 5DEZA 3LS5H 3CPLB 5IFAL 4XBPB 1KQYA 1PWMA 3LKPA 3GI8L 3T6WA 4A6YB 4HPGA 5AHMA 4MLIA 4Y4FD 1KULA 2C1IA 1C7TA 2H2PC 3M64A 5HYSG 2FNWA 3T0XA 1UGNA 3QG7L 3IGXA 5D2YA 1TPEA 3B7TA 4XV0A 3M1CA 4KXDA 5T3ZE 3X14B 3G24A 3FRPA 3BVXA 4M1DH 2JI1A 3SDYL 4M4RA 3MA7A 2PDIA 1OAJA 3S1XA 4IBWA 4F2EA 5KSAD 1KFLA 3U0WH 1AHWA 1TIUA 4TO8A 4NRXA 4KHTL 3PR2A 4K3GA 4QD2E 4YSOA 3NL3A 4ZD3H 5EGRA 1XG3A 2WWDA 3MLSL 4NKOA 5KYXA 1QSFE 3T3MF 3JRKA 4HQQH 1VLIA 5F0LB 4LGSB 2EC9U 5JQ6H 4JFDD 1I7TB 4EPEC 3QKEA 1RZJL 3KR3L 4H9ZA 5LIWX 2QPXA 5LGHH 3C8KB 3A5FA 1S39A 1DO5A 5B39G 3O1NA 3O3AA 5CBAA 5GS0D 4PTUA 5CLTA 5A2FA 3W7PA 2OMNA 3DWTA 4XISA 3AREA 1KXQE 2X4UA 2OXGA 1CECA 1PV8A 2XA8H 2WLLA 1B0WA 4OFCA 4P5TC 5GS3A 3NSDA 4KQ4L 5I1EL 3UL4A 3L9YA 1I4FA 1RH8A 5FDWB 3ZM8A 4NZ1A 2ZT9C 1HSAB 3RVVD 3N25A 4OLVL 3OIXA 1GYWA 4JDTH 4KNSA 1D5IL 3T77A 9RUBA 4YTSA 2NUXA 1JPTH 2VFHA 1NINA 1U8PB 4ZI8A 1AI1L 5FSDC 5DURD 4MAYD 3O8XD 3WJYA 4NKQB 1KGWA 5HDBE 2QQNL 5DRXA 4DH2A 1KN2L 1HILA 3N34A 2GYSA 2YSWA 4EIUA 3T1GA 1W72A 2V5JA 4ML4A 2V33A 4A7QA 3AC0A 3QI9B 5JORA 1W5QA 1ZTXL 3W7NA 3TA3B 3T0ED 4A38A 1OFAA 4A3UA 1NDVA 3KEDA 1RZGA 1MUCA 5A8MA 3MVIA 3O6KL 2NVDA 2QIIA 4QRUB 2ERJB 4KH2A 4I3RH 3GWJA 3GM8A 5ECJE 3MOBL 4ZQKA 1SO6A 4Z8FH 4P8QA 4I89A 4WSJA 1QFUL 3QFJE 5ICZA 1VAHA 2NXHA 4ERSH 2KMWA 4KDWA 5LBVA 1JHLL 1S7SA 2UY5A 4DGUA 3FTGB 1QVOB 2AABL 3UYPA 3TN0A 5DUBB 5FV1L 3BGMB 4OZHF 1K7FA 3EFDH 3KX6A 4PJFA 2CIKB 3BD4A 3W1NA 3QV9A 3TC3A 2IF7A 1HN1A 5HDWA 5JBDA 3QORC 1VGEL 2PAJA 4XB7A 1GOKA 3T42A 1NKRA 1UCBH 3TTOA 3P1VA 3RWEA 2CO1A 2R1YB 3E6FA 3PTKA 5CC6A 1DKWA 1ZSHA 4YHML 1QMUA 4HWBA 4UTBA 2UZXB 2EH8L 1LL1A 2AZUA 4BHYA 2X2IA 3ARBC 1MCJA 2ARJQ 4DKFH 2VDNB 3GQYA 4JPGA 3O2VL 4UDTA 25C8L 2WKJA 1LT8A 2VGGA 4TV3A 5D8WA 2Q3ZA 3HO8A 5LWYL 1PCXA 1B9BA 3W9DA 4K7VA 3M5XA 2HT3C 4O52A 5AZEL 1GGYA 3NYDA 2AQ3A 2P8BA 4U1JB 1AO7E 3VFMB 2AQOA 5DUJA 4OGAC 2W3ZA 4KXZH 2ZAIA 4NJ9H 1MFNA 4ZAKC 3FVDA 1FA4A 3WJSA 2VAJA 3P9WB 3S9YA 2EICA 3L3OA 1HIML 5MEPB 5HHMB 3FA5A 1A3WA 2ESVB 4FXGA 3FUIA 3KS5A 5IY5B 4HALA 4LUJA 4PIRF 5H94A 3B7UX 2OJPA 2QJMA 4QTHA 2AW2A 4Z0JA 2X7WA 2J4WL 5D2LE 2QGHA 4F66A 2FJFA 2MANA 5M94B 2NQ3A 1CURA 3IMTA 2YD2A 3Q5OA 1E2VA 3QDGA 3OBKA 3UO1L 3B9KC 2EPLX 1RHCA 5FGCB 4AV0A 4KMTH 2Y61A 5A2IH 1DVTA 1MCOH 1I7ZB 3CB8A 2PPFA 3L4XA 2VDPH 3EWWA 4F7MA 3FY1A 4X5RA 2VAAA 4M7JL 3MSGA 4Y4HA 3RDTD 4H9VA 1F90L 2HVMA 1RZKC 2VKXA 2B08A 5IFAH 5EU9A 1OANA 1JYXA 4IIDA 2IXUA 3ME0B 3NCMA 1FWAC 2R59A 4UWQB 1U1HA 3QG7H 4NCDA 3RAJL 2XY1A 3QPQC 1ITCA 3VIHA 1H7OA 3SDYH 4YLWA 1BF8A 4MD5A 3SE8L 1CPUA 5F7LB 2NX5D 5D5MB 1W5PA 3DFHA 3VFGL 2EYSB 5FK9B 3B8WA 4GG6E 2UY3A 3E8UH 3BW3A 3HGSA 3LTYA 1HG3A 4JYFA 3SE4A 2QVFB 1LLWA 5GNXA 1IAIM 3JTTB 3CT7A 2V2TB 3BGJA 2GSIA 1PY0A 4KHTH 5AKRA 1HH9B 4X6CB 4JRXB 3VI4F 1J10A 4ESKA 3MLSH 2JBMA 2CRYA 3P0WA 2JIEA 1QWKA 4X6BA 1KNOA 2PXYD 3QDJB 5DC4B 3LAFA 3HG3A 1GGTA 1TEYA 4WKZA 2EO9A 4HJGA 3CPUA 1RZJH 1W3IA 1CG9A 2E9BA 2D73A 4F0KA 1TWWA 3WIAA 2HVNA 2JJSA 1PB0A 1IFRA 3QR0A 5TDPA 4S3DA 2EJAA 4HEPG 2HS8A 1CVSC 4DP6X 3EJQA 5HJGA 3X1FA 4S0TD 3KDPB 1WGVA 4PJGB 5I1EH 4LARL 1A3HA 3URBA 4GQ9L 5SWSD 2WBXA 5I3GA 5JW4Q 5FA4B 2P88A 4GOSA 4Q4PA 5AB1A 4OLVH 1RH9A 3O16A 3FQUA 1HKWA 1N6VA 5B3JE 1SFHA 1YEFH 2QQNH 3ALFA 3EGXA 1KN2H 2NQZA 3NURA 3MRHA 2QEJA 1W91A 1WYJA 4XP4L 3FTWA 4X5XA 1NIBA 2CDGA 4DK3A 2H3DA 4MSSA 4DXVA 1ZTXH 1LL7A 2FWOA 2Z7ZA 2K6WA 5A7EA 2Y72A 4HPXA 4G5ZL 3D34A 1T41A 2YEQA 2AEQL 1GG1A 1LL4A 2JF1A 4QKTA 4PRAB 2IVFC 5KJ7E 5DQDL 2PLCA 5FJTA 3MOBH 4JG1L 2QW5A 2YZ1A 1NGZB 1LK3L 3TP4A 1UURA 4F40A 3M45A 5I9QB 4OCLC 1JHLH 3CZEA 5DVNA 1PVNA 2P47B 1JDCA 4QLLA 5G5DA 3SN0A 5IKCB 2AABH 4YHEA 2CM6A 5FJIA 2E6FA 3STEA 4DVBB 4O02A 1YDNA 2G2NA 1LEKA 1QG3A 4ODBD 4M9PA 3LA4A 3M4HA 4L4TB 4PJCE 4ZOAA 4EAMA 1ZHNB 2DOCA 2R2EA 1VGEH 3HE6C 2Z64C 3UYRL 5FECA 2VX5A 3RN6A 3W2NA 3TGXA 1MMFA 1CFTA 2P4AB 1UM5L 5DJXA 5KSUB 2YPKB 1NCDL 3ZKSD 3S2MA 1FFPB 3ZQXA 2OQHA 4YHMH 2A4CA 2J20A 4H01A 1EOMA 5FFGA 4KKCD 2FGWL 4OFDA 2JGYA 2EH8H 4PB5A 2C4XA 3ZOAA 4Z7OF 4HAGA 5TDNB 1E65A 3CCHB 4PRHA 4W7VA 2OOFA 4HCLA 1VGKA 3G9VA 3IMBA 3O2VH 4DP4X 3IPFA 2D31A 1GEQA 4REQB 1F4XL 1XWVA 5LWYH 2LLNA 2HVOA 2C9SA 4M3PA 5AZEH 1SJAA 1LP9B 3WLMA 1D9KD 1XRTA 2K0RA 1R3JA 3H2AA 1WD9A 1LNUB 4E9RA 1FIGL 3T4YB 2XYCA 2WV3A 1F3DJ 2Z93B 3A6CL 3WUFA 3FT4A 5D96C 3NJGA 2H3BA 3S46A 1HIMH 1U8OB 3AW5A 3HE7B 4BWLA 1E42A 3W84A 1UZ8A 3QYQA 3FN0L 4X9BA 3S1VA 5D9PA 5MERB 5FUCE 1I1FB 4MRCA 3VWJA 3NZGA 1I7RB 8TIMA 4YL4A 2NYYD 3W39A 2XWJB 5FESA 1OX4B 5C0AD 3TN3A 4TL4A 2OVLA 3S4SB 1X1ZA 1I8LC 3OV6A 4I18A 3P4OB 2DN7A 4YPJA 3D5HA 3FYYA 2PGEA 1QI3A 1G01A 5D7KE 4QTFA 3SI9A 3GTHA 1O12A 1E9IA 3QQ0A 1EJOL 3CV1A 3Q05A 4WDTA 4Y1TA 1TB3A 4G80B 3AU0A 1FOBA 3UO1H 4OSUL 2N59A 1M42A 1D7BA 3VH8G 1KEGL 4EWND 3P02A 4NJIA 1AKJB 3B2UD 1HGWA 2IDCA 2E46A 1KV3A 5EOTB 3RX8A 2EDTA 3EOOA 5A6JA 3IKCB 1UYWL 1A3ZA 4M7JH 4UOW1 5E24E 3AIEA 2YZ8A 2J9ZA 1F90H 1U42A 3F5KA 5HD8C 3DG3A 3MUY1 4PUNA 1EBPA 4PP1D 1H0IA 4LNCA 4F91B 4E9XA 2VLJB 5TDOA 5C0GA 4W4QA 5I1LA 3OXSA 2VGLM 1OALA 5DCCA 1M03A 3C12A 2YJLA 5G1YA 2NY3D 1AL8A 1J96A 3GIYA 3WY2A 2P8MA 3RAJH 5FWRA 4Y9FA 2I9TA 1OVZA 4Z7WE 4MJIB 2WBGA 1FHDA 3RX4A 1FWNA 3S6OA 1A5CA 4NQTA 4YK4C 3DERA 4NO0A 4F8PA 3VXMA 5JHDA 5IB4A 4RNFA 2F7PA 4R7DA 3SE8H 3QUZA 4ZXBB 1SVDA 3WIFB 3FSTA 4YSQA 3VFGH 2OU4A 3B0PA 1T1ZA 1V6UA 2J56A 2L7UA 4N2HA 1A1OA 2EKSB 4KDTC 1EQPA 2Y6SD 2Z1XA 4NBYB 2E4TA 2MCG1 2OZ3A 3NJVA 3R8GA 3VDCA 1QATA 5F96L 4NQDE 4N5UA 4O14A 4WI4A 2ATSA 3ANYA 4Z7NE 3OZLA 4F8LA 2YD8A 3VMPA 3VGAC 4MA3B 2OKTA 3CXHJ 3KM8A 4JKMA 4H25B 3GXMA 4I9WE 3ZZ1A 4RZCB 3B9AA 3CLFL 1L6XA 3ME3A 4RRPG 3C6LD 5AL0A 1U8HA 2BGNE 2AVGA 2B59B 3G0UA 4HOXA 4QQ3A 4RGOL 4LRIC 3VZZA 2DQTL 4CDHA 2ZYSA 3U9UB 2WVVB 3B7RL 4HUXA 1X5AA 1FAKT 4NVTA 1YBQA 3I50L 3QG6B 4LARH 4OFQA 4LGPB 4AD3A 1R3KB 4GQ9H 1G7JA 4HOMA 4AKPA 2ZG1A 2XH0A 2GJZA 4O53A 1QSZA 1IEAB 3CC5A 4F9LA 2CESA 2YRPA 3AMCA 3H4WA 2W67A 2EH7L 3PBGA 3IFPA 1AZCA 2I27N 3UGVA 2QVHA 4AXWA 4UAHA 2PDKA 5CH9A 2EG6A 2M1KA 1P84K 2OFQA 3MRPB 3RL2B 1SXCA 5F93C 1WDSA 2PDNA 5CIPA 2XWEA 2Q7NA 1UZDA 3T4AB 2O61B 1H50A 4M43L 1PHWA 1Q7ZA 2EVHA 3NQVA 1CLVA 4LW7A 4MJHA 4AVHA 2XN1A 3JWNH 4G5ZH 4GRLA 4MDJB 2ZVIA 2AEQH 2ZONA 1AJ2A 4KW2A 2PCYA 5DQDH 3TYFA 4MNHB 4JG1H 1BP3B 4A7UA 1MXGA 3QWRA 5DJ8B 4P7RA 5C9RA 2APXA 5JUVA 5BOOA 1LK3H 5GGRA 4OLUL 3RPKA 1S5WA 4D0DB 1FNEA 5C54A 3I6KB 2CD0A 2WB5A 3OAUL 4EACA 2V9RA 3CUPA 4XN9A 5DX7A 3I75A 5F21B 2ZUQB 3N9RA 2FJHA 1I85C 2QKIB 4HMDA 3QXAA 2PGFA 2GC4C 2C0HA 2ZD0A 3D39E 3SGKA 2JFEX 1YZZA 2A73B 2UX7A 1VP5A 4DPBX 4RMRA 3PC0A 3LBOA 1ORSB 4X4YA 2P43B 3D4YA 3CDZA 3ZT6A 4NAQA 4XCFL 1CT8A 3I6LD 1E0UA 1HE8A 1KXQA 3GLDA 2E7FA 4ANUA 1HH6A 1TPDA 5JHBA 3ESMA 1UM5H 4G9FE 2NQ5A 4BQCA 2QCGA 5I6LA 4J8RA 3WN5C 1NCDH 4PRIA 4UT7L 4ZMAT 2C9AA 1BJ8A 4HSCX 5T1MA 2EINB 3W02A 1SMAA 2FGWH 5FYLL 4U3XA 4CQBA 1ETB1 2IAND 3CSYA 3BESR 1PTDA 5DMJB 3D2TA 1DQQA 4XCCL 3CYJA 4CGUB 4LNYA 3W7OA 1S5HA 3GDCA 1Z9MA 1F4XH 4PE8A 2YD0A 3ZKMC 3EOAA 4M5PA 3EHBD 3DVIA 3PZUA 8XIMA 5JOEA 3L5HA 4UUJB 1E7VA 3A3WA 4EF8A 3EADA 5D7IE 4P4KB 3P2BA 5BU9A 3ZDZB 3AQZA 4C7FA 4X5WA 4Q9CA 1FIGH 1V0KA 1W0WA 5E5MB 3WTSA 3A6CH 5CEXA 2XC8A 1QRND 1EAQA 4QIUA 3L5IA 1P7BA 3EJYC 1JGVL 4EJ1C 4XBEL 2IC2A 3FN0H 3FFDA 3F7PC 2E9JA 3AWFA 1EEQA 5I02A 4Z2KA 3GS6A 4BBWA 1JPHA 3UU0A 1ZK5A 5A6TC 2CCRA 1SDDA 4OU1A 3RVTD 5KANI 5CMAA 2Y06L 1YAZA 3HGJA 2E40A 2BNRE 1I9CB 4QS6A 2W5PA 2G3ZA 1XIWB 2N4IA 2WM0A 3MV8E 5ERWA 4HJSA 2A9NL 4PGDB 2KLRA 4YVUA 2BNQD 1EJOH 3WELA 3TEWA 2A6LA 4LVHC 3IDYC 4OSUH 3ULVF 2PFHA 4QF1B 1KEGH 1BWLA 3CH8A 1FP8A 5I1GL 2WTRB 4P3DB 2WYIA 4O2CA 1ADQA 2ZAHA 3DRTA 4QHMA 5GGQH 3FQNB 4IRJD 3G6JB 1UYWH 3IFOB 4R3SB 4AYFB 4RCAA 5MHSD 4YWGL 4QXGH 3T8MA 3A4EA 4TTDC 4C83A 1BVNP 1ML1A 1HJUA 3X1EA 4G8GD 3K4WA 4LFHD 4F9DA 3RWFA 1KGXA 2QCFA 4Y9PA 4JZOB 3MRJA 3RFZB 3WDPP 2X0UA 1J8VA 3VD9A 3PNWB 3V4PB 1L7TL 1AO7A 2FTPA 4WNJA 1T8XA 3SSJA 3CMGA 3UPCA 1YPZA 2XFGB 2EPOA 2EIZB 3ENEA 2Q9OA 5D7HA 1A4KB 3AT8A 4ZFOL 4RBPH 4XTRD 3BXNA 1H09A 3FS9A 4C54A 5F96H 5HHOA 2P24B 3T9WA 1PZ5B 3NXLA 3EYQD 1T6VN 5HOSA 4WWID 1XI3A 1QNQA 3ECWA 5AYTA 1A5FH 1A6AA 3I3DA 2A1YA 4EXAA 1V77A 1XT5A 3L4WA 1XXDC 3EMCA 4KUZL 1V3HA 5E8EB 4JFED 1MEHA 3GZAA 3QWQB 2P3YA 3NGBC 4LRNL 3UJRA 4L9LB 1T5XA 4FA3A 4F7TA 1CDYA 3Q7JA 1FI8C 4MD4A 4JX6A 4DO5A 1VS1A 3T04D 2GUYA 1OARL 2DQTH 1RVGA 2RAGA 1WZKA 4R2GD 3WL0A 3W5MA 3PULA 2VO5A 3I50H 2Y5SA 3D85D 1TFVA 3TJIA 4MJ2A 4ZQCA 1BZ9B 4DGIL 1N8OE 1M2VB 3O3DA 4FJYA 4QY8A 2QGDA 5MEND 2YD3A 1RP8A 4M5SA 5E99L 4J3ZA 1IJ9A 4NT0A 1QNZH 4JJ5A 4TKWA 3A5VA 4FLOA 3VNJA 3W7EA 2EH7H 1TLMA 3GXPA 3QISA 4M8VA 5DELA 1CS6A 1AHWC 2XWZA 3FYEB 2X7LB 1GYNA 1VACA 2VVNA 1RUML 5HGHB 2BXZA 3OB8A 4OLEA 3TZVB 4F2MA 2XWCA 4M7KL 2D2CC 2BNUB 2X70A 3V6FA 1U92A 3REQB 4M43H 3D07A 3FOMA 1TMCB 4C56A 2SFPA 3S47A 3MLPA 4JFHE 5I74C 4GG6A 2KZWA 2B7NA 3DOPA 3E12A 4B15A 1ZA6B 4WDUA 4HFWA 5DA0B 4PC8A 5IUSA 2Y5TB 5B8CB 4OLUH 4YDJA 5IB1B 3OAUH 3H7BA 3AREC 1UJQA 4OF7A 1A9BB 2GY7B 5AAWA 4ENED 1G87A 1EGMA 1X1OA 4DT2A 3H0TA 4LSSL 4E0CA 3UR7A 4HU8A 3GNML 1AGFA 1JCVA 1O6TA 3FJNA 1B9KA 1NCWL 4PJFE 1U91A 3N6YA 2P46B 3G1RA 4ZS6C 1FXPA 2VKZG 2H0EA 3NIDE 1Q6OA 3F7YB 3DZ1A 3CWHA 3FOLA 3FPYA 3IE4A 3SIMA 1XAUA 1GZQA 4QPEA 1KRAC 1QZNA 3PWVB 4EANA 1C5DA 5CJ8A 1KM2A 3TFCA 2Q8LA 5IVOA 4UT7H 5EO0A 1KKRA 1RSYA 2QZ5A 3VCCA 4UINH 4JZJA 5L88L 5DSCB 4NZCA 4PJAA 2VM8A 5ISZB 5GGVL 3B3IB 4XCCH 12E8L 3PG9A 4F57L 3W0KA 1VLXA 1ZY9A 3X3GL 1BRLA 2YIHA 3TR9A 1W1IE 4V2BA 4ABQA 4PJ5B 4ODUA 2IADA 3W53A 1PAMA