3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
b'VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
3CV5A 3EMZA 2DSZA 1V3LA 3CLWA 3QHMA 3H54A 1BFNA 1ISZA 1OIFA 4PMYA 4J3VA 2ZXAA 4Z2HA 4DWSC 4D1JA 1A3HA 1NOWA 5D9OA 3T2OA 4B3LA 1GQJA 1R7OA 3ARVA 5FIPA 3ARRA 3KLLA 3IAPA 1NM9A 4P8WA 2F7PA 4U2ZA 2DT2A 1G94A 2VC9A 3CBWA 1CTNA 4TXEA 1B90A 4XZWA 1PS2A 2ZUUA 4W84A 7A3HA 1TVNA 4EANA 3LPOA 5ABFA 3MI6A 4UZSA 1LL6A 4W93A 1OT1A 1WZMA 1KXQA 2DQXA 4H8UA 2CHNA 4JL1A 4PBGA 1WE5A 4HPGA 3IJ9A 4CN4A 1V6YA 5FOOA 4MNMA 1MQRA 3WF1A 2XSBA 3EJUA 2O9PA 1D3CA 2XJ7A 3L4UA 5HOSA 3T09A 3SUVA 3WNMA 2WNWA 1HXJA 2PWGA 1EO5A 1GOWA 2NT0A 1W91A 2G4FA 4AEFA 1ODUA 3BMVA 4OBSA 4RE3A 1E15A 3WL0A 4FNUA 4TVDA 4M24A 1MXGA 1V02E 3WL1A 1NH6A 1E73M 2WLYA 1UR0A 1JYNA 1E9LA 3SCQA 2G8ZA 2XN1A 2JF7A 4QLJA 3WNLA 3LRKA 4U31A 3W0KA 3LPPA 2EO7A 2VQUA 1NP2A 1OD0A 3WN6A 1EGZA 1WZLA 3RDKA 1SZNA 2J75A 2V3DA 1V02A 3UR8A 1M04A 4UZUA 4XV0A 5JIWA 1UHVA 4DWSD 2YLLA 4P7LA 3QHOA 1JDAA 3W6MA 4E8CA 4OOUA 2J7HA 1MW2A 1HP4A 4GXPA 1GOKA 1PCPA 1ISWA 3AIRA 3OZOA 4QCEA 2E4TA 4DWSA 2ZX5A 5JBEA 2V3GA 2J78A 3ZR6A 3MKKA 2ZUNA 1UWTA 3HZ3A 2F7OA 3M6DA 2PWFA 1KQYA 2YL5A 3RCNA 3BLKA 3BVVA 1NWTA 4AZHA 4HZ8A 3PN8A 2PSPA 2PI6A 1JG9A 1JXJA 4JFWA 2YDQA 1UD3A 1V0LA 4MB4A 3S2CA 1E6SM 1WKYA 3S5YA 1BVZA 2WWDA 4GKLA 5CXPA 3ZJ7A 3W81A 4P8XA 3B9EA 1OGBA 2V3FA 4R5EA 1HT6A 2WB5A 2E3ZA 4ZFMA 3H53A 1E4MM 1U30A 1MVYA 3NJ3A 1I1XA 3WUFA 1R86A 4U3CA 3W38A 3KZSA 3AICA 5ABFB 1GCYA 2GK1A 5IFPA 4J3XA 1VFUA 2WVSA 1E3ZA 4D6FA 1R7AA 3F4VA 1KWKA 2FGZA 3CZNA 4QLLA 4CU8A 2WC3A 4EKJA 3GXPA 3ARSA 3BMWA 4CUCA 3GBDA 3W53A 2D3LA 1JNDA 1JF5A 1EQPA 3A4AA 1KGUA 2DIEA 1VRXA 3VIOA 2PWDA 1JZ8A 1NOUA 1E72M 1Q6DA 5D9MA 4OGZA 3MUAA 3CTTA 1M7XA 2J7EA 4P8VA 3WDHA 1WP6A 1QWUA 1J0ZA 3DDGA 5BWFA 3TTSA 2DH3A 1TMQA 1QI0A 2F1AA 1K9TA 1UWIA 3PTMA 1W2VA 1KXHA 1E56A 1U2YA 2CBVA 3W27A 1MYRA 3A6OA 2IXVA 1BF2A 1A47A 3TOPA 4PMXA 3DX4A 3ZJKA 1IT0A 4V2XA 1V6WA 3WBEA 1NARA 3VGEA 2F8QA 3VIHA 1QBBA 4TX8A 2DSVA 1E0VA 4FLRA 1GHSA 1W9BM 4DWSB 4RE2A 3WNPA 3VDCA 1HJWA 1QBAA 1J12A 2YBUA 4MNLA 2WVTA 4ZE5A 1TQUA 2E9MA 3WIJA 1SR0A 4DUXA 2YIHA 4W5ZA 3VTRA 3AS0A 1VJZA 3JUGA 2WW5A 4HOZA 1V3JA 4JZ5A 1ITXA 3PZTA 1JZ4A 1E6NA 5E6YA 5CLWA 3U57A 3BXWA 1GZJA 3CUIA 5M3WA 5JBFA 2Z1SA 4N42A 1QI5A 4NXSA 3DYMA 5FD0A 5BRPA 1FOBA 3ZO9A 5BCAA 2IXUA 1F4HA 2WHLA 1QNQA 2JE8A 1HF6A 2EPOA 1TVPA 2FDMA 3FY1A 1PZ3A 3TTYA 1FH7A 5CLTA 5C71A 4JFSA 4AC1X 2E40A 4UFMA 3AIVA 2BY0A 1OGSA 2GK1B 1W9PA 2ZOXA 2HVMA 2VCCA 4W87A 4D6IA 2PB1A 2BY1A 3WY3A 1B3VA 4FMVA 3AMCA 3WF3A 3A5VA 4FNPA 1UQZA 1V6UA 2J4GA 1W1VA 3WDQA 1CGXA 4UOJA 4H04A 2CESA 3GNPA 1CEOA 3POCA 3AMKA 1FFQA 1HKIA 2UY4A 4H8HA 2AMGA 1RD6A 3ARZA 5LA1A 5A6KA 3MANA 3GZAA 3T0AA 1ECEA 3OGVA 5I0DA 3KL0A 2WKLA 3RMEA 3WNKA 2NW0A 2QPUA 2PC8A 1EO7A 3W4RA 1HN1A 2DPEA 3OZPA 5HDRA 1NOFA 3WQ4A 4TOQA 2VZSA 4HOXA 2WAGA 1AQMA 4GO8A 1Q6GA 4MJ4A 4M82A 4W7VA 5HPCA 1JFHA 4JFTA 2VQTA 1CGTA 2BS9A 4MNKA 2NT1A 4PN2A 5GQBA 2WVVA 1XCXA 5M5DA 1XH0A 5DT7A 1W1YA 4PUDA 3WD0A 3T0DA 3AJ7A 1GHRA 4P7QA 2WK2A 2PBGA 1ESWA 4WLCA 4QFUA 4M80A 3SEPA 3RO8A 1ZBKA 1UA7A 1V0KA 3AOFA 3WNNA 2VMFA 4AD2A 3WSUA 3BUPA 2VOTA 3AYRA 1RH9A 3OG2A 1BHGA 2CBJA 5LA0A 3AS1A 3AHTA 1OSEA 4NZJA 5A2CA 2VR5A 4HMCA 1CECA 4HA4A 2VZOA 3ZR5A 1CXIA 4M1RA 3BAWA 2D0GA 1R34A 5A2AA 1GOMA 2V5CA 1Q6FA 4OOZA 3CZLA 1PJ9A 5HPOA 1KB3A 3VD7A 2YA2A 1UKPA 4UFHA 3RIKA 3VIJA 3ZM8A 1JD9A 1TCMA 4H41A 4U2YA 5CZKA 1J10A 3UR7A 5EFDA 4J3UA 3EYPA 3FHAA 3VPLA 2ZIDA 5FL1A 1IV8A 1WNOA 1PSPA 2OLHA 2QMJA 1VEOA 2A3BA 4NRSA 4W8AA 2TAAA 1W3LA 4PMNA 3WF0A 1R33A 1HP5A 4FNRA 3IGUA 4JL2A 3VMOA 4D6GA 5A6SA 3N12A 4CVUA 1FHLA 2WHMA 3BAXA 1LG1A 3MSGA 3N13A 2WM0A 3AS2A 4JCMA 2J74A 4KGLA 1B3ZA 1J0YA 1K9EA 4U5KA 1G9HA 2XSAA 2YOCA 1PEZA 3WMCA 5A95A 2EPMX 2XM1A 1JD7A 2FH6A 2C0HA 3ZIZA 1FP9A 3MUZ1 2EACA 3MMUA 1K9FA 1EDTA 2DT3A 3F5JA 3VX1A 3KEHA 3NSMA 3HG4A 4QDMA 1BQCA 2DH2A 2ZWZA 3POHA 2F7QA 3WF2A 1BTCA 1WB0A 1ISXA 3WD1A 4H2CA 1BYDA 2X0YA 4AWEA 2ZE0A 4J28A 1XH2A 1DWFM 4BA0A 2WCAA 2J7FA 2WVVB 5DMYA 2FGLA 4MAZA 3CZKA 4OZOA 3VNYA 1VEPA 4FF5A 4AZIA 1B0IA 4UOQA 1W9DM 3S6TA 2XVPA 2YFOA 2D20A 5A6JA 3MO4A 4J27A 2WC7A 1TFVA 2WMHA 1KXTA 3T2PA 1E6PA 2VZVA 2YL9A 1GNXA 3CZGA 1E0WA 4CVWA 1KXVA 1E1FA 1H11A 3SUUA 3GNRA 5CPQA 4XX6A 1CXFA 4AZCA 1VAHA 1MWOA 1R85A 1KTCA 3OLDA 1C8XA 3VGBA 1VBRA 1CGWA 1HX0A 1B3XA 3EMCA 1BYBA 4UFLA 1WAWA 3MMDA 5DO8A 5ABEA 3SCTA 3K8KA 3WEOA 1XSJA 5DFAA 4CD8A 4OIFA 1NQ6A 4F79A 1OINA 1G5AA 1ODZA 1BG9A 1GJWA 4HU8A 3NDYA 1B3YA 4AYGA 4V27A 3WH5A 1C91A 5A8OA 1UD8A 3K8MA 1EHNA 2WMFA 4YN5A 4DM1A 5IDIA 3VKKA 1QNRA 2VCBA 3FAXA 4JAWA 4DO5A 1KR1A 2WYSA 2WC4A 4XUYA 1X1NA 4ATLA 3BVTA 3ZT6A 4HZ7A 1J01A 3VSTA 1ZJAA 2GJXA 1BVNP 3UG5A 2GSJA 1MW1A 2JIWA 4U33A 2ZUSA 2EJ1A 3FN9A 4MADA 3GH7A 1H4PA 1W3HA 4X0NA 4CU7A 3BH4A 5D8ZA 1CIUA 3SCUA 3LXCA 3EDEA 1O7AA 4LX4A 2XFRA 2XIBA 1E55A 5EMYA 5D9NA 4H7VA 4E8DA 3VVGA 4XZBA 1HXKA 2X8RA 1V3MA 1EH9A 4KRTA 2VUYA 4W89A 1GJUA 4F9JA 4NX0A 3E1F1 2DSUA 2XIIA 2OYKA 3RPMA 2VI0A 3EDDA 1BAGA 2BHUA 1H0IA 4Z2JA 1LQ0A 4HP5A 1JDCA 3I3EA 4CD4A 3LRLA 3BCFA 3MS8A 2QV4A 3EBVA 2YFNA 4ML4A 4AMWA 2W62A 4TVUA 4Z2IA 1CZ1A 3ZOAA 2Y4SA 2WZHA 4OBRA 1BSIA 1U33A 2BVDA 2EPNA 1LWJA 1CLVA 5A8MA 2XGBA 3NUKA 4LYPA 4PMOA 2O9RA 2YL6A 4AZCB 2XM2A 3UERA 3S5ZA 3WDJA 1BGAA 5EFFA 4X9YA 3CUFA 1RP9A 2VX4A 2D22A 1HL8A 1X6LA 4BF7A 2WBGA 4PSPA 5EB8A 5DT5A 4HPHA 3BCDA 1V3IA 1MXDA 5A8PA 4C7DA 1PAMA 3BUIA 2EXOA 3NIYA 2MANA 3BSGA 4HZ6A 4AD1A 1CGUA 4AYSA 2BV9A 3VIGA 3VD3A 2W61A 4CN6A 4FLOA 4DUVA 2JEQA 1LLOA 2DT1A 3WUEA 3EJSA 5IHRA 1FFRA 2ZUTA 4U3AA 3WDIA 3WY2A 1ZB5A 3VIMA 2X2JA 3J7HA 4UTFA 4W5UA 1QOXA 3BVWA 3OGSA 3WUBA 1KFWA 1CGVA 4E4PA 1XYFA 2YL8A 5GNXA 3BAKA 2BFGA 2X0HA 1VEMA 3PTQA 1WPCA 1CXEA 4BCEA 1E70M 1V6XA 2WPGA 3DX2A 1SMDA 2Y24A 2GJXB 2J8FA 4IPNB 3AMLA 2J7BA 2PF0A 4JHOA 3D3AA 4UQAA 1C3FA 3WBAA 1BYCA 2OW6A 2CEQA 1TQTA 2VURA 3AS3A 2QLYA 2GVYA 4X0VA 2CNCA 1CXHA 1US3A 4UFJA 1H3GA 4BQ4A 3ARYA 2BY2A 2WLZA 3VD4A 2EPLX 1ZBCA 1UH4A 4PSRA 2ZX9A 1WCGA 5BXRA 1GOQA 1BYAA 2VVSA 1S46A 4PMRA 3BVXA 2ZX6A 4CN1A 3QOMA 4AW7A 4DO4A 3DX0A 3G6MA 2YDSA 1WZKA 3NSNA 1QI2A 3ZMRA 5A6AA 2BVTA 3SCPA 1UG6A 3CIVA 2F18A 2XTKA 1UWUA 4CD5A 1ZBVA 3AZTA 2Z1KA 1QX1A 4IUGA 1GONA 3MMWA 5D4YA 1EXPA 1DTUA 2VZUA 2F1BA 3U7VA 3WH6A 1ZU8A 2C7FA 1DWAM 2DSKA 3VINA 2XFYA 2CCRA 1FHDA 4S3KA 3N1AA 3CHCA 2OYLA 1OT2A 5I79A 3BSHA 2A3HA 3SCSA 3VMNA 4FLSA 3TTOA 1JIBA 3OLGA 4GZEA 1UUQA 1QWNA 3SUWA 1BLIA 7TAAA 2VL4A 1RPKA 3CGTA 2VTFA 3W6LA 3AZRA 3SUSA 3AMDA 1EDQA 4NZCA 3A24A 3VIIA 2J79A 2J7CA 1JYWA 3L4ZA 1GW1A 5A3HA 1KCKA 2OWXA 4BQ2A 1TQSA 4LYQA 3D51A 2UY3A 1QW8A 1B3WA 1JI1A 1C8YA 3WDPP 2WMIA 1HI7A 4P7RA 1OGGA 4R27A 3O6AA 1J0JA 4UQBA 5FL0A 2A3AA 4BQ5A 1XYZA 3CC1A 3CUJA 1M01A 3FXYA 5DEZA 1UKQA 3EDKA 2E0PA 4MB3A 3WQ8A 4ZXLA 4MNJA 2BXZA 3BAIA 3WMBA 4JFVA 2DSWA 4UQEA 1QHZA 2J25A 3L4VA 2ALWA 3AHVA 4C7FA 2W5FA 1NWUA 3WQVA 1C7SA 4FNQA 1H0GA 5JIPA 1WDSA 2JF6A 2XVLA 4Z2KA 3WH7A 1EOMA 4PMDA 3OLIA 4UCFA 1KR0A 4JFUA 4QCFA 4CU6A 4JCLA 5E70A 1T0OA 3VGGA 3CZ8A 2J47A 2QF8A 4AD0A 2WZIA 4LYRA 1PIGA 4HA3A 1D2KA 1DWJM 5D8WA 1V3HA 1XV8A 5I24A 1ISYA 4MTVA 1BGGA 3A3HA 1EIBA 3ARWA 1J0HA 4YPJA 1V6VA 1G0CA 4Y7EA 3THCA 1KCLA 3IAQA 1EDGA 3M7SA 1IZJA 1HJSA 2J77A 3A23A 4L4PA 4CKQA 2RGLA 4PMQA 1UD4A 5AYIA 2WSKA 5HBFA 4PTVA 4NRRA 3QGVA 1TA3A 1OWQA 4ACZA 1HJQA 4FNSA 4J7RA 4HA1A 3CHFA 5AY7A 3W29A 2EPKX 1VENA 3VU2A 4AMCA 2VVNA 1VFOA 1EQCA 4Z2LA 4GO9A 4B9ZA 1GQIA 4KGJA 3PHAA 2QPSA 3RM9A 1V0MA 3SCNA 2YA0A 4H8VA 4N0RA 5CPSA 1E6QM 3AIBA 4HOWA 2BHYA 2RGMA 4TX6A 1UD2A 5CGTA 3WELA 1KBKA 4A4AA 3RJYA 4CD7A 1HVQA 3RM4A 1NWRA 1QW9A 1HNYA 5A6BD 5M17A 1VFMA 4WK9A 1ZJBA 4TTGA 3K46A 3BVUA 2FHFA 4J3TA 4PUEA 2WMIB 2EQDA 3OLEA 1QNSA 2F61A 3K8LA 1LWHA 4D71A 2CBUA 3HU7A 4JKKA 1DHKA 1E4LA 1JYXA 4LXFA 4PTWA 1DP0A 4ATWA 3CMGA 3O9NA 1MFUA 2XN0A 2WKGA 2DGAA 1SMAA 4Z2GA 1FP8A 4UFIA 3MU7A 1DWIM 2W4XA 1QPKA 1YQ2A 2FYVA 1BPLB 1UH2A 1JAKA 4F9DA 3ECQA 5LA2A 4AMXA 5BXPA 1C93A 1H2JA 3T08A 4M29A 4UFKA 1J9YA 4ZENA 1LJYA 3ZSTA 2WCSA 3A22A 4OJYA 3ZT7A 1K6AA 1OCQA 3VMPA 1GQKA 2D73A 4CCEA 4W86A 3QHNA 5CQ1A 1M03A 3AQUA 1TUXA 1R75A 3EDJA 4KMQA 1ISVA 1GOOA 4NZFA 3II1A 3IANA 2ZXQA 5GPRA 4TTUA 3TTQA 3VGHA 1E9TA 3TP4A 5A6LA 1DWGM 4JKLA 1O7DC 1JYVA 3AFBA 4CD6A 1CGYA 5FCZA 3LX9A 4NF7A 5CG0A 2BY3A 1TA3B 2GJPA 1N82A 2VNCA 2XPKA 4ACZB 3VDHA 4GIAA 3W82A 4GI6A 1OIMA 1K9DA 3AXIA 4AZGA 3TA9A 5F7UA 1GOIA 2BNJA 1R47A 3THDA 5A8QA 2Y2WA 2YA1A 3ZQ9A 2YKKA 3WEMA 2EEXA 6TAAA 3WKZA 1C90A 2W67A 3WQ6A 5DF0A 3GXFA 3PZMA 1B31A 4J3SA 2VX5A 1KWGA 2XVKA 3L4WA 2ZUMA 1B1YA 1TE1A 1Y7VA 2D23A 3WFZA 5A69A 4Q7NA 1ZS2A 3ALFA 3BGAA 3FAWA 3GH5A 3U5YA 3BLPX 2EABA 4WKAA 5CSUA 4WSJA 2WHJA 1H5VA 3TV8A 5I77A 4GINA 1JF6A 1KGXA 3VGFA 1JNEA 3WMSA 4C7GA 2D1ZA 5BROA 2BVYA 2ZXBA 1UR9A 2GDVA 3PZVA 1JAEA 4HTYA 3CUHA 8A3HA 4A3HA 3WD2A 4QLKA 5ECUA 2D2OA 4WF7A 1HTYA 4P7NA 4IISA 4B9YA 2WANA 4AD4A 4P8UA 3L4YA 2OWWA 4LGXA 3AIEA 3HG2A 4AZ5A 5TD4A 1OM0A 3BC9A 3AIQA 2W66A 3KE0A 3SCOA 3PZGA 4RL3A 1MW3A 3A4WA 3MUY1 2JEPA 3WEZA 3VUPA 4D1IA 3M46A 3EJQA 4PCSA 1QI4A 3VGDA 4PTMA 3WDRA 1DWHM 5AC4A 2O92A 2O9OA 4PMUA 4QAWA 2FE0A 4CGTA 1FH9A 3KL5A 4MPKA 2WMJA 3WFLA 2WSPA 2G3NA 4OKDA 4ZEPA 4D72A 1UWQA 4UQDA 3UESA 1B2YA 3ZT5A 1LF1A 4PMVA 2QMKA 3CHDA 1JZ6A 1US2A 1UA3A 1GVIA 5A94A 5E0FA 3MV01 4Q22A 6A3HA 1KGWA 2J62A 1R46A 1W1PA 1VJSA 1TG7A 1E40A 1J18A 3LRMA 3LPGA 1XRVA 1G1YA 3GXIA 1PX8A 3PBGA 4M81A 1UOKA 1QVBA 3K4DA 3RM8A 3FW6A 3WNOA 2CETA 2CYGA 3VILA 1JDDA 1G01A 4L4OA 4WKHA 4QP0A 3AXHA 1CPUA 1VIWA 1TZ7A 1MW0A 4AD3A 3M07A 4D6EA 2PWEA 4EAMA 3MUIA 3HG3A 1JFXA 3DX1A 4PMZA 2IUZA 5CSYA 2PBOA 4D6DA 3VIFA 3SCRA 3WENA 3K1DA 3VSUA 1Q6CA 1Z32X 1TQWA 3UCQA 3UEQA 1XSIA 4MDPA 1HWWA 3GXNA 3LPFA 3A21A 3L4TA 2XG9A 3AXXA 5M03A 1B9ZA 1OBAA 2DEPA 3VM7A 2X2HA 4RE4A 1HJUA 3N04A 4LQ1A 5IFTA 1PBGA 2B31A 3AI0A 3B9AA 3CHEA 5KZ6A 4GQQA 4UQCA 1HIZA 1UD6A 1LL7A 2OW7A 3D4YA 2F2HA 1W1TA 3AYSA 4WSKA 2WMGA 2E8ZA 2VT0A 3MSDA 4BS0A 2XYLA 1E3XA 2OYMA 3A4XA 1W9XA 1JXKA 4KRUA 3TONA 2XHYA 2ZX7A 1Q6EA 4MB1A 1OB0A 5HXMA 2XUCA 1CXLA 4NSBA 1L8NA 1ZBWA 2E9BA 2Y8KA 4FLQA 2YDRA 3GXTA 4PYSA 1WDRA 3GXMA 1IZKA 1GUVA 1UZ4A 3SCVA 4AIOA 3B9DA 2FH8A 1UWRA 2DT0A 4UNIA 2VRQA 1CLXA 1E5JA 1P6WA 6CGTA 1XC6A 2AAAA 3BUDA 3EJRA 3CZEA 4D6CA 2J7DA 1E1EA 3AHYA 1V08A 3GYCA 5I5RA 4W8BA 2XFFA 4WIWA 2A3CA 1PX3A 3WH8A 3ZSSA 3CZJA 2XGIA 2CXGA 5LYRA 1XD1A 1H49A 5BRQA 1NP0A 3GBEA 2DDXA 2ZUVA 1UYQA 4AY1A 3BLBA 1C8QA 2VX6A 1E6XM 3PZNA 2WBKA 3LMYA 1MQPA 2D3NA 3PZ9A 5E9AA 3IJ7A 3T2QA 4GQRA 2XN2A 1VB9A 3NDZA 1E6RA 3ZJ8A 3WQWA 1I1WA 4AZ6A 1JL8A 1Q4NX 1DEDA 3D5HA 2XVNA 3FNDA 3RJXA 1HJXA 1TQVA 1QNPA 2A3EA 2BXYA 1XHGA 5A1AA 2Q8XA 3EDFA 4ATDA 3HMCA 1TR1A 1UH3A 2G41A 1C7TA 1X6NA 2ZWYA 4KH2A 1JZ3A 4AIEA 3L2MA 3D50A 1WDPA 3PZIA 4U5IA 3CPUA 1UKTA 2J8GA 4W8LA 3W37A 5HNNA 4HMDA 1AQ0A 3L2LA 2FHCA 2WVUA 4CCDA 3CUGA 3DYPA 3WY4A 2WCGA 2VZTA 3UG4A 5E6ZA 3ARTA 1E71M 4PTXA 4AEEA 1UR4A 1QI3A 1E4NA 3AZSA 3IJ8A 1QNOA 3DECA 3VO0A 9CGTA 3AHZA 3N9KA 4DO6A 1CBGA 2VR4A 4NI3A 4A3YA 1GORA 3PTKA 2XVGA 1O6IA 1R87A 3L4XA 3KWXA 2CKRA 2EBNA 2V3EA 2WWCA 4DM2A 3N11A 2E9LA 3PZOA 2XWEA 1XSKA 4MB5A 2CHOA 2ZXDA 4MJ2A 2X2YA 4AISA 3I3BA 3AHXA 2Y5EA 3GNOA 4PCTA 4MAVA 3AISA 3NYDA 2O9TA 4D6JA 1E0XA 3KL3A 3SCWA 4GPNA 4V28A 1JI2A 1L0PA 3O2LA 4AIUA 1UR2A 3LXBA 1W3KA 3OB8A 3BAJA 3CZSA 3AIUA 2CBIA 3CH9A 4NXKA 4HMEA 2VJXA 5JUVA 2CERA 2ESCA 1CNVA 2AOSA 3ARQA 1LG2A 1HJVA 4IM4A 3GXDA 3H55A 1UZ1A 2BHZA 5I78A 3VIPA 5ABHA 4M8UA 3OGRA 3W25A 4PRWA 2YBTA 1J11A 2D24A 3F5LA 4WKFA 1HL9A 4AZBA 3T0BA 2QHAA 3F5KA 4UOZA 3WY1A 1FH8A 3U7BA 1W32A 3DHUA 5AYBA 1W9UA 1KQZA 1BG4A 4W7WA 3QOKA 3OBAA 5I3DA 1XCWA 3B8SA 3BUQA 4MDOA 4GI8A 1UR1A 4P7OA 3BUBA 1HKMA 1RP8A 3K4AA 1UQYA 3GM8A 4JHZA 5CJ5A 3WQ5A 4JKMA 1MFVA 1V0NA 2GDUA 4LPCA 4E2OA 3UG3A 3VD9A 1AMYA 4PEEA 3ARPA 3HG5A 3W24A 1XH1A 1V03A 2OSWA 5D9PA 3WD4A 2J7GA 1YHTA 2D0FA 1PPIA 3VD5A 1HKJA 4CCCA 2WZEA 3UETA 2ZUWA 4AXNA 2F7RA 3GH4A 3CMJA 3I3DA 3DDFA 4D6HA 1H09A 1UWSA 5A6MA 5ABGA 2WXDM 3NSXA 1M53A 1V3KA 2ZX8A 3N17A 3BAYA 2HISA 5IHSA 3AIWA 5CGMA 3WF4A 1KTBA 4YHGA 3APGA 3SUTA 2YJQA 4F8XA 1WO2A 3GDBA 5GNYA 1H1NA 4OUEA 4EE9A 5A6BA 5CPTA 1UD5A 2EAEA 2OSXA 3HJEA 4W7UA 1LL4A 2VRJA 2W92A 2E8YA 3DC0A 1XGZA 5E1QA 1AVAA 5E09A 1UKOA 2JALA 3N15A 4AZ7A 2X09A 4GI9A 2XWDA 2OSYA 1QHPA 2CITA 2VO5A 1UASA 4DUWA 4J3WA 1W3JA 2VX7A 3D4ZA 2GFTA 2JIEA 1PS3A 5JBDA 1VFFA 4KWUA 1PE31 3VDAA 1EOKA 2X05A 1JGIA 3N18A 4HU0A 3AROA 1CDGA 1EHAA 3PZQA 1WZAA 4UQ9A 1NWSA 4URIA 2CPUA 1CENA 5AC5A 2YLAA 1W2PA 2JFEX 1HVXA 3FHQA 1F4AA 2CKSA 2V38A 3SURA 3AMGA 3ARUA 5FKYA 3OA5A 1KBBA 2W63A 2Y8VA 1J0KA 4UR9A 3VIKA 4EK7A 3NCOA 4B15A 2GUYA 1C92A 1I75A 1E5NA 1MQQA 3OIHA 3VSVA 4YHEA 3HN3A 4WJXA 1QHOA 5I2UA 5C70A 4BZYA 1SYTA 2OWCA 1E6ZA 1UR8A 2G3JA 3SIMA 3GTNA 1PZ2A 4GZJA 3VX0A 3VOCA 5BYWA 4AD5A 3VDBA 3DHPA 5EBAA 1AQHA 1CYGA 2V5DA 3VM5A 5KEZA 5A8NA 5IXEA 2WHKA 1D7FA 1PIFA 2IGTA 1ZL1A 2CIPA 5BXTA 4B16A 3A47A 4GZIA 4ACYA 2NSXA 5BXSA 1H41A 5A2BA 3QR3A 1W9VA 1JZ5A 1GQLA 4M56A 2W91A 5E0CA 2VCAA 2C8NA 4ZXOA 4TUFA 3WUGA 2G3IA 3D52A 1E4IA 3ALGA 5C8BB 1J0IA 3EMQA 2UY5A 1OD8A 3G6LA 2GJRA 7CGTA 1PX4A 5GNZA 4W85A 1B30A 3U5UA 3MV11 2DIJA 3EJTA 2X1IA 3WD3A 1UKSA 3DX3A 3WH9A 2WMKA 4K68A 4W88A 1EA9C 1JZ7A 2UY2A 3CO4A 4FK9A 4S3JA 3ZJ6A 2FHBA 5I23A 1SFSA 3ARXA 1GPFA 1ITCA 1R8LA 2UWFA 4IPLA 3LXAA 2VRKA 1CXKA 1XD0A 1CWYA 4ZE4A 1HKKA 4FNTA 3EJPA 3DYOA 2G3MA 4B3KA 3KLKA 5I6SA 1E43A 2PWHA 1FA2A 8CGTA 2D0HA 1VBUA 1GVYA 1VF8A 2X2IA 4BQ3A 3PZUA 3VNZA 3W28A 3W26A 1JZ2A 4XB3A 2ZICA 4TVCA 1WDQA 2EADA 3IK2A 4JIEA 3RILA 4F66A
chains in the Genus database with same CATH superfamily
1X4ZA 5CJXC 3EX3A 3BAEH 4QTIH 3FFSA 4ZX6A 3HE6D 3C60A 5D9OA 4NT6A 2GBUA 5CCZA 4OF8A 4I4WB 3EJYC 1P6CA 5IQMA 2DWEB 4ZOAA 4CSZA 4XZWA 7A3HA 3WTUA 1S3HA 1EYWA 4JHUA 5MHSD 2DQXA 1IR2A 3BE1H 1IM9A 1FJ1B 5ABAA 3R7QA 3EJUA 1A65A 2X4QB 4JDZB 1EO5A 1NDYA 3C2RA 2Z0IA 5FV2A 3CIQA 4KJYB 3G6DL 4N9OB 1AH3A 5CLXA 4TNVK 2P47B 2Z0UA 5G5DA 2JKAA 4Z17A 4Y8EA 4D8ZA 1E9LA 4QLJA 1XGUA 3MHZA 4YYFA 4NOFA 4JG5A 2OB3A 3WQCA 2W9LA 5AYUH 4N6RA 1DQVA 3IKKA 3OGCB 3FB8B 1PTGA 2IMMA 4UT6H 5TDOB 1ONEA 5CZJA 5AG9A 1TZGL 3ILPA 5CZXC 1GIGH 1SJEB 4P9HC 4ZMVA 3U1SH 4F2MB 1CMOA 1BFVH 3QDGA 3FONA 1KLYA 4HX1B 2PWFA 1AZ1A 3RCNA 1NWTA 3W57A 2BW5A 3RWHB 4FOUA 3H3PH 1QQDB 1TPB1 3F7JA 2YD5A 3IMTA 2WB5A 2DLFH 3JZUA 3H2FA 2FAUA 3LDBB 4HJSA 4U3CA 4GMEA 5ABFB 1QUNB 4P2OC 2WZ5A 1VFUA 5HDQH 3P1VA 4IHBA 3TCXA 1QFHA 1A2YB 2XZ9A 1W16A 3CK0H 4UTHA 1OAZL 4M51A 2FJHB 2QVTA 1AKJA 1JF5A 3VXMD 2IBZX 4NZ4A 5L4JA 4GW4B 3IDYB 3GC5A 4YHOH 5DXXA 1AIFA 1ZHKB 2YK1L 1WKFA 3P74A 3DDGA 4A55A 2JB6B 4BY3A 1MNZA 1A5NC 5J9PA 1KXHA 1SJAA 3PHQB 1S2VA 5E6IA 2JIXA 4QLRA 1NARA 3SBQA 1QBBA 1WEJH 1YYMH 2Y7DA 3GSQB 1L5GA 4XRCA 3STBA 3KX6A 1VJZA 2QVMA 3TQVA 4WI2A 3QQ1A 3FJ4A 3ZYIA 3LIZA 43CAB 3MSPA 2X0VA 2R1XA 1L6WA 4F57L 5CFHA 1FOBA 3CX5J 1S9XA 1TVPA 5ADOH 1NJ9B 3FU0A 1NF0A 4MG4A 1XF5B 3IV3A 2VEPA 2JJWA 2FMNA 2R4SL 4LKCB 3FT3A 4Z7VA 1CGXA 4HKJB 5FYKE 4H04A 1KJ2B 1GVOA 4E9LA 1SJMA 4Y16B 5AW8B 3NOEA 1JNNL 4QTHB 2V7HB 3MRKB 2X42A 1TV5A 2EP6A 3BP7A 4WGHA 2MHAB 4DUOA 5I6PA 4YDJB 4X5XB 1P6BA 1T7ZA 1IEVA 4F1SA 4MS6A 3OM3B 1HYSC 1T5WB 3PLYA 1EEQA 5DZVA 35C8L 4NQDD 4FIRA 1W1YA 5C0DB 5BUPA 1UG9A 4U1JB 3O4LA 1N2VA 2G2PA 4LUIA 3QIUA 3RO8A 2VH5L 1AXSB 3S3DB 4UTTA 2E7FA 4I8YA 4LGRB 1M5WA 5DJDB 2AQ1A 1JV2B 3BUPA 3QAZC 4AGMA 2VJ0A 2ISFA 1RY8A 4PJCA 1SBBA 3O0RL 1R5IB 3MR9A 4UYQA 4HA4A 4M4RB 2WIIA 5C0CD 4NAEA 2VZOA 5FUOL 2D0GA 5GISL 4H1LB 3CZLA 5C7VA 1PNDA 4U2YA 5EF1A 3QV8A 3HQ1A 3ILDA 3EYPA 3PP4L 2ZIDA 4LNRB 1GQNA 3AFLA 4LT9A 4MIMA 1W3LA 4JFDD 4YYCA 3IGUA 3KW7A 1D3GA 1JSYA 3BAXA 1LG1A 2H1LM 2PR4H 1B3ZA 4R7VA 3CSYB 3OXSB 3TM6A 4MD0A 1B0RA 3ELAT 3CEUA 4AUUA 3O05A 3FO9A 4PV8A 3MNZA 5I8OL 1JPDX 4DJDA 4KF1A 4H2AA 3COOA 2F0CA 1MF2L 1TJPA 1FHNA 3VAEA 5DMYA 3ITGA 3UTPD 3O3EB 2AFNA 1VEPA 4P3DA 2YR1A 2O93L 3M9YA 3Q6FB 1KXTA 4WO0A 1SQ2N 2FEJA 3C6CA 4HNCA 4CVWA 3GSNL 2WNXA 1R3HA 2C1PA 3SZ6A 2HK1A 3UTTD 1F11A 3T77B 1DANU 1YTKA 4JIPA 1C8XA 4KNQA 1M42A 3U2ZA 1WBZB 3DX6A 4Y2DB 1HX0A 3MMDA 3DENA 2FL5B 2KPWA 3SDYL 2BOBB 2P8MB 3TH2T 4XBMA 1IE4A 4KKLD 4AQEA 1R3SA 1YNQA 4ZRGA 2FLRT 4FXRA 3K8MA 4YN5A 4IMAA 5C0IB 3WE6A 4GX8A 1T0PB 5B7FA 4LSQL 5ITBH 5DN1A 3MNMA 3GDKA 2JIWA 5JXEA 2KX9A 1JGUH 4GBUA 2Y7MA 3LM3A 3ZLQC 1BQGA 1VYPX 4A2LA 2GI7A 3KTSA 2X8RA 4BHYA 3IDMB 1T96A 4EN2A 3QXVA 1VBGA 1I7TB 4JANA 5IMMB 2XIIA 5TK2A 1EEYB 5IHUH 2VQ1A 4KO9A 2YFNA 2R4RL 3OV6A 2WO2B 5I18L 3IJHB 4ODUB 4NO2A 2DMGA 1U6AH 1HKWA 3TJHD 1T22B 4OZHE 1C12A 2ICWA 4HETA 3SPVA 2W80C 2C3ZA 3IFNH 1U0QA 2D22A 1HL8A 1RMFH 3HI6L 3ATDA 2Y85A 4CQBA 1M3IA 3CDZB 2E28A 3O9WA 4FQ1H 3Q5YA 4FFYL 3WXWL 2B9AA 1UT1A 3EJSA 3IFPB 5KANG 4LCWA 1NFGA 3LU2A 1KRMA 4OT7A 5F1IB 1I3UA 5IVXE 1XYFA 1L0QA 2YMXL 2X0HA 5T1KD 1UOLA 2PDGA 3TXVA 4FEZA 5FA4B 1RJCA 1RJLB 3G1AA 4B3VA 1EUAA 1KYDA 4IFRA 3CBKB 1LCOA 3MXVH 2IFGA 5EEWA 1CD1A 3HLAA 3N85L 2I60H 4CC1A 3ZTNL 3I75A 2EVIA 4HJFA 2IAMC 4PD4J 2FSEA 3ABMB 1R3WA 3UYIA 4WW1A 1KPUA 2M2DA 4DESA 4GQGA 3GXUB 1JF1A 3TH6A 4OFDA 3ZMRA 5DK2A 3UEZA 3DU0A 4I8DA 3MLYH 2W94A 5CUSL 1PJWA 2QV5A 1IGYA 2FT6A 1E9YB 1ENUA 5LIYX 5FYKL 3CBRA 1NGQL 5BOPA 4ZK8A 3IJIA 3DHDA 3L54A 4QISA 4TNEA 1TSIA 1P1ZB 3BH9A 4XMKL 3QRLA 4NZCA 3UA3A 4WTZA 2ITDB 4K39A 3U9UA 4P5TA 4E5TA 1NDTA 3L4ZA 4EBQH 4H1LG 2E86A 1UWGL 3QUYB 3HB9A 4M3JA 4KK9D 5F3FA 5I06A 4CNIB 1Q9OB 3OAYH 2GVLA 1BX2B 3IBEA 3EDKA 1IIHA 1E2WA 3QEQA 4R7DB 4YDIH 1QHZA 3B9KD 4C7FA 3DVGA 1C7SA 5KVFE 3HQPA 3QJRB 4IBZA 3V0SA 3B5TA 2MPAL 4ZA0A 5AB2A 3A9IA 1SW0A 2NQZA 4AEIH 4OBTA 1N5YH 3LPWA 3VNJA 4TV3A 4E41E 3LIUA 5I19L 4TF4A 4AD0A 2C7UB 5GS2D 4F7PB 4N86A 5D8WA 2FX9L 3RPBA 1XLBA 4ADGA 3WNJA 4G7YH 2ZP8A 5D04C 1ZCRA 5DFVD 4IU2B 1G0CA 3RTQC 3SDOA 1EF3A 1JPSL 1IZJA 2RQ8A 1UEYA 4W9JC 3DN5A 1IKFH 1TA3A 1AH0A 3HZVB 5EBGA 3ME3A 3CHSA 1VFOA 4AEHH 4P46B 5EIVA 4PRAB 4D0BA 3GMRB 1BQLL 4AQAA 5CPSA 2ZKXA 3DSFH 5A2JH 1HHIB 4RIRA 4PB5A 4J8RB 4JFYA 1LOLA 2ENQA 1NWRA 1QW9A 4IBYA 4LCCB 3MBXL 3PHOB 3K46A 4NUQA 3OLEA 1EP3A 1SF3A 2B77A 3BLOA 3TK7A 3GO2A 4UT7H 3C6LC 2A6DA 3PUCA 1ZT1A 4GMTH 4KQ3H 5KBKA 3VFWB 4NAFB 4HKZA 4O10A 4ODTL 3RU6A 4Z2GA 3L5AA 4GWEA 3G5VB 1GYMA 2CKBA 3E80A 3JYBA 2WWKT 1JAKA 4F9DA 1PHWA 4KPHH 2H1PH 4TNVF 1H2JA 1CFVL 2QCHA 2F15A 1W5OA 2Q3XA 1V7AA 4DOHB 4OKVA 4X2RA 2FX8L 1A7PL 2Q6ZA 2E6JA 1TWWA 4GHRA 5CQ1A 1M03A 2H9AB 3RB5A 1MH5B 2P5WE 5JW3H 1MSSA 1GOOA 1PQZB 3ARBD 3Q9QA 4JKLA 4R7NB 3SY1A 1D5RA 4ZG1A 2MFNA 2BY3A 2B2XL 1R6VA 3ZVHB 1KTNA 3TA9A 1IJNA 2YA1A 2XGZA 3QGAC 2YKKA 1WUNT 3DGGA 3PNWA 1WFJA 3QBUA 3GXFA 4ATTA 1JPTL 1B31A 2ZCZA 1FCBA 2BDQA 1IGIL 3FUHA 1MHCA 3CSBA 1X96A 2R1WB 2V8ZA 1FPTH 1TTUA 1HUVA 4EI5B 1KG0B 4QGCA 4NOBA 3BYYA 3VOFA 3OKEA 4LRNH 3IJEB 2FZNA 4LARH 4BWLA 3BLIA 1NDGB 1U8JA 2PDIA 1JK9A 4X4ME 5IVZA 4YWGL 3MW7A 2WBJB 3BKCH 2BP8B 2E9WA 4E5XA 5BMXA 1NEPA 3P60A 1ZV9A 4CC4C 1PG7L 2K7QA 3VXPB 4LSDA 4FA6A 2CO1A 1MQ8A 4LKXB 4J3OD 3ZHNA 3ZT5A 1LF1A 1UA3A 2ZOKB 2V33A 3I50L 1DHPA 2YCEA 4AG4L 5E99H 4HEMA 5D1ZB 4ORGB 1JMZA 3WKML 1TYEB 3K4DA 4B5SA 1A80A 1LO0H 3FW6A 4KTGA 5EF0A 3NQBA 3MCMA 2UY6B 5DQ9B 2ACUA 3RX5A 2J9YA 1HOEA 2ZCKL 4UMCA 3TO4A 4B5XA 3EGSB 4D6DA 3K5XA 3ECWA 3VSUA 1Z32X 3UCQA 5LN8A 3K2IA 4EN3C 1YBQA 3AXXA 4HWUA 3W2DH 4RGNB 3IGHX 1QEWA 2VDLL 4LQ1A 4GQQA 3K2KA 4Q9RH 4HOMA 1D5BA 3A4XA 4G7QB 4BSVB 5ID0A 4I7UA 4FXGB 3CQ0A 1DSWA 4NO0B 1SN0A 3KYKL 2YZ1A 3L16A 3OAUH 1TQXA 2NTFA 4Z78A 6CGTA 3BUDA 1WBYA 4LB8A 4F24A 4CBZA 1EZVY 1PX3A 3ZLGA 3BEVA 4O51B 3S6CA 3BGGA 3Q37A 3LQGA 4AY1A 3BLBA 2V9RA 3N29A 3LMYA 2Y36L 4IRSC 4ISVB 1I82A 3ZYJA 2K70A 3UVIA 4Y19D 2CDFA 5F7HA 1Q4NX 2Y61A 4APQC 2XVNA 3SJVA 4XKYB 3EH1A 3I6LD 3ZQWA 1XQ4A 1L8PA 2G41A 5KVFL 3IGAB 4BK4A 2VDOH 1K85A 4XXDB 3S9YA 1X5AA 1ZLVK 2WXKA 5FM8A 1AO7D 3DURA 2O56A 3I6SA 3IJ8A 4KQNA 2VR4A 1T2XA 1EWDA 2Y25A 3QR0A 1UVQB 5DJYA 2VMCA 2OMVB 5ACZB 3KCPB 2HJKB 1CDBA 1UROA 4MSWB 4U1MA 1DSYA 4GQZA 3T4YB 4H20L 3QUMB 2HS6A 1KPRA 2A77L 3U30B 3MLVL 4P2YA 5I6XB 3RL1A 3O2LA 5JHDA 3DUHA 3VZZA 2Y7EA 3CZSA 3FH7A 4GLRH 5GSRB 3H0TA 1WAPA 1GS6X 1HJVA 1VGEL 4L4TB 4I6VA 5JR1L 5EIQA 3F5LA 5GJNA 3HPZA 5EZPA 3UWQA 5D1XC 5I03A 1LOQA 3T0BA 2VLLA 4ZBCA 1I9RH 3DV4B 4MTMA 3FCUB 2BZNA 4EDWL 3QXAA 4G1NA 1TPH1 1NUDA 5D5MF 1MWAH 4PVBA 2XQYA 3KXFD 2P80A 5DURD 3GSVA 1F58H 2HJLB 1AMYA 1FCUA 5HYQB 4O12A 1CG9B 1TV7A 3JV6A 5CBAB 4GUQA 1RIHH 2HJFA 3L95A 1AE6H 4GJ1A 7ENLA 2NW3A 2GTZB 2VXVL 3IDXL 2HWGA 1TFPA 2VC6A 4HWEH 3S34L 3HUJF 5IOPB 4WI8A 2G5RA 5A16A 2V5LA 4OUEA 1H1ZA 4ZS7H 5HMDA 2OMWB 5AB3A 3HJEA 3UJTH 3QFDA 1EO8H 1XSOA 3S3PA 5CAKA 1OB1A 1XDMA 4ZL1A 1FWNA 4OGXH 1W15A 1HEHC 2VX7A 4EZJA 3CN1A 1WWWX 4JLRA 1QFWL 3W6YA 5DUJA 1KFJA 1OK0A 3USBA 4IMKC 4ZD3L 1GYWA 4OFCA 5MEND 2OX5A 1BZ7A 3VRJB 4YIQB 2G30A 3FSVA 1WUZA 5TDNA 1U8NB 2CUHA 2I7OA 3DO4A 1KEGL 1DVFA 3FDWA 1YIXA 3HFFA 4QGYA 5A2FA 4B90A 1XR2A 1DQWA 3IKCA 2MH4A 3VOCA 3TVMC 4MS8C 4HU4A 4GRLB 5EBAA 3VI3E 4ZAKB 1KM2A 4QNPF 3W7QA 3CHPA 2B7DT 2YGOA 4ZPVA 1MLBA 3HE6C 1E0TA 1IXNA 4TVPE 4GZIA 3FFCD 2AQQA 2AGJH 1FL5A 4Q58C 2VUOA 4M9OA 1FVDB 4HUVB 2W91A 3OKNA 2CUIA 1UTDA 4LHUA 1A5BA 1ZRUA 1ZIBA 4IMLA 5C8BB 1Z9OA 3EMQA 4FTVD 4ALDA 1H7RA 3R8QA 1EJOH 3UJIL 2HEJA 4AQ8A 4DP6X 1KFCA 3ZKXB 1F3JB 3FH5A 3MV9A 1SFSA 5DUBB 5C7HA 2K9FB 2DOCA 1T89C 3DH7A 3ZDYF 1HKKA 4G3YH 4TX9A 3B40A 3IDGB 3H2NA 3V4VA 5TE4L 2VEMA 5D4QA 4TVCA 2CU0A 1WFNA 5K33A 3SCMA 1LZOA 3RILA 4O4VA 1E4WL 1YC7A 3MJYA 4MYWB 3QHMA 2MEJB 1OIFA 2FGBA 2BIHA 3W0WE 5CD3B 4RX4A 3IFOB 1MFBL 4JHAH 3QZOA 4NM4L 2HUEA 3B9VA 1G94A 2HBVA 3QJXA 3EOTL 3RF9A 3MUHL 3D48R 2X6CA 3CXDL 3LPOA 2GBTA 3QPQD 2CHNA 4JL1A 2FIKA 3IJ9A 5J13C 4JNZA 3G3MA 1KBGL 1XKYA 1HXJA 1HZHH 1IKNA 4RE3A 2VDPL 1Q63A 5B8CA 4RAHA 4N0YH 5I76B 3IMVA 5FGSA 4QD2E 1T0MB 3KBSA 1OD0A 3M0HA 2VERA 4N2LA 3RDKA 1PTZA 3R43A 4QDWA 3FRPG 3USZA 1DFBL 5D7JA 3MJ9A 1QR7A 5E2VL 4BSWB 4E8CA 3V4BA 4JTKA 3OMZA 2PTUA 2E4TA 3QDGD 4Z9KB 4YS1A 1TEFA 4DH2A 2ZUNA 3QHFH 3QYSA 4UDTB 1RFDL 5C0ND 3LS4L 5HVHC 4YSUA 2MKWA 3LKOA 4L9LA 3WJLC 1E6SM 3S5YA 5FF6B 1WIUA 3OTRA 1A5KC 3ZJ7A 3B9EA 2Q7NA 3B2XA 2WOYA 5DJ8B 4WUKL 1WQVT 1RY0A 1R5WB 4IS6A 3FJTA 3GS0A 5JQHC 4L6DA 3IGFA 2VXUH 3BSZL 1Z5HA 1P7BA 3T71A 4U0RB 3GMLA 4YXKL 1FSKB 2N0KA 1KB5L 4XMTA 4PLNC 4NP9A 5KVEH 1A7RL 4KCUA 3RCMA 1HGYA 1P0BA 5D7LA 4LLQB 2YAHA 1A5MC 2HTKD 1RPUA 4XO9A 3HS0A 5HATA 2QHRL 3GJFK 4C56A 5D70L 1VHNA 4Y9EA 4YEFA 2OP4H 2CBVA 1RUQL 3E74A 1YN7A 1NCWL 5E2WH 3RIFF 1NEZA 5JZ7D 1CICD 4EMZA 3ZJKA 4GUPA 4O58H 3GS6A 1F18A 1C5DB 1NCCH 3FYEB 3O3DB 4ZQRA 1SUXA 3A67L 3OPZL 1MI5B 5F7AA 3P9MA 5DS8B 2J8UA 2IXQA 3I6RA 3QA3A 1FN4B 4PWJA 1GMIA 3L9RA 1UJQA 2PNDA 2RDUA 2ZD0A 5JORA 3QQNA 1GZJA 3BPLC 2EH7H 4Q8PA 2QJJA 1HAWA 3STLA 5BRPA 5IEKA 4QXIA 2UXVA 1JHLL 4KNSA 2JE8A 3MMEA 1QNQA 1LLZA 3NTCH 2FDMA 3KGSA 3RWDB 5KS9E 1MFAH 5F3HB 2HVMA 1J05B 2PB1A 3CU7A 3NFPB 1YECH 5T3ZD 1GPWA 4NP4L 3GUGA 4LNVA 2GJ6B 3FCPA 1K8CA 3S42A 1NPUA 5DD3H 2X89A 5BW7C 5BUAA 4EOWL 1IYXA 4PV9A 2PPDA 2NVAA 5LGYA 4DPRA 2PC8A 1E7UA 4D9RD 3STFA 3KDMA 4JDYA 1YUHB 4JTEA 4C57C 1Q4WA 1L6ZA 4P57A 2NT1A 1AJ0A 1XCXA 3TC6A 3ZDYB 4UF7C 5DT7A 3QIUD 2WK2A 1RERA 4PJGA 2QGHA 5DD5L 3ROOB 3IU4H 3AUWB 4ETYA 1DLFH 3US0A 2VR9A 1KYUA 1I60A 3LCFA 3NCYS 4PMJA 1C5CH 3AS1A 1TF4A 3X1EA 4GVIA 3C6SA 4YHYC 4HV8A 1CLZH 3C5ZA 1Q6FA 3KS5A 2Y7GA 4X4ZA 5SWZA 3VIJA 1TCMA 4G6AD 5I1GL 3HC4L 1MRCH 4NN5B 1H3VA 4NLHA 1T0NB 3CIWA 2D7QA 4M7LT 3MSGA 3N13A 2BS8A 1JV5B 2WXLA 4KKLC 1Q0YH 1K6QL 2RTTA 2YOCA 4DJDD 2AQOA 4GS7C 3MUZ1 4MNQA 1KKOA 2J73A 3UQNA 4WTXA 4R9HA 1YEJL 3NSYA 2IH1A 2PMZA 1H0DA 4H9YA 2ZF9A 2BOFX 1PSKL 2APSA 1KIRA 4HIEA 4WD0A 5IFAL 1NC2D 4L2YA 4ZOBA 2UZYB 4R4FL 4PWIA 5DYOB 3TT3H 3I6KB 3VWKB 3W7DA 1VAHA 4LJ3A 5AC6A 5EEUA 1R3KA 3H42L 4PLJD 1BYBA 3MRIB 5D2VA 5DO8A 3SCTA 3K8KA 3WEOA 5DFAA 3FPXA 3CXOA 3KJ6L 5KSVA 5C0BB 5D4IA 3TJHC 5IUSA 3BPOC 1B3YA 2CZ5A 1WS7A 2J4WH 3W1NA 5DA4A 3WFCH 1CTOA 3SQLA 4DBSA 4NCDA 3SGGA 4PVLA 4PP2A 1LO2L 4JEQA 1MW1A 3V0VB 3GH7A 3KRBA 4S1SH 3M17B 4LLVA 4QY8B 1G4EA 2PGEA 3SCUA 5D7KE 1KCVH 1W0YT 2ETWA 3VVGA 5K39B 3WJMA 1U91A 4NO3B 3C9NB 1I8KA 1PZ5B 1QSFA 4IIEA 3MO7A 3V5HA 4PH8A 5HHNB 1OGPA 3DROA 4B4FA 1GAFL 3Q48A 4XOEA 5I5JA 1WVZA 1P1XA 4NUGH 3N34A 4Q8BA 1WWCA 2DQHL 2NX5A 2DMKA 5IP4A 2XM2A 2BSLA 2F6KA 3LEYH 1I6NA 1IEWA 1FGNL 5D9SA 4PUBL 2AHIA 2P44B 1WBXA 2IV8A 5GRYA 2QDHA 5GGSB 1DL7L 3NQDA 1QR1B 4DUVA 1T3FB 4MJ6B 5HYJB 3SGZA 4NRXA 4YLWA 1ELSA 1KJVB 5FOBB 3E2RA 5D6CA 5C9JA 1P4LB 1UZGA 3B9NA 1UUOA 3U6XA 1W0WA 2V68A 3BT2H 43C9A 2B15A 3LM7A 3EHBD 5IHZA 1K8DB 3KYOB 5F7DA 2BGNE 5KSBA 3LMJL 4N8VA 1AACA 4KK9C 3HPJB 3TURA 2ZWSA 5KINA 2QZ5A 4XZUA 5MKGA 4I9WE 2GVYA 1ET7A 1INQA 1ZALA 3PR2A 2FATH 1TPFA 1TNNA 2DTSA 1URIA 3GHEL 3PHSA 5DC9B 4PMRA 1HKVA 3P30L 3GJEB 4MKMA 3B9KC 4AY7A 3I6TA 4DO4A 3DX0A 5GGTL 5AW9B 3N6QA 1UEMA 5EO9B 2RACA 1UXLA 2X1OA 1EUUA 4PJFA 3TXAA 3WO3B 5AC7A 5EO1B 1P6FA 1DWAM 4M5PA 3VINA 1A49A 4DGYH 1DVTA 3Q3GB 2LTQB 2KT6A 5EBWA 1V51A 4GZEA 4P5TD 1RZKC 1X5XA 2XWBA 4UT9L 4JZNB 4N24A 4QQUA 4FA8A 2A74C 1KCKA 1Y0LA 2YGPA 3HRZB 3L7EB 4TO8A 3QUXA 4GXMA 2FJSA 4Q4EA 5MEQB 1C8YA 3S0CA 4FQHA 1OVZA 3LNEA 4P7RA 1BQHA 4FQJL 3LZFL 2FQFA 5K9QG 4LASL 1RZGA 5E8OA 5GS1A 3QEQD 1BXNA 2FFCA 1HJBC 4F27A 2BXZA 3ITCA 4ELME 4TLUA 4JFVA 2DSWA 4UQEA 1LXMA 4JNXA 5CEWA 4DFHA 2CW6A 4KFNA 2DFAA 4C1LA 2QBWA 5E2JA 1WDSA 3GFZA 2Z4QB 4P23A 1XGYL 1YEGL 4JCLA 4XBSA 1I31A 1YLBB 1CE6B 1DBBL 2B16A 3LVTA 3FQXA 2DYPA 1FAKT 3DPBB 1FNEA 2X87A 4GYKA 2P5EB 2VL5B 3M7SA 3A23A 4Y1AA 1LE5A 4G9FB 1QSEA 4MJIA 3WFBH 4CNTA 1XEUA 1YY8B 4HIQA 4F91B 3VU2A 2OPCA 2BWDA 3IWVA 4RSVA 3PHAA 5IIEA 4G8AC 1P7KA 4HXBH 3QC6X 3ARBC 5I0WA 3TROA 1FTXA 4DJFA 1ILSA 1UD2A 3DO3A 4CLMA 2HNEA 4WDIA 3BVUA 3GR4A 4J3TA 4PUEA 2WMIB 2NLJB 2GLKA 3PWNB 1DHKA 1LEGA 1ADQA 4J23A 1AGDB 5KJ4A 4B9PA 1JWUB 4GW1B 1F5WA 3HNTH 5HQMA 5HP5A 4RZBA 5F7MC 1LO5B 4OJFL 4HUMB 5LNVA 3HE7B 5AVNA 4DPCX 3C3UA 1KCUH 4G71B 4JO5A 2X40A 1TJ1A 3MUCA 2NRDA 4N2AA 1Z69A 3VXNA 2VW7A 4Y4FA 4HUUA 4OIIL 3ZGIA 4IBUA 1L9QA 4Z5RA 2VR6A 2PUZA 3ZLFA 3AQXA 4W86A 3QHNA 1RZIA 2XRAH 3KOWA 1A9EA 2BOCA 4FXTA 5TF1L 3FTGB 1KTDB 4B5WA 1O7DC 1UT2A 3MTRA 5DEFB 2W3ZA 3AAZB 4A7TA 1N82A 1HG3A 1YQVH 4IKIA 2QGEA 5EU9A 2R82A 4HJ1A 3QZWA 2PP1A 3UF9A 3X12B 4DWDA 1NF7A 1P0NA 5A40E 4H2HA 3UWZA 3MRPA 3LV3B 4J3OC 5L2JB 3OR7A 2VX5A 3GLEA 2UZXA 1DXIA 2ZUXA 3DBNA 4CW1A 3QDMA 4NYYA 3LH8A 1DLHB 4XN5A 5CSUA 4WSJA 1YDYA 4HLEA 1H5VA 4X5WA 5I77A 3BTNA 2D7OA 2VLKB 3EFOA 2JCWA 1UR9A 2PCYA 5D2LB 1ZLWH 5LNRA 1MCLA 2UZIL 5EDXA 3OKDA 4GKNB 5CEXA 5BV7C 5F96H 4PFEA 3UZJA 1EGJA 5FCUL 2ZZ3A 4IISA 4LP8A 7PAZA 4AZ5A 2IH3A 5AAWC 4MS8D 4BQ6A 3SCOA 3KPLB 2NXYB 3QRGH 4KXBA 4ONVA 3BVJA 1XBDA 4D1IA 3M46A 5FC9A 1J1PH 4H13C 1G7QA 2EDHA 4PMUA 2QSQA 1ZLUH 2XV6B 4WY7L 4FE9A 5MEOB 1WV7T 1SHMA 4KFOA 2PPAA 1ZA6B 3ZE0E 3CC5A 1CFQB 1XZWA 3K72B 4L1DA 2OMYB 2WZMA 3MCNA 5EOQL 4M81A 4A3RA 4PYHA 1N64L 2F7FA 1AY1H 5IWLA 3CQHA 1F2JA 3TN0A 3QXBA 1MW0A 3FV9A 4PJ9A 3E8UH 4EAMA 4PW3A 2F53E 3D39A 2CLVA 1TO4A 1JHKH 3NA4A 3QS2A 1RULL 1A4KA 4HT3A 2IVFC 3PAUA 1B4JH 2Y1ZA 5ISZA 4ETQA 2IF7A 3UZYA 4JG1H 4CVZA 1HL4A 1WCBA 4HH9A 5IY5B 4UU9B 1H8SA 3T0VA 1HIZA 2IDTA 2RIKA 2Y5JA 3TWAA 3TA3A 5ACLA 4E9VA 2WJZA 3MSDA 3GTVA 3K1KC 1M7DA 2KZ1B 2NVCA 1KFLA 2QFPA 1CBVH 1THAA 3R06A 4WI3A 3MJ6A 4GBXA 3RLHA 3HNSH 2JKTM 3T4AA 4Z7WE 3EA3A 4PWKA 4ZUTB 3DUUB 2KL6A 3FJLA 1LHZA 5FKPA 2QDGA 1OFQA 3NDZE 1YEIL 4JRXA 5BOJA 3QXUA 5LBVA 2PSNA 4Z42C 4JTJA 1E5UI 2HKAA 3SJVD 4YSAA 3CAQA 2WXQA 4G83A 4OGYL 2E76C 3EO9L 2A3EA 4DK5A 5A1AA 4L3CA 1IQWL 3B5HA 3VXOB 2M1KA 1AGEA 3HR5A 1U95B 2VLJB 2X4NB 4DJED 5DTFA 5LXEA 4JD4A 2YQGA 1FYTA 2YAMA 3D85B 5FECA 4HUXA 1NSJA 4OCSH 2GSGB 2EPHA 4NWTH 3SDCB 1WXYA 4WI0B 1HWHB 2Z31D 2QPDB 3AHZA 3G0UA 5CIPA 3VW3L 1R87A 3KWXA 2V3EA 2LV4A 5E2UH 3OJMB 5I1CL 4A7GF 1GG1A 3BDYL 2BVPB 2XWEA 3QFWA 1MIMH 2XWTA 3L3JA 2O26U 4B0MB 3CLFH 1TJ0A 2CBMA 4NZRL 3MO1A 4IPJA 6XIMA 1ME9A 1LJMA 3N41F 1L0PA 5TPWL 2OZNA 3UFIA 1DKWA 2FK9A 3WLWD 4NXKA 2VJXA 4JQXC 4F8OA 5JPMB 1GRWA 4OLWL 4K5OA 5I78A 4F2FA 3P2DA 5B1CA 3NFSH 1TFHA 5D6DA 5C0FA 4XNAA 4N2GA 1I9CB 1WT5C 2V5MA 3BUTA 4L3ED 3AW5A 4GUIA 3OYXA 2P80D 1LYQA 4PJIA 2JVUA 4IGBA 4R2GB 4JTQA 1UR1A 5C3LD 3FCTA 3QCUL 3DNKA 2XSXA 4YWSA 4F5CA 4JHZA 3HG1B 5KITA 2V2XB 3HG5A 4OTKA 4Q4QA 2J7GA 1NL0L 1PPIA 4HSNA 3CHQA 3LHYA 5AKQA 3CMJA 3GMQA 4D6HA 1H09A 3PP3K 4DZIA 2WXDM 2ZCGA 3N17A 4ANVA 5B3JE 3T0CA 3UZEC 2HISA 1XB6A 3NPSC 4KQ4H 4PI2A 4RRPM 3S88H 3ARDB 3IDJB 2CA4A 3T6ZA 3DERA 3G1DA 3W3OA 5IJVB 3C8FA 3MBFA 3CL6A 2AQ3A 2ZRYA 2ZOLB 5ESAA 4WU5B 1F6PA 4ELDA 3SBWA 4ES9A 2OLAA 3GJFB 1NBYB 1FBIH 1XFPA 3HHRB 3D4ZA 2JIEA 3PM6A 1WYIA 2OI9B 4KWUA 4XNYL 1EOKA 3NGFA 4NKIH 2J2ZB 2YARA 1QRQA 2MQCA 4B2DA 1G87A 3D09A 1DVFD 4ZMXA 3AMGA 3OA5A 1KV8A 4NQSA 3P0GB 1RVGA 4K3DL 1L9TA 4G6ML 3BIKB 1A8ZA 4Y1TA 5SX4H 2G3JA 1HGWA 4JVWA 5E8DH 4Y6GA 4NQVB 3C60C 5I66A 2WHKA 4NJHA 2CU9A 1XLAA 2CIPA 3PANA 1UXSA 1A5OC 2WQ8A 4QRRB 4FZIA 4C6PA 1MCRA 1TPC1 5E23A 4LBUA 1DBKL 4FJYA 4M56A 1SEQH 1CN4A 2F5AH 2XZAL 4OZGA 1X3DA 3GG1A 2GJRA 1NCBH 3PPSA 3U5UA 3QPQC 5DVNA 3MV9D 5JXAL 3I7RA 3KXQA 1UKSA 3CVBA 3T1WA 3CO4A 2EDWA 4S3JA 3B34A 4Q4MA 4MDJA 2LHAA 2BX5A 5L88L 3K81A 4OQ1A 4MCYA 2DD8H 1IXPA 1BMWA 1HU8A 4N8UA 4WO4A 5D96C 4YNGA 1T1XB 3VFOA 4MX7B 3C8NA 2EADA 3R6IA 5XIMA 2PLCA 2XACC 4A67A 3CWGA 4PWGA 2P0IA 3MGOA 3ZRFC 2GTQA 1TV2A 4RX4D 3CLWA 3TBYA 1IM3A 1Z3RA 4XAKD 1DJIA 4P2RB 3LVEA 1JK8B 4QHUA 2R69H 3PJTA 1XR9A 2QCLA 5CZVL 5E9XA 2HMCA 2ZKWA 2CIIA 3UTSE 3V2AR 2NPLX 4TUJB 3CBWA 2ZUUA 4EANA 4YZWA 5C0NC 1DBJL 3R0UA 4W93A 1MQKL 4J8QA 1WZMA 4WY0A 5FK9B 1KD0A 1E51A 5FOOA 3IPFA 3KPPB 1SGJA 4U1GB 4I85A 2C9VA 5DRXB 1MEWA 3Q43A 4AEFA 1QRNE 1WAEA 4FNUA 1CDUA 3BW9B 3UWYA 3T1GA 2O1AA 5CJQH 3GB7B 4IIQA 3HKZA 2EDBA 1MDRA 1R30A 3WNLA 5JHLA 4LO9A 2GEEA 4ZFFB 5L7XH 2JCCA 1O60A 5E4IA 3CN4A 3LH9A 1NAMH 3GZQA 1NQKA 4WDWA 3C5SA 4ZTYA 3HI5H 3AIRA 1MCOL 5I3IA 2NY2D 2HTKC 2F84A 1Z66A 3MKKA 2IPKB 3MC0A 3N41B 1D6EB 2B3IA 2DLIA 1RVKA 4NQCE 1KQYA 4PUWA 1PL9A 2Z7UA 1D9KB 4BRJA 3PN8A 4EPDC 5JZ7C 1FNSL 1CICC 3HIJA 3WFAA 4G8GB 4KEUA 3KPSA 4D9QD 3TPKA 5KANI 4PYGA 4EPKA 1RK0A 3GDLA 1BOGB 1J5IA 1HCFX 1SOQA 2VUNA 5CSZA 5K9JH 5D7SL 1R86A 2ITCB 2G37A 3LCWA 4QS6A 5FM4A 3ULUE 4ES4A 1H5BB 5E08H 4H0HB 4MAYA 4PCFA 5FFLA 4KKBD 1ZE3C 4F0SA 3O45B 4FOJA 3S96A 3V6ZA 3NCEB 4EI0A 2I5IA 4YVNA 3ABGA 3KBNA 4YDKH 4C56D 4XN4A 3V6OC 1ZJHA 2IGFL 1XR8A 1SJDA 3L5WB 4NVTA 3DBPA 1E56A 1HCZA 2E6PA 5HHVL 1GTNA 5DD0H 4IJTA 1M7IB 3F01A 4UNLA 3PDOB 4P49A 3UPMA 4HLZH 2CZFA 3VGEA 1OX4A 1MFCH 5BZXA 5FJRA 4FLRA 4DWSB 1OSPL 3OG3A 2O4QA 4NENA 4ZE5A 4MMZB 4TQTA 2VC5A 2VLMD 4FGMA 2B1OA 2WW5A 2VEIA 4O02A 3U6WA 2K45A 3G5YB 4N0UB 2OZ0A 5LGJA 4TQEL 2VDRH 2R2HB 4RZ6A 4V2BA 2YEVB 5T5FL 3LEVL 1J2BA 3VFNA 3QIUC 5A6TC 4ZSOA 1PZ3A 5I1KH 1A6VH 2ZDSA 4DLFA 4J3BA 5JA8B 1W9PA 3GC4A 4ZSUA 4XVJH 3AMCA 5BZDB 2JKPA 1OJXA 2ASHA 2A1WL 4M5ZL 1ACCA 4EEEA 2CESA 4WI9A 2BNQE 4GNJA 2GUOA 4G6AC 3OGVA 4ZOCA 1RJYA 2QPUA 3WIFA 1EO7A 1NMBL 2Z4TA 4LEOA 3R7RA 4ERAA 1J1OH 2DQJH 2X9WA 3MSYA 4Q14A 4OF3A 1SYVB 1NELA 5E00B 3VKCA 1PMYA 4PN6A 1ITUA 4PN2A 1B3JA 2BZ7A 1MCPL 1AD1A 4GA8A 3F4WA 5D2NA 3ERXA 3FU9A 4DJDC 1NTDA 4WLCA 1LP9F 3UTOA 3VXUE 3W73A 5DQJB 4PG2C 1RZPA 3MCKB 2DEXX 1I3GL 5SWZD 2BIQA 2BVWA 4CSSA 2IW0A 3GS4A 4M1RA 3FYOA 3CVCA 5DVLA 1IEAB 3P3BA 5SWSE 4Q6IC 1JGMA 4Z0BH 1RVFH 2XNAA 4F40A 3A6BH 3P0VL 2A3BA 2TAAA 4PMNA 1R33A 3ILQC 2GBAA 4P5MB 4PLJC 3RIFK 5E1GA 2J20A 2B7QA 5B80A 1G9NH 4KHTH 4JCMA 2TSYA 2DMHA 3P4MA 1N5AA 4MNQD 1NUNB 4HYWA 5DCBA 4XP6H 3DRQA 5DHDA 2Q1EA 1YJDL 4EJ1C 1LO3L 1XBXA 3MJ8A 3BDXA 2XWJB 1UWXH 1DWFM 3M86A 4PRTA 2ZSWB 5KZMA 1UXWA 1OABA 1B0IA 3KHQA 4HUKB 1XGQB 1P53A 3FT4B 2EILB 5TQLA 4GRMA 4MUPA 3QPXL 3VTMA 3WIIH 3GSRB 1VKXA 1CI3M 2OMXB 2X4SB 4H8WC 1MWOA 4PJAA 4S0HA 4OWGA 4I1NB 1N2RA 1BD2E 2XN9E 5FPIA 4IFKA 1WAWA 5DGQA 1ORSB 1W5QA 1W0MA 1OINA 1Q72L 1L7IH 3ZXAC 1T03H 3NCBB 3DX7A 4YXHL 3FT0A 5A8OA 1ZANL 1C91A 3E38A 4BFOA 2JELH 1SZGA 1F73A 1KR1A 1P0SE 1UATA 3MRDA 1GZQA 1VPYA 3QLLA 3ITOA 1UUMA 4BRVA 1YCSA 2BSEA 1D5ZA 2ZWKA 1J8VA 4IW4C 1OOWA 3MFGB 4LNYA 1RHCA 1BYPA 4RNRA 4JJ5A 3RGVB 4K3EH 4ODHL 3MUXA 3BUYB 3ABRA 2NXIA 4XO7A 3KGUA 1AR1D 4EWJA 4W89A 4AH2B 4NX0A 5MP6L 2WGNB 3EHBC 3W23A 12E8L 2DQIH 1Z3GH 3QYQA 3QIBA 1VKFA 4H25A 2WQXA 2OEJA 1ETZB 4PJHE 2AXFB 3ULUL 2NX5D 4H9UA 5HUOA 3TX9A 4MCZA 3NJIA 4GG8B 3GSOA 5EN2B 2FZ3A 4LYPA 5F9OL 2R91A 4AZCB 3HA1A 3UERA 1AG1O 4K23H 4PS8A 3T1FA 4BF7A 1Q1JL 3KPOB 4KW2A 3A9BA 4QOKB 4C7DA 2MANA 3BSGA 1HI6A 1P2CA 2YCLA 3U4KA 1DQDH 2WCPA 2XBZA 2W61A 5HHME 5FAGA 3BP6B 1FFRA 1OD7A 5GS2H 5C08E 2J66A 1E6OH 4XQ6A 4IGHA 4S3AA 5GRVK 3UBXB 4TN9A 3U79A 3GYRA 3J07A 4P5TC 1Y18B 4Y2LA 5IHHA 5C2BH 3NL2A 2J21A 1BYCA 3BPCB 2NNAB 3VXSB 3ORJA 3TEYA 3MJ7A 1CXHA 4UFJA 3MV8D 4NJIA 5SWQA 4JFFE 1MCKA 1DJHA 2YGYA 5K4XA 1R9XA 6ALDA 1I7RB 3W11D 5DUPL 5TDPA 1XZ0B 2ZZ2A 4XMLL 4AW7A 2H0JA 3BP5B 1WZKA 4DKDC 3NCFB 2V17H 3RDTD 4C83B 2I14A 1UWUA 1V7ML 4P99A 5J57B 3BGFB 1UZDA 1THFD 2NQLA 1Q0XL 1TJRA 1PD6A 3C0JA 1KEMH 1HIML 2F2KA 1LP9B 4P3WA 3SCSA 4L6HA 3NZPA 4B97A 1EZUA 2OZ4H 4DTGL 3AMDA 3SUSA 2J7CA 1JYWA 2W9DH 2ESVE 3JWOL 1J7VR 1TELA 3DXAD 5LQBH 3H6AA 3FRPB 2BLFA 3FOMA 5D7IE 1CD8A 2IQ9H 1M1XB 1KIPB 4ZT1A 1MHEA 1M2VA 3UZZA 5E5MB 2FT7A 1ZSXA 4M8QA 1F6AB 3DJTA 5TAOA 1E4XI 1HSAA 4HWZB 4OJCA 2D31A 4FERA 5ESVA 3H2AA 3KHJA 3WQGA 4L80A 2CHDA 3MV7B 1Y8BA 5DJ6B 4TM9A 1SY6L 3O2DA 3QTGA 1IFGA 1R3QA 2DYPD 2J47A 4HWBH 2QF8A 4EVNB 2WZIA 4WTQA 1IEQA 4Y1AD 5E1IA 1E4KC 1F7BA 4J9JA 1H15A 2ZZ6A 3V0WL 3FO1A 5HBFA 4JK0D 2AJYH 3FYYA 2P8CA 1KELL 1QSVA 4L0PB 3U46A 3WS6A 1GQIA 2YSSB 4S38A 3RWGB 2MJWA 3XISA 1SLVA 4OCRL 4RFEA 3ZL4L 3G08B 1KBKA 3U0TB 1K4HA 2Z6JA 3B0PA 4N9EA 5KG9A 5T1LA 2BMKA 1AH1A 3VI4A 5FM5O 2EJAA 4D71A 2BSTA 4ZJ9A 4J3OH 4KNUA 5I1IL 1ZENA 4QHNB 4OFYA 3R1GL 3GRWL 1C5BL 1CCWB 5IQOA 3N9GH 3CMGA 4HHPA 1WWAX 1UZ8A 5C7XL 3MP4A 2VYOA 5HWJA 2FSDA 2OJEB 3V0AC 2IADA 4QITA 4LDOB 3V4PB 2OJPA 2W9EL 3TLLA 1SBSH 4Q2ZA 1U3HD 4Y4FD 2PYFA 3K4WA 1B5TA 3EO0B 3S1VA 4FLHA 1Q9WB 4KY1H 2CZEA 4MZ3A 4XOAA 3RYSA 3IXTA 2G4JA 1J9SA 4RFNB 3UYPB 2O61B 1ISVA 4ZUVA 1ZLDA 2VLRA 5D1ZI 4OI8A 2WXPA 3K71B 1R4XA 4TUUA 2XXMB 3SE6A 2ERJB 5CG0A 4KUZL 3MT1A 5KZCD 3FOLA 2BVEA 3C4UA 5A8QA 5FF3A 2YAPA 3KYNA 3WEMA 4AWSA 3MRNB 5AOIA 3BISA 1VYSX 4C6LA 3PZMA 3QDMD 1NAKH 2PP0A 3FQWB 3R0NA 3RZCB 1XO8A 1KN4H 3N40P 4WKAA 2FO4B 3FMGL 3WHXB 3JBG7 3TV8A 1S7XB 3UBXG 4L1WA 4M62L 3TO4C 1O5RA 3V9CA 4YHZH 3HZYB 3WK0A 2I57A 3CUHA 4M61B 3S36L 4YXGA 1EX0A 3APYA 5FUCC 2ALDA 4CNPA 1VGKA 4LH8A 1NFAA 3FUFA 1IGTA 4ONFH 3UOAB 4B9YA 4GAGL 4BEUA 3VNIA 3ZE2F 3C60D 2P3YA 3L7FB 4XB7A 2MWCA 3VUPA 1FZMB 1I8LA 4PJDE 4BH7B 4PTMA 3HBLA 1KN2H 1ME8A 4P9HH 4LV4A 3NM1A 3NYZA 5EBUA 2IMNA 1ZLSL 2ONEA 4GZ7A 2JKLA 5DUML 3CZFA 1IM9D 3E8VA 3LRMA 4Z7NF 4EAYA 3TN0D 3QFJE 3RM8A 4PJ9D 1I3VA 3JTSB 3M1ZA 1NCTA 1TEGA 3DMMA 3FO2B 5J8LA 2PWEA 4D8AA 3DX1A 5ISZD 4PMZA 3NIDF 1QASA 1YXCA 4O19A 2UYLA 3PF2A 1SN2A 4UOW1 4LEBA 2XZ7A 4WFHE 2BH0A 4OTXH 1B0GB 1JNLH 3DAQA 1U93A 2O5YL 3TA3D 3MODL 3MLZL 3P5YA 4LSUL 1LL7A 5HWMA 2OW7A 2W95A 4MDIB 3ES6A 4BS0A 4DJEC 3BP4B 4GVHA 3KW3A 3EGDA 1F3DH 4S10A 5JH1A 5C3TA 4KKCD 4CQCA 4L5ZA 4JGUA 2BP3A 2OR8A 4UAOC 4L5FE 3UWVA 3GXTA 4G9DB 4RWYH 4A2HA 2Z31C 2G95A 1W17A 2VRQA 1KGJA 3OOQA 2AKMA 1GZPA 2UWEF 4PRIE 4FR1A 4S1RH 3WX7A 2EDKA 1XDJA 5KSAB 1E50A 4K2UL 4OV9A 4XVSL 5I9QB 5C2UB 4XP1H 1LNUB 4UM8A 4ODXB 4N0CD 5AC8A 1XD1A 4AENB 1NP0A 1OGAB 3JQOB 1MHPL 4UIMB 4U6XA 4PB0H 5D5MB 4NZ1A 4GUHA 1AKJD 4EQ3A 2OFJA 3E2QA 1E6RA 3NL3A 4MQ7A 2H26A 2YEZA 3RJXA 3LCLA 1JQVA 3WLWC 3CN0A 4LSRH 3TH4T 2HBXA 2TRSA 1WDPA 4YX2H 4OLUL 1R3VA 3OVGA 4CVXA 4R3UA 5EU3B 1EEZA 2O4EA 1I1YA 5E6ID 3TYGH 3WY4A 2JIXD 1NLBH 3PJSA 3HUJB 3FU3A 1YEKH 4PJ7F 1DJZA 4XVTL 2G5BA 1F4XH 1ZCCA 2BWGA 5K9KB 4JTSA 1VBJA 3QQ3A 4UMGA 3DK0A 2NXZD 5GJPA 3OKOB 2CGRH 2NY3B 5M94B 2DQUH 2MQGA 4DEWA 4D7BA 1XSKA 2CKNA 2G5UA 1G5GA 3I3BA 3VFGL 5I1LA 4JFOB 3P40A 4KX7A 5E8NA 4K7PY 5JPNB 2Z4GA 4HD5A 5IHBA 5J11C 2PTTB 3G6JF 3NESA 3UO1H 3CPRA 4J2PA 2F8IA 2R0ZH 3AREA 4MCMA 2BSSB 4GAYA 2PCEA 3B97A 4AYMC 4WHYG 3PWPE 4TQHA 2QHAA 3FTWA 4I2XE 5GS0L 1PKOA 4R8WH 1MLCA 3OBAA 4AX3A 3QDJA 1EP1A 5AECA 3B9OA 1P5BA 5JDSB 5F88A 4G72B 4LVOC 4OCMC 3WAJA 3O3RA 1NDMB 1DVFC 1PZBA 1F76A 2YZ8A 3CFDB 5KVMC 2ZUWA 2JKNA 3W39A 5E9DB 1HKFA 3Q2LA 4AT6B 4KERA 1AHWA 3VXRE 2V5SA 1V3KA 3NCJH 4ZW5A 5FYJL 3CSGA 2FVNA 2AJUH 3C8DA 2ZOUA 3O4LD 1OZUA 2DW7A 5CKGA 3N3TA 1A1NB 3SUTA 1HL2A 3G6AB 4A6YH 1C8VA 1GC1L 2FQIA 2AK4A 5JDJA 2X0WA 3HN8A 3N43F 3P77B 1DV7A 3CU2A 4BK5A 4N87A 3RPKA 1MVUB 1FUYA 4JFEB 3AXLB 3VRLE 5E94A 3ZE2B 3JWNG 4DUWA 2GFTA 2OXGB 3WO4B 1UQSA 1BVKB 2N7SA 1C1EH 1OFBA 4HD9A 5T3XD 3B7TA 2D03L 4PUNA 1B54A 2Y8VA 2GUYA 2F9BT 5B7EA 1OE1A 3OIHA 3KW8A 3N6YA 4H9TA 2FBJL 4IOFD 5I3KA 4Z7NB 1XLCA 5CD5D 1N7KA 3W02A 4I18B 3SIMA 3RCYA 4JN2A 4O52A 2V5DA 3U9PL 5IB1A 1PIFA 1OF2B 4A2SA 4C54A 2P53A 1QLEH 4AXKA 3NIDB 2L7UA 2B20A 3QR3A 4JXCA 3E0IA 3F7QA 3PBWA 7PCYA 2C1OA 4DO7A 5GNZA 4W9HC 3UZWA 1DXEA 2PDQA 1ITQA 5J3HD 4HCFA 2HG5B 5A6IA 2D2HA 4XC1L 2TODA 4G7EB 3U7WH 1IKNC 2UVFA 1MI3A 1VACA 1DQJB 1CXKA 1SM3L 4K94C 3ATBA 1A7QH 1FA2A 4OU1A 3GIVB 3VCLA 1FNHA 1VF8A 3ILQD 2X2IA 3BZEA 5LXGH 1Q94A 2O0TA 3IMRA 1FNLA 5E1AA 4V11A 3VXGA 5ALBH 1IGJA 4WOZA 3LKSA 4XZHA 3QIWA 4MMXA 1RZFH 2WINA 3T05A 1W56A 1L6YA 1FZJA 2ZXAA 2DW6A 4Y9FA 4JKWA 4KKAD 3KWSA 4OZFA 5FIPA 4XPTL 3EFFA 4U4IA 5E5CA 4HCRL 3IAPA 2NY2C 4P8WA 5JXED 4YLCA 3OJVC 4M7ZC 3P84A 4W84A 1TVNA 5EZIL 3KYMA 1K02A 2BP0A 4LF3B 4LLDB 4L5FL 1J6PA 4AIBA 3HBPA 3P2BA 2O9PA 2O6DA 3T09A 1QFWM 2I5YL 4IX2A 3MDUA 5FB8A 1C08B 5EC1A 4W6XB 5LXVA 1MXGA 4PJ7B 4BGLA 3OTTA 5LGHH 3KLHC 4X5PA 5KW9H 3CAKA 3QUGA 1JYNA 4K8RL 1QLRB 1L2QA 2DM3A 1ZE3H 2J88A 5EL1A 2BNUA 3EXJA 4KKBC 4Y5YC 2V2TA 2VM3A 2V3DA 4IU3B 2G0WA 1BBDH 4MD5B 3KPNB 3QHOA 3KP1A 4AZUA 1TV3A 4KWOA 3CIXA 5T3ZH 5DHVA 5BQ7A 3BT0A 2IPGA 3DTXA 3O9WD 1JDEA 5F4WA 3JT2A 3KPRA 4YHMH 4LCWD 3O3AA 3G6JB 3CVHH 1PYWA 2Q7YB 3KPSD 1UT9A 4BK9A 5LJYH 1JXJA 3S2CA 3QXDA 1OFEA 1G0DA 4CNSA 3DVFA 2OA9A 4P8XA 1OGBA 1KNWA 3M8OL 1QO3A 3PAOA 3L67A 2NY5L 2V7NA 3NJ3A 3WUFA 3GBNH 5T9BG 2IJ0C 3Q5OA 4FCAA 4OECA 3SDDB 2WVSA 3LHZA 3O3UN 9XIMA 3EOSA 1A6WL 4EKJA 3S3BB 4PP1D 4ZQKB 1E9PA 1W3IA 2YUZA 2DIEA 4NUWA 1UC6A 4G5ZL 2PWDA 3TYFB 1KLFA 2WP3O 5L9DH 2VMJA 3BGMA 3SDAA 2WWOA 1A5LC 2J7EA 1WP6A 5AQ0A 2AJ3B 3R89A 2EGZA 3MC5A 3MRMA 2PCPA 2QJMA 4XN1A 1K9TA 2VDKB 1JDFA 3W27A 4Z7UF 4YL2A 3NIGF 2HX7A 3RUGF 1Z44A 1J8RA 4Z1CA 1WBJA 3ZVIA 3BARA 1DVQA 3FUJA 4UTAL 4R0LA 4O50A 3N43B 2JSFA 1BAFL 2C9AA 4TX8A 4LOUC 4K8GA 3UJJH 2NR6A 2AAVA 2KMWA 1A3LL 3RWEB 2ATKA 4IJ3B 4HZMA 4XZMX 1G9ML 2IC2A 1JZ4A 1NGYA 5CLWA 1KBIA 5KVDE 4NQEB 3UTZB 3L3DA 2VC2H 3OKLA 2VIRA 3Q8FA 3ZIMA 3STZA 1EXUA 4RZKA 3FY1A 5LAXA 5K9QI 2VN7A 1X38A 5DMIL 4UFMA 3N9SA 2MQ0A 2VCCA 3S4SA 5HI3D 1K3UA 3E96A 5D71H 3GRBA 3GG0A 1W1VA 3D2UA 3C5ZC 1MCSA 1VZHA 2X1WL 4QRSA 4KKQA 4WDXA 2AEPL 3VQ2C 3GI9L 3U7YH 5L6YH 1ECEA 2WKLA 1DO5A 1HHHA 1HOCB 3KOFA 2WO4A 4UQ2A 2W38A 4ZX3A 3DVNB 4IRZH 5AOLA 3S37H 4WVRA 3MX0B 3GIZL 2I7GA 2WQPA 5T1DL 1ONQB 2XCMC 4NQXB 4IOTA 15C8L 1OADA 2EKSA 4QCIB 1T1YA 5EOCJ 3NZQA 5IFJA 1GHRA 1UZHA 4AU0A 3W2KA 1AMKA 4XZIA 1A14L 4JR9L 3ULVF 4BCXA 3CH1A 4ZMYA 4D9PA 4FA3A 3MI2A 1M6UA 3AYRA 1JPGB 3RWCB 3ABZA 3PBMA 4M8VA 3W1QA 4NYLB 4B5ZA 5A2CA 4GH7B 2GC4C 2A4CA 1CXIA 5IT2L 1VFAA 3T6QC 5I1HH 1LDPH 3CV6A 2VSDA 1IAOA 4K3GA 3RNKB 4N5UA 5JXQA 1YNLH 4J3UA 4U1HB 2IOMA 3MCLL 2VDNH 4KI5C 3MRFB 1WNOA 1Z9NA 4PI0A 1GGIL 3ABSA 2ZTKA 3VMOA 4B95C 3C2OA 4GX9A 4LVDA 2WHMA 3GB6A 1EZWA 3ZDWA 4R9XA 4YQXH 1G9HA 2WLKA 1GPOH 5A95A 2XA8H 3DV6A 4GW5B 3SKJH 4QDMA 3U0PB 3VI3A 1G4SA 4EPSA 1BYDA 2QUNA 4EDXA 1W2KT 2GK0B 4PJEE 1ASPA 3HI1A 4HHMA 4AZIA 4UOQA 4M6ML 4O2CA 3DIFB 3OVQA 1W72L 1AR1C 5DDHB 1IE5A 1DTNA 4X8GA 1OEPA 1GGBH 1CK0H 1S3KL 2F68X 1D8WA 3MY9A 3DI1A 4I0KA 3C3NA 3A64A 1FE8L 4AC4A 3OHXB 1RURL 4JFXB 3IBOA 2W65B 4KTEL 3WH5A 1EGMA 2SEBB 3WXVH 5DMMA 3M0KA 2WMPB 2H90A 5DO2D 4WV1B 3SQBA 1N8ZB 2DWDA 2DQGL 5DHEA 4BI7A 3CPLB 4HZ7A 2AJXL 1YPFA 4AOFA 2JJUA 2OSLB 2PDNA 4NQ1A 3QUML 3W0WA 3FO0H 3AG2B 4JBSA 4HK3J 4UTBL 5BMFH 3W9DA 1FF5A 1N6QL 2P10A 1WS8A 2COQA 4WQOA 1ZSDB 1X7QA 1ALDA 3UH8A 4DGUA 1QA9B 5CEYA 3QIBD 1UPMB 2BHUA 4Z7UB 3I3EA 3NIGB 2QV4A 3QUKA 3RUGB 3TO4D 4W9IC 1FG9C 3ZOAA 2WZHA 1B3IA 1CU4H 2AXWA 2XGBA 3W11C 1RZJC 3TU6A 2GIYA 5PAZA 1G67A 1BGAA