3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
1WZAA 3AMDA 1MVYA 3CUJA 1RPKA 3WD1A 3VD5A 4DWSD 2C0HA 3VU2A 1UZ4A 3W25A 3CC1A 4Z2JA 3VOCA 2O9PA 1XH1A 3LPGA 3WDIA 3N9KA 2E8YA 3POHA 4J3XA 2ZX6A 4QFUA 3DHUA 1LG2A 5CPQA 4D6EA 3ZMRA 3MKKA 5A8OA 2UY3A 3FY1A 2YFOA 4W88A 4CD7A 1CTNA 2TAAA 2A3AA 3BLKA 3GDBA 1KQZA 3MMDA 1EHAA 3RILA 4B9YA 5DFAA 2XHYA 2D0GA 1ITCA 4NZCA 3SUWA 2XWEA 1CENA 4UFJA 3PTKA 1JNEA 1NWUA 3PZIA 3RM9A 1UHVA 1UG6A 3B9EA 5ECUA 3H53A 4UNIA 3WDQA 1TA3A 3F4VA 1BF2A 2J62A 3ARVA 1V0MA 4PMDA 1UZ1A 2RGLA 2BHYA 3WUEA 2QF8A 4AWEA 1UD8A 1ECEA 2XM2A 3VD7A 3AIVA 2IUZA 3BVXA 3BAJA 1W9BM 1EDTA 3WDJA 1BFNA 5DT7A 2XN1A 1FFQA 1DWHM 1LLOA 3WEZA 4BF7A 2D2OA 4TVDA 3BVWA 4BA0A 4AXNA 1M04A 2PWEA 3EMZA 1CGUA 1JI2A 4WSJA 3WFZA 4AISA 3CHFA 2WC4A 3HU7A 4JL2A 1QW8A 4JFWA 1JXJA 1B3XA 1GZJA 4BQ3A 1RD6A 2VTFA 4ZFMA 1OT2A 1V0LA 7TAAA 1HNYA 4CD6A 4CCCA 2VX4A 3BSHA 1GQJA 4WKFA 4MNMA 3WL0A 1QBBA 3CUIA 1LWJA 1WDRA 3MSGA 1UKQA 2GUYA 2DGAA 4HA3A 1NOWA 3WF4A 3MV11 1UR4A 3CH9A 3VM5A 3OGVA 1XYFA 1XH0A 1EGZA 3WBAA 4W8BA 1TZ7A 1D7FA 4PMZA 1CPUA 1V6XA 4F9JA 1W9XA 2W63A 4MB1A 2X0HA 3T09A 3SCQA 1OT1A 3MU7A 1NWRA 1CDGA 2ZICA 1HJXA 4XUYA 1QX1A 3VD9A 3PTQA 5E1QA 1H0GA 3AIWA 4J3UA 2OYKA 3O9NA 4CCEA 1DEDA 2CETA 4GXPA 4WIWA 3T0DA 2FHFA 3ARWA 1UQYA 4JCLA 5CZKA 3W6MA 4W89A 2YFNA 3GBDA 3GM8A 2D0HA 2PBOA 2JIEA 1JZ7A 3WUGA 3T2OA 2WWDA 5EFDA 2BY0A 2ZUNA 5BXSA 1HF6A 4FNUA 1QNOA 1UR2A 2BY2A 3L2MA 1IV8A 2JIWA 4D6DA 1W2PA 4P7OA 5AC5A 3EJTA 4CD5A 1ZJAA 5CG0A 3BVTA 3WELA 4JFUA 3NYDA 5GNXA 4HU8A 4X9YA 1HKKA 4WKHA 4CUCA 4U33A 2QV4A 4NZFA 1V3MA 3LX9A 4E8CA 1E73M 1B3WA 1YQ2A 3RO8A 3WY4A 4IPLA 5I24A 1UKSA 1V6WA 3DDGA 2VCCA 4BQ5A 2WSKA 1VJSA 1M01A 5A6KA 1H41A 4QCFA 3SEPA 2V3GA 1G5AA 4FLSA 4DUWA 1JD9A 2WPGA 4H8VA 4U2YA 1TG7A 2J75A 2ZWZA 3RIKA 4OGZA 2JE8A 4UTFA 2FH6A 1Q6CA 2GJRA 3N17A 2EO7A 1UA7A 1UOKA 3WQWA 3AXHA 5M03A 2J78A 1ZBVA 1SZNA 3N11A 4UFHA 2WBGA 1MXGA 1SMDA 4PMUA 3RM4A 2WHKA 4AMXA 1PZ2A 1WZMA 3NSXA 3ZSSA 4AZ7A 2DT0A 4CN4A 2CKRA 2D23A 4N42A 1J11A 3EJSA 4MNJA 3WIJA 4AZBA 1RP8A 4XV0A 1R34A 2WVUA 2YBTA 4KGLA 3QGVA 3EJQA 2J25A 5ABFB 1FH7A 1ZB5A 1C93A 3AYRA 1J18A 1PIGA 5A95A 5BRPA 1O7AA 3GNRA 3MMWA 3QOMA 5GQBA 1NP2A 2VQTA 3GZAA 4H41A 3GBEA 1E6NA 3VIPA 3WUBA 1FH8A 3KL3A 1TQVA 1OGBA 4MAVA 1QNRA 3WNNA 4PN2A 2YJQA 1CGXA 1KCKA 4W7UA 2JFEX 2EPLX 3MS8A 3VDHA 1CWYA 3CUGA 1UQZA 4JHZA 3LXCA 4NRSA 2W67A 2WCAA 4KRUA 1GCYA 4AZ5A 4PMVA 1E0XA 2DH3A 2BY3A 3O2LA 4QLKA 1O6IA 2D20A 2ZX8A 1GJUA 4IM4A 4MTVA 3OZPA 3TTOA 1H1NA 1JDCA 4HZ7A 4HMCA 1PX4A 5CGTA 4GKLA 1T0OA 4JL1A 1US2A 5D9MA 2ZUUA 2NT0A 1WKYA 3U7BA 1WNOA 1UKPA 1XH2A 1X1NA 3G6MA 5FL1A 1ESWA 1CXIA 3N1AA 2D24A 1E5NA 3OLDA 2VMFA 3CZSA 5D9NA 3WY1A 1I1XA 2F61A 4PTXA 4W8AA 3BUBA 2XUCA 3VPLA 1QOXA 4GI6A 2CNCA 3VGFA 1VAHA 3THDA 5TD4A 4DO6A 1ISWA 1KB3A 1O7DC 1U33A 3ARPA 3FAWA 3MUY1 3M6DA 3MMUA 4GQRA 4PTVA 2YL9A 2ZIDA 1NM9A 3VIJA 1Q4NX 4KWUA 1KXQA 1JXKA 2PWGA 1MFUA 3LPPA 3HG3A 4FF5A 3MO4A 2XWDA 5JUVA 2ZUSA 2D1ZA 3U5UA 1B3YA 4MNKA 3WY2A 3IJ7A 1FP9A 1J0JA 3HMCA 3DYMA 3I3EA 1PAMA 3WL1A 3A3HA 4FNSA 2DQXA 1E40A 1FHLA 3AI0A 1OCQA 3D52A 4ZE5A 2BXYA 3ZO9A 2WVTA 4LYPA 4P7RA 2CBUA 5KZ6A 1CXKA 1XYZA 3BSGA 4PCSA 2YLAA 1JYXA 1CIUA 1HXJA 2QMJA 3ARTA 1K9FA 4D71A 3A4AA 3TTQA 2X0YA 4M82A 5DF0A 3ZSTA 2VX6A 1PCPA 4BZYA 4AD5A 3HJEA 3LPOA 2YA0A 3ZIZA 1E4LA 1R46A 4HU0A 3AOFA 3WQ6A 3WQ5A 2D3NA 5EMYA 4H04A 3PZTA 5JBEA 1WDSA 2O9OA 3AQUA 3HG2A 3D51A 4QCEA 5A6LA 3L4TA 2HVMA 2X8RA 4AY1A 5F7UA 1V3IA 2J7DA 4OIFA 1BGGA 2OLHA 3AFBA 5I3DA 4W93A 1ISYA 4F8XA 4IPNB 1PS2A 2BVYA 1M53A 7CGTA 1OWQA 1BVZA 2J74A 1B2YA 1DP0A 3NSNA 3TTYA 2X05A 1XC6A 2E40A 3BMVA 4V27A 3W4RA 2WMFA 3SCOA 2WC3A 4ZXLA 2VR4A 1QI0A 3RDKA 2ZX7A 1OSEA 2VNCA 3DX4A 3ZQ9A 4AYGA 5BWFA 2Y4SA 1E6SM 1GQIA 5CLWA 1Y7VA 3W24A 3BUIA 1H09A 4QAWA 2WMHA 3I3BA 3TV8A 3WSUA 3VIHA 2A3EA 1GOQA 4PYSA 3BAYA 2WNWA 2PWFA 3ARSA 3NDZA 1EIBA 5E0FA 4PTMA 1C8YA 4ACZB 3TP4A 2F1AA 4AZHA 5BCAA 4UQEA 1E6XM 2WLZA 2YDSA 1V02A 2BS9A 4KGJA 5BXTA 2OSYA 5A2AA 1W9DM 3BVVA 1MW1A 3QHOA 3HG5A 4RL3A 2YLLA 4BQ4A 3VKKA 5A8MA 3PZMA 3VIIA 5CGMA 2YKKA 2WM0A 2F2HA 1V6VA 1GVIA 4MJ4A 1DTUA 1BG9A 1JDAA 3SUTA 3CHCA 1B3VA 2WYSA 1AMYA 4DM2A 3VSUA 1IZKA 1KFWA 5ABFA 2VX5A 1K9DA 3EYPA 3WD0A 1V3KA 1GORA 3WN6A 3VNZA 4D6GA 5A6BA 1QHZA 3OIHA 3AZRA 3WEMA 4AD1A 5BROA 3GNPA 4ATDA 4ZEPA 4E8DA 2J4GA 4B3KA 4DUXA 1B0IA 3B9DA 3AZTA 3RMEA 1BQCA 3VIGA 3S6TA 1UR1A 1CYGA 1PIFA 2GVYA 2OYMA 1CGYA 3VGEA 4UOQA 5BRQA 4A4AA 1UKOA 2ZWYA 1EXPA 3PN8A 3W37A 2YOCA 2C8NA 1J10A 2BNJA 3DDFA 1NWTA 5FCZA 1W1YA 3WD4A 2J47A 4WKAA 4FMVA 3RCNA 5E0CA 3IANA 3EDJA 1G9HA 3M07A 2F8QA 4B15A 4TOQA 1V3LA 2PWDA 1XD1A 1CXEA 2J7BA 1OBAA 1QI2A 1C8QA 1EO5A 1E6PA 1SFSA 2O9TA 3GH5A 3NSMA 2GK1B 1QNPA 3RPMA 1KBBA 2UWFA 5I5RA 1JF6A 5E9AA 3FAXA 2EPOA 1AVAA 1JG9A 4J3VA 2ESCA 2X09A 1E0WA 5JIPA 1JNDA 1X6LA 4DO4A 5EB8A 2XVNA 3BMWA 3ZR6A 1VBUA 2CITA 1V6YA 2VCBA 1PPIA 3AMLA 4A3HA 4FK9A 3KLKA 2Y8KA 1CLXA 2YL5A 4JZ5A 4TXEA 3GH4A 2WKGA 1GHSA 1OIMA 3M46A 3U7VA 1IZJA 4GZEA 1D3CA 3WNKA 3L4XA 5AC4A 1HKIA 3RM8A 4KMQA 4UQBA 1KGWA 3W29A 3WMCA 3WH7A 2D3LA 1KXHA 3NUKA 1I75A 3U57A 1ZJBA 1GJWA 5FD0A 4QP0A 1XSJA 1JFHA 4JHOA 1UWRA 4AD2A 2FDMA 3VINA 4CN6A 1GQLA 1HKJA 2E0PA 1QNSA 2EPMX 4UFMA 1UASA 1OB0A 1F4AA 5FKYA 3GXMA 1TCMA 5IHRA 1KR0A 2CERA 5AYBA 1XGZA 3B8SA 4HPHA 4MADA 2G41A 3A22A 4V28A 2CCRA 3LXAA 1ODZA 3NIYA 4WK9A 2YIHA 2YDRA 3AYSA 3K46A 4W5ZA 3D50A 1LL6A 4AD0A 1E56A 5DO8A 3KL5A 4H2CA 5IXEA 2AMGA 3CZKA 5HPOA 2DT1A 4LPCA 5D8ZA 2EEXA 1PZ3A 3PZNA 2YDQA 4UOJA 1H3GA 1DHKA 2VURA 3MUAA 2XSAA 4MB3A 1E9TA 3MSDA 4JIEA 1BHGA 3VDAA 1CXHA 8CGTA 3L4YA 4D1JA 2BFGA 4CD4A 1QWUA 1EHNA 1GHRA 1GPFA 2XGIA 2Y2WA 2WZEA 1QVBA 4XB3A 4JFVA 1HL9A 1R7OA 3VMOA 1E0VA 2FYVA 1TR1A 3N15A 2PC8A 5KEZA 1TVNA 2DSVA 2GSJA 4TVUA 1E1FA 3VIOA 5IHSA 3UG3A 3APGA 1B90A 1FHDA 1VJZA 1LWHA 1E4IA 3BH4A 1BTCA 2G3NA 1KR1A 3A6OA 2ALWA 2E9LA 4HZ6A 1HKMA 2VO5A 2EQDA 5I79A 1XSKA 1XCWA 5CJ5A 1W1VA 1V02E 1J9YA 2GJXA 5A69A 1KBKA 3VO0A 3MUZ1 1B1YA 1R47A 2VR5A 3DHPA 1GVYA 3AS2A 4CKQA 3WF3A 2VZTA 2OYLA 3AMKA 4M1RA 4M56A 3VDCA 3PTMA 2XVGA 3EDKA 3S5YA 4JAWA 4S3JA 5DEZA 3RJXA 1NARA 3N13A 2PSPA 1US3A 4TVCA 1KQYA 2PWHA 3FHAA 3AJ7A 3SCVA 1QI3A 1UD4A 4AD3A 1G01A 2FHBA 5ABGA 4QLJA 2DIJA 1J0HA 2VC9A 1H2JA 3F5JA 5HPCA 3L4UA 2J8GA 2CIPA 2OW6A 1SMAA 2CXGA 5BXRA 3TONA 3THCA 1KGUA 1NOUA 2XN2A 4ZE4A 3UERA 4PRWA 4AMWA 1GONA 2BVDA 4ACZA 4AEFA 2E9MA 5FOOA 4R5EA 5A6AA 2W61A 1C8XA 2VVNA 4M29A 3SUVA 1V0KA 4J7RA 1H0IA 3CIVA 1HL8A 3VGBA 1JYNA 3LRLA 2ZUTA 1OD8A 1GOOA 3CHDA 4PMYA 1WZKA 1E4MM 4PSPA 4MDPA 3KEHA 2CYGA 4W85A 3AMGA 4DWSC 1OGSA 1UH2A 3SUUA 1UD2A 5EFFA 4AD4A 1L0PA 2DEPA 1UA3A 4NI3A 4J3TA 4DWSB 3W81A 4MDOA 4FNPA 2XFFA 4J27A 4J3WA 2DSZA 1JZ4A 3GXPA 3FN9A 3DX0A 3WH5A 3WQ4A 4F79A 1JYWA 3WQ8A 4PMXA 1XV8A 2UY4A 4UCFA 2VL4A 1UD6A 3F5KA 1BYBA 3AXXA 1VRXA 1ZL1A 3W82A 3PZOA 4IUGA 4F9DA 1EQPA 4X0VA 3H54A 1QBAA 2WZIA 2F7QA 4UZSA 1HT6A 1GW1A 1W9UA 4TX8A 3D4YA 1ISVA 1UH3A 1S46A 2WXDM 1K9TA 3T08A 1UR9A 1M03A 3ZT7A 2G4FA 1HWWA 1E43A 2QHAA 3K8LA 1JF5A 4WF7A 5JBDA 3JUGA 1TA3B 1VEPA 2GK1A 2FGLA 4C7GA 3CV5A 3AICA 3WF1A 5DT5A 1U2YA 1OGGA 4GZJA 2OSWA 3T2QA 3A5VA 3ZR5A 3VSTA 1EDQA 1Q6GA 4UR9A 3CLWA 1EOKA 2OWCA 6A3HA 1PS3A 3VNYA 3WNMA 1UWQA 2ZXDA 4LXFA 3B9AA 5BYWA 2DIEA 4RE3A 1UD3A 5D9OA 4C7DA 3GYCA 1LL4A 4OJYA 3LMYA 3BUQA 4A3YA 1TQSA 2J7CA 2XTKA 4MB4A 4OKDA 2EBNA 3ZOAA 3WF0A 3ZM8A 1AQHA 3BC9A 3VGDA 2WHMA 1JFXA 1G94A 3AZSA 1JAEA 4UFIA 4HA1A 1QWNA 2Q8XA 2PBGA 1VFOA 2V5CA 3MI6A 4U3CA 3AIUA 3VMNA 1E5JA 2A3HA 4X0NA 2O9RA 1KWGA 2JF7A 3CZGA 4H8UA 3NJ3A 5ABEA 3BCFA 1UR0A 2WZHA 4WLCA 1DWJM 2D73A 5I2UA 2FH8A 5D4YA 1R8LA 4HZ8A 3BAKA 1A3HA 1AQ0A 4FNRA 2F7PA 2G8ZA 1QI5A 1QW9A 4QDMA 3SCNA 5LA0A 1WDPA 1BGAA 4LGXA 1M7XA 1E15A 4GPNA 1ZBWA 3VILA 3AHYA 5CXPA 2X1IA 3K4DA 5ABHA 2GFTA 2WVVB 2WCGA 1FH9A 1UH4A 1WPCA 3AIRA 3AS0A 3SUSA 4FLOA 3II1A 1XD0A 3DECA 4FNTA 1BYCA 5A3HA 4LQ1A 1CGTA 3TA9A 1V3HA 1JDDA 3AIEA 1PX3A 4AYSA 1CEOA 2WMIB 1HP5A 2A3CA 1D2KA 3BCDA 2VT0A 2O92A 3AS1A 4PTWA 4EKJA 1HI7A 2X2JA 3MANA 4J28A 5I0DA 1Q6FA 4AW7A 3O6AA 4FNQA 2W66A 1QPKA 1XSIA 2EPNA 4MPKA 4AZ6A 2BHUA 3GXIA 3NCOA 2CHOA 3WBEA 3WUFA 3DX2A 3ZJKA 3ZJ7A 4YPJA 2FGZA 4GI9A 1J0YA 3VM7A 2W5FA 3WEOA 2ZUVA 4UQDA 3WMBA 3BLBA 3VIKA 1GOKA 1JI1A 2CESA 2PB1A 2ZOXA 2D0FA 1E9LA 4NF7A 2X2IA 2XFYA 4WJXA 3WD2A 4AZGA 1CLVA 3BGAA 4M24A 1K9EA 4ZXOA 4PEEA 1MQRA 4GIAA 4XX6A 2W4XA 1HJSA 4D1IA 1MW2A 2W91A 3BVUA 5LA1A 4TTGA 1GOMA 4JKKA 4JKLA 4WSKA 1F4HA 1HTYA 4NRRA 4OOZA 2E3ZA 1NQ6A 1VEOA 5M5DA 2DPEA 3N12A 1TQWA 1MW3A 2JEQA 5A8NA 3IJ8A 5CSYA 4BQ2A 5A94A 4IISA 2JEPA 1C90A 3W27A 3TTSA 2XFRA 1Z32X 1B30A 2J79A 3E1F1 3I3DA 1UWIA 2J7EA 4NSBA 3CTTA 1C91A 4GZIA 2GDVA 2F18A 1OM0A 3MV01 4AZIA 1KWKA 4JKMA 1C92A 2DT3A 2CBIA 1VF8A 4PMNA 2VX7A 2DT2A 3WQVA 2VZOA 2EABA 1WDQA 2QPUA 1L8NA 2OW7A 4H8HA 3VMPA 1UWSA 1HX0A 4AZCB 3S5ZA 2QMKA 1SYTA 5A6BD 5CPSA 3SCRA 2F7OA 4DWSA 1QI4A 1KXTA 3N18A 3IK2A 2UY2A 2Z1SA 1XCXA 5A6JA 5HNNA 3GXDA 1VB9A 1HIZA 4EAMA 1FOBA 1G1YA 1WE5A 3UR8A 3SIMA 3BAXA 5HBFA 4UZUA 1JZ6A 1P6WA 4Z2KA 3UG5A 1W2VA 2EACA 4W7WA 2WKLA 4B3LA 4P7NA 5GNZA 2J77A 3A4WA 4PMOA 1Q6EA 1I1WA 1CGVA 4UQCA 3CGTA 3TOPA 1VFUA 2V3EA 1OD0A 3PZQA 1OIFA 1WZLA 2ZUMA 4NX0A 4PMQA 5GNYA 3ZT6A 2DSUA 2Y5EA 4C7FA 2Z1KA 2CEQA 4EK7A 1E70M 1VFFA 3AHVA 4MB5A 2VRKA 4KRTA 3KL0A 1W32A 3ARRA 1JGIA 2GJPA 3AISA 4OBSA 4HTYA 2QLYA 1EDGA 2V5DA 3WD3A 4PMRA 1E3ZA 2Y24A 3AHXA 3A4XA 3K8MA 3KWXA 1BYAA 2XSBA 5A1AA 1GUVA 1UWTA 3BUPA 1JAKA 3WDRA 3WMSA 3FHQA 4W84A 3VX1A 2ZX5A 4TX6A 3WY3A 4R27A 2VVSA 1ZBCA 5IFPA 1MWOA 4P7QA 3W28A 3A47A 5DMYA 1LJYA 1JD7A 2WANA 1RH9A 1LG1A 1WB0A 2CHNA 2QPSA 1LQ0A 1CECA 1EQCA 2ZXBA 4KH2A 1GOIA 3AHZA 3DX1A 3ZT5A 3VX0A 3ARZA 3GXTA 3K1DA 1W3LA 2WVSA 4QLLA 4P8UA 4UOZA 1B31A 2WSPA 2G3MA 3QOKA 1LF1A 2FHCA 5AYIA 4JCMA 1J01A 4Z2IA 1E72M 3BAWA 4NXSA 3A21A 2VZSA 3ZJ6A 2Y8VA 2JALA 2ZE0A 1GQKA 3L4WA 3VGHA 3OBAA 1KCLA 3DX3A 1R86A 3WH9A 3A24A 5IFTA 3OZOA 1R33A 4PUDA 3OG2A 2X2HA 3SCPA 1EOMA 3WDPP 1RP9A 1EH9A 1ZU8A 1PJ9A 5A2CA 5E6ZA 2WHJA 1E55A 1XRVA 4HMDA 4GI8A 1TE1A 4E2OA 2EPKX 5EBAA 2F7RA 4FLRA 4CVWA 1R7AA 5LA2A 3S2CA 4DUVA 3WH8A 3J7HA 1J12A 3PHAA 2JF6A 1TQTA 5CLTA 4F66A 2CBVA 2XVPA 2WVVA 3M7SA 4D6HA 3PZVA 3H55A 4HP5A 3FNDA 1CNVA 4W87A 2XN0A 3POCA 1TMQA 3EMQA 4L4OA 3OB8A 2NT1A 1GOWA 3SCSA 2WMIA 1KTBA 3OLEA 4AEEA 4TUFA 2IGTA 4YHGA 4GO8A 4MNLA 1ODUA 2VI0A 5FIPA 2DSWA 3EJUA 4H7VA 8A3HA 1R85A 2ZXAA 2G3IA 1H49A 2WB5A 1W3HA 3SCWA 1E6QM 3T0BA 5I6SA 3KE0A 1R75A 4TTUA 3HN3A 5M17A 7A3HA 1DWAM 5A6SA 4UQ9A 4CGTA 1AQMA 2YA2A 3CZEA 2AOSA 2BVTA 3CZ8A 1PSPA 3UEQA 2DH2A 4D6JA 4ATWA 9CGTA 5GPRA 2DSKA 5D8WA 1ISZA 2WW5A 4P8WA 3UETA 4Z2LA 2DDXA 4UFKA 5A6MA 4LX4A 2WC7A 4CVUA 2J7FA 1HJVA 1MW0A 2OWWA 4P8XA 3SCUA 1PBGA 1JIBA 1E4NA 3UESA 3G6LA 1UKTA 1J0ZA 2VRQA 3KZSA 3VIMA 1JZ8A 4DO5A 4OBRA 5I78A 1KGXA 3UR7A 1R87A 1QHOA 3VDBA 3WNOA 3PBGA 1BPLB 3AMCA 1HJWA 6CGTA 1OINA 2YBUA 2E8ZA 4HOZA 4P7LA 4AIEA 4LYRA 4HOXA 1XHGA 1PE31 4W86A 5LYRA 3HG4A 4CN1A 4CU6A 3EBVA 2E9BA 4MAZA 3T2PA 1MXDA 4D72A 1WO2A 1NP0A 2YL6A 4CD8A 5I23A 2YL8A 3LPFA 1HN1A 1UWUA 3CBWA 2BXZA 1YHTA 2XIBA 3EDDA 1B3ZA 1BYDA 5A2BA 1QHPA 4AZCA 3VD4A 4Y7EA 1H5VA 3EJPA 1TFVA 2HISA 1CXLA 5AY7A 2VZUA 1V3JA 2BY1A 4B9ZA 4HPGA 1FA2A 2ZX9A 1FFRA 2BV9A 1NWSA 3EMCA 3WF2A 1W3KA 4XZWA 1C7TA 5C8BB 2EAEA 4OOUA 4BS0A 2WMJA 3CMGA 4M80A 3W6LA 3W38A 1W1PA 2XVKA 3BUDA 4FLQA 3AHTA 3BLPX 4URIA 3CUHA 2CKSA 4GQQA 3WDHA 3UG4A 2J7GA 3KLLA 4E4PA 1K6AA 4PCTA 1B9ZA 1H4PA 1X6NA 6TAAA 3AROA 3GXNA 3WFLA 5IDIA 1JZ2A 4NXKA 3CZLA 3L4ZA 3LXBA 3ALGA 4Q7NA 4PSRA 5CPTA 1HXKA 1N82A 3K8KA 3EJRA 4J3SA 3W53A 2F1BA 3IGUA 2VQUA 4JFSA 1ITXA 2B31A 2XJ7A 1BSIA 4B16A 3HZ3A 3VD3A 1EO7A 1SR0A 4D6CA 3ECQA 1J0IA 1GNXA 3GH7A 1BVNP 1V0NA 4AIUA 3CZNA 1VFMA 4UFLA 1U30A 4D6IA 4Q22A 3D4ZA 4PUEA 3QR3A 3LRMA 4GINA 4OZOA 3EDEA 5BXPA 5A8PA 3IAPA 1VENA 4ZENA 3OGRA 5C71A 3F5LA 4P8VA 5I77A 2E4TA 1HP4A 1CGWA 1WP6A 5CQ1A 1E6ZA 1UD5A 3T0AA 3CO4A 3OLGA 1UUQA 2OWXA 2C7FA 2VCAA 3WKZA 2WMGA 1TUXA 3WNPA 3GTNA 4W7VA 1TQUA 3AIBA 3WNLA 3CMJA 1WAWA 1HJQA 2BHZA 1UYQA 2WCSA 5E09A 4ML4A 2FE0A 1CXFA 4Z2GA 1NH6A 3NDYA 4V2XA 4NZJA 3QHMA 2AAAA 2V3FA 2XPKA 2X2YA 1C3FA 4AIOA 3CHEA 1ZBKA 3UCQA 4JFTA 3WENA 3SURA 5M3WA 3ARXA 3FXYA 4W5UA 1JYVA 1C7SA 2YA1A 2D22A 4MJ2A 2EXOA 3CPUA 3BAIA 1PX8A 2GDUA 3GXFA 1MQQA 3W0KA 4RE2A 1Q6DA 1MFVA 5HDRA 2PF0A 4YHEA 1E71M 1BAGA 2G3JA 3DYPA 4UQAA 3AIQA 1WCGA 1G0CA 3AS3A 5HOSA 5JIWA 1VIWA 1MYRA 1BG4A 2W92A 2IXUA 4D6FA 2NW0A 3BXWA 4U2ZA 3PZUA 5E6YA 4HOWA 4OUEA 4S3KA 4L4PA 1V6UA 3D3AA 2XVLA 4ACYA 2RGMA 3OA5A 3LRKA 5CSUA 4CU7A 3EDFA 1FP8A 4Z2HA 2PI6A 4LYQA 1DWIM 2XGBA 2CBJA 5JBFA 1CBGA 3ARUA 1NOFA 1ZS2A 3OGSA 4XZBA 2VUYA 1VEMA 3ARQA 1E1EA 3U5YA 1JZ3A 2GJXB 1E3XA 2V38A 3IJ9A 3L2LA 1QNQA 1VBRA 1LL7A 2VZVA 2VOTA 1KXVA 2J8FA 1HVXA 3WH6A 2A3BA 3ZJ8A 4U31A 3DYOA 1W9VA 3FW6A 1E6RA 4N0RA 4ATLA 3VSVA 2OSXA 4K68A 3ARYA 4HA4A 1UR8A 2VRJA 4EE9A 1DWGM 5A8QA 1J0KA 3VIFA 4DM1A 1KTCA 2EJ1A 3A23A 3AXIA 2ZXQA 2IXVA 2WK2A 2XG9A 2VJXA 5E70A 1W91A 1V08A 1ISXA 4U5KA 3DC0A 4M8UA 2NSXA 2W62A 1JZ5A 2EADA 2WLYA 3MUIA 4EANA 3L4VA 1CZ1A 1HVQA 3PZGA 3ALFA 4W8LA 1W9PA 3VGGA 4BCEA 2XYLA 1EA9C 1HJUA 1V03A 3PZ9A 4RE4A 2XIIA 4GO9A 1MQPA 2CPUA 1JL8A 2WWCA 4PBGA 3CUFA 3OLIA 1A47A 2WHLA 3QHNA 5HXMA 1DWFM 4M81A 4YN5A 2WAGA 4HMEA 3W26A 1TVPA 1W1TA 1W3JA 1H11A 4AMCA 4U5IA 5D9PA 3N04A 2WMKA 3GNOA 4CU8A 3D5HA 1PEZA 3VVGA 3K4AA 1IT0A 2XM1A 3VUPA 3IAQA 3RJYA 2MANA 1BLIA 2V3DA 4AC1X 5C70A 5FL0A 3VTRA 4CCDA 2UY5A 4U3AA 2WBKA 2ZUWA 2J7HA 3CZJA 3SCTA
chains in the Genus database with same CATH superfamily
1IM9B 1SXSA 1T1YA 2HWZH 1ZE3H 3OL2A 2ZA1A 4PRBB 4Y90A 2XRAL 1L9PA 2DIAA 4D6EA 5HI4D 2AEPL 2XXMB 1WXZA 2H5UA 1MRDH 2XHYA 1UB6B 2AXFA 2L7QA 5I6XC 1AZUA 2D8KA 4JFOA 3DETC 3ZMEA 1WAPA 3WFBL 1CF8L 3BWAB 5GGRY 2JB6B 2QTEA 3RM9A 3DTXA 4UNIA 5EPDA 3LEXB 2J62A 5FF7A 1HS6A 4G72B 4AQEB 1DVFD 5DUPL 3VXRA 3QO1B 5FWRA 1UD8A 4NENB 2IUZA 2R4RL 2I9EA 2VDKB 1GMIA 3PC0A 4WEUD 4PJAB 3U4AA 4KNSA 5C09D 5JIQA 1ZLWK 4LSRL 1XR9A 2GGIA 4A7GA 3HMXH 1GT8A 4HK5A 3QQ9C 3W1LA 2DQJH 5LKYA 2NY4B 2F5BH 1XYFA 2GCYB 5TFSL 3JWNH 4R85A 1ONWA 3SIKA 3OHXA 1UWAA 3KXQA 2YR1A 3C5ZC 1FYTD 3LS4L 5F70A 2R82A 3RDTC 1O66A 1U93A 4NAJA 5FKAB 1PLAA 4A7SA 3CVIH 1OAJA 2WXOA 4K15A 2CWNA 5HHPB 1LP9B 3EZ4A 4GC3A 4NKIL 3BMXA 4FKEA 4QWWD 4NHCL 5D5MB 3X12B 1JHKH 2E74C 1IV8A 3MJGX 5EBUA 1C12B 1LM1A 2J71A 3OP2A 5DJ6A 4WKHA 2Q9OA 4G9FB 4CUCA 1RJCA 2FB4L 1A25A 1B3WA 4QIUA 4JG0H 3RB5A 3MW7A 3NL2A 2NYYC 5E9DA 2B59B 1UMYA 2REQA 5T1KD 1F6PA 4DHGA 4NBZB 3SDCC 2HH0L 4JRXE 1WS7A 1GYMA 3QEGH 4ML9A 3OKDB 4MAUL 2PCEA 1ZAJA 2VDQL 4KOBA 4RFEA 1MXGA 5DJCA 3DA0A 3GU1A 1XLEA 1WZMA 1S7UB 5J56B 2OFJA 3WIJA 4C1KA 2YBTA 1UQSB 3R7MA 3QGVA 1AUSL 1FH7A 5AHMA 1J18A 1HYRC 4MZ8A 4M6MH 2B39A 3HAEH 3QOMA 4H41A 1SJMA 1GS7A 3I65A 4N90E 2ZOWA 5I8KH 5FYKE 4G6CA 4FA3A 1MWAH 4K3EH 5I19H 1EGVA 4YZWA 3RVTC 5KSBE 5DVPA 4PJHB 5DHVA 4NRSA 2PPAA 2Q76A 2W67A 2XBZA 2FYMA 1E0XA 2EDJA 3DVFA 4WW2F 2ZX8A 4GUHA 3N91A 1NEZA 4M1GL 2VQ1A 1FDZA 2DZXA 3GS7A 5DUBB 2IANE 4JY9A 2X1XR 4XZLX 2OMBA 1L6FA 1XB8A 1LRNA 3RVUC 1X44A 1MRAA 3B1UA 3VPLA 4Q2ZA 4XHQA 4GI6A 1UADC 1AHWA 4N2IA 3QUGA 4OJFH 1ISWA 4C6FA 3IDXH 4MMZB 4AIBA 1AGFB 5LAPA 5CJBA 4I13B 4S1QH 2ADGB 1PD6A 4DP0X 1P4CA 1A9BA 3WTYA 2NNRA 2EH7L 2NCEA 3PB2A 4XT1C 3ESNA 4XP6L 5C0QA 3SRKA 1SUHA 5IBUG 4M93C 4HPYL 1JPHA 2OTPA 2VEKA 2BXYA 4KKLC 3UADA 3UZEA 4WAFA 1H60A 4CNUA 4O4YH 4AHOA 3GU9A 2VFDA 2BNQA 1YY8B 3AY4C 3IFNH 2XGZA 2P5PA 4EN2A 4XX1E 1A0CA 2AQPA 4B3EA 2APTA 3NACH 3V6OA 3JS3A 3C6SA 1TRIA 4DUOA 2P8LA 4QYOB 4Y96A 4HU0A 3AOFA 1LE5A 1YEKL 2N7SA 3BZ4A 3NAAL 2N1TE 3NQEA 4WWKA 5I1CH 2YYTA 4FX8A 1XBVA 3U2JA 2QVTA 4PBWD 3HFFA 1IEAB 2APFA 2VLMD 1T5XB 3FUNA 1YNTF 4F8XA 4IPNB 1EDYA 4DP4X 1MI5B 1OF2A 5A2KH 3LVTA 5B39B 2WTRB 4WEEA 5IT2L 4PUBH 4J2MA 1FKWA 3TTYA 3BQVA 5FM4A 3GDTA 4ETQB 1I85C 3B9OA 4H9XA 3ZLGA 3HB9A 1XC6A 5CIPB 4V27A 4BQ9A 1U21A 1Z9LA 2FL5B 1OSEA 5KSVA 5D1ZI 2DM2A 1QK2A 3ALPA 4FZEH 4ZQKA 2HBXA 5ABDE 2CBMA 3CMOH 2FO1A 4X63A 1U3JA 4HJFA 4GGHA 1HQTA 4ODTH 1FNSL 1HGYA 2CM5A 1NC2D 1D8CA 5C9XA 2BERA 5H2ZA 3STZB 4NQDE 2PLTA 3UPCA 2JGQA 3NCCB 3UJTH 4LIQH 2A6NA 3IMRA 3QMTA 1UZGA 3GZOA 5DMNA 4BFJA 1MRCL 1W2KT 3S6CA 1CFQB 1LORA 1T03L 4IRZL 4A7VA 2AK1L 5EIIA 2GUOB 2ACRA 5MKGA 3BQUD 4KPHL 4AX7A 5CCHE 3UP1A 4YO0B 1VZWA 3C2AL 2G3XA 2IIJA 4PR4A 3BPLB 8PAZA 3B9DA 2UYLB 3VIGA 3K6DA 3HVDA 4ANUA 5AHIA 3H4GA 3VGEA 3D85D 4NO0B 3C9NA 4JR9L 2CRYA 2GSIA 2JF1A 3HTLX 1DBKH 2VXVL 3F7JA 5AKTA 2IEPA 5D1XD 3OWRA 3L7FA 4A22A 1K8ZA 2RDTA 4KXAA 4M8QA 1BA9A 2O9TA 3BIKA 2OJPA 3B05A 4WUKL 4MMYA 4XCEA 1JF6A 4KZDL 4J3VA 4MA7H 4XP4H 1FWBC 1U4FA 5D96B 2JV6A 4LCWA 3DCPA 5I1HH 1QCWA 1C1EH 5EU4B 2A6IB 1PPIA 4FB7A 5AZEH 5FJIA 4M7SA 3PAZA 1MY7A 4AHQA 1Y8BA 1IZJA 2ED9A 3Q13A 4ZK8A 2H7WA 1MJUH 4B9IA 4GPVA 1A6AB 4UQBA 5IFHH 3LYRA 1KXHA 3FFCA 3NUKA 4LCYA 3TGXA 1XF0A 4QRPD 1A65A 1D5MA 4CKVX 3P9LB 3IF1A 1HKJA 5DRNA 2ZP9A 4OECA 3DSFL 1BQLL 2RAMA 5AW7B 3B8SA 4Y5YA 5AHLA 5DYFA 2SEBA 5D8ZA 3LCWA 4D9LL 2YDQA 1BWMA 3HQ1A 2BO0A 1GHRA 2R69H 4AGOA 3S4SB 1QVBA 1HL9A 1CE1H 4H9YA 2UY6B 1DJWA 3WTTA 4P4RB 4XP1L 2PC8A 4HIXL 4L4TB 3FK4A 1MAMH 4P5KA 5IHSA 1WG3A 5DD1L 3UG3A 3PFQA 4C83A 4N85A 3P4NA 4XTDA 3GMNA 3DUSA 2G0KA 4NNXA 3QIWB 4EDXA 2HN7B 1SSDA 4H0LC 4PCPA 1BRLB 4PRHB 3U4EB 3KPLB 2G4EA 3AXLA 1KC7A 4JB9H 3EOBB 4LJ3A 3B8TA 4S3JA 1JERA 1A5AA 2Q7YB 2Z1BA 4X5WA 1N8WA 1I1AC 4PJIA 4AV4A 5ABGA 5IM7B 3JYBA 3OC5A 1IB5A 3P69A 1MFBL 3VFWB 5FW8A 5IK3B 1UJQA 2FJGA 1I1YB 2VLKB 3IDYC 1Z41A 3EX1A 4EZMA 1F02I 1GONA 3IS4A 5DHYA 4YSCA 1IAII 5KTEL 2B4CL 1G1KA 1SHSA 4OU3A 2VVNA 1FWRA 4XPGL 3F4DA 3ARFB 2QTVA 3QWRD 4PJ5B 2K6WA 3R6IA 5JPMC 2VN4A 4OB5L 5L88H 1J86A 3CH1A 3MODL 4PMJA 1D9KD 3SGEI 4UDTA 3NM1A 1QRNB 3ATEA 5XIAA 2Z2UA 1AP2A 3IWVA 3ALXA 1FFOB 4QCIB 5E5RB 5KAQF 5HDBF 2PTTB 4RZ5A 4RNRB 4P3DB 1ZL1A 4F9DA 3HIZA 5G5DA 3L12A 1A14H 4PUUA 4DZBA 2P9RA 1UH3A 1TJPA 4BWWA 3F1QA 1OV8A 4QIRA 2A9ML 2B7NA 5IHUL 3ZT7A 4X9FA 4B5SA 2QIWA 1IXOA 2QHAA 4WF7A 3EGDB 3T0EC 3AICA 1MSSA 1AD9B 4QSHA 1WD9A 1OKEA 1ETZB 3RU6A 4NDMB 1YW1A 3MJ9L 1MCQA 1KFEA 3A67H 2OWCA 3QGAC 1Q7QA 4DYEA 3DOPA 2ZCHL 5EC2A 2J7CA 4MB4A 4MLJA 1PDZA 3WKMH 4HIHA 2YEZA 3DROA 2PBGA 3AIUA 1SW3A 3GMPB 3F4CA 3FQRA 5L9DH 5K9DA 3G6AA 3CDGB 1CR9L 2CLRB 2WZHA 4AKOA 1N8ZB 1JPGA 1RIVL 3IPEA 3FYOA 3MQTA 3W73A 2FIQA 4IUOA 4GPNA 3H2WA 2WVVB 1T21B 1WV2A 2BSEA 5J7CC 2P5NA 1LK2A 3II1A 3SRDA 2B2XL 1YJDH 3NZQA 4MDJA 1CEOA 3AW5A 3CHRA 3Q8EA 5IBUB 3T6QC 3U6WA 4GSQA 4WWID 2O92A 3QRFM 3GSOB 3WGVB 4W9CC 1Z9AA 1QR7A 2VGGA 1MUJB 2YEVB 1GK8A 2COVD 5FUCE 4X2RA 3FQWA 4UU9B 2Q10A 3L81A 3WMBA 1GXEA 5CEYB 3BCJA 4NN5B 1O0VA 4X98B 2FZMA 3FU7B 2D0FA 5HI5D 4X99B 1WBZA 4JZJB 4FIQA 1MQRA 1I2OA 1U8NB 3BRDA 2L7JA 5I0YA 2OTWA 4KMLB 2NY6B 5BRBA 4Q6IB 5HDOA 3HJZA 1TZAA 5KVEE 1U3HB 1I8AA 4WSKA 1HTYA 5DO2D 2I9TB 1VEOA 4ZFOL 1CLZL 5D7LA 5C2GA 1OALA 4Q8PA 4EUPH 4IGBA 4H0GA 3TYBA 3HNTH 4UT9H 4GMEA 2AXGA 3CVCA 3ARGA 3BD3A 4K8RL 2EILB 3ETSA 1VF8A 4S0HA 4WDUA 4HXAL 4U1JB 3QY8A 2OTDA 1OCOB 4LEXH 5F2GA 3CFDB 5GS1C 3IK2A 4JRXA 3CQQA 3K71A 3WSQH 1IBDA 4ELKA 3HZMA 2IWEA 4S2SB 5BJTB 1G1YA 1ONQA 1CI5A 4GE8A 4XOAA 1AR2A 4RGNE 5DJYA 1QWHA 5D72H 3A4WA 2E09A 1OXYA 1NIEA 2CEQA 3HC3H 1JHTA 3FO0L 3KWTA 3UAJC 5BS0E 2E1DA 4R7OA 4MA1B 1BYAA 4G6FB 3O6CA 1QPRA 3KPSE 5M95B 4OI8A 1GUVA 2Z1PA 5KJRH 1EC7A 5C08D 4C47A 4W84A 1EIXA 4ERSH 2ZX5A 3V5HA 3W2NA 4Z77B 4IU3A 4DGIL 1LJYA 2WXKA 2Q2EB 1BFOA 4ZTPL 3TPUB 2FKPA 3DX9A 3ARZA 4LF2A 1U8MB 2XTJC 1B31A 7TIMA 2HJKB 4C91A 2W0FA 2IGFH 2FHCA 3E2HC 5TK4A 3RY6A 1M7PA 3TO2A 4ONGL 3MROA 3PY9A 4GIRA 2O55A 2OZ4L 4OY9A 3OBAA 1R86A 3I84A 3A24A 5T1MB 5LGJB 5TAOA 3WLJA 1NCNA 2AQNA 2G60H 4XAZA 1YEYA 3LNIA 2VD8A 4XXDB 4FYSA 2P53A 2RDWA 2EPKX 1OADA 1TVLA 1OFQA 1AXIB 3GIZL 5D2TA 3I7QA 4PPTA 2DD8H 1TMCB 4GG9A 3AQZA 2J6EA 3TCSA 1KJVA 1CNVA 5T5NF 1O4UA 4IOTA 1KDIA 3SCSA 3QIBB 1JUFB 3KAAA 1ODUA 2LLNA 3BYTA 2VDPL 1Z42A 3L5JA 2P5EE 3FO2B 1UBPC 1E6QM 3VFLA 5I6SA 5I5IA 1LVEA 2WJFA 3MMTA 3MRDA 2QDDA 15C8L 2ZF8A 3UCDA 4KJWC 1YLBB 2I60L 5DZJA 4E0RB 4MY9A 4L1LA 1KLFB 4CVZB 4ACPA 1XF3B 3KBJA 3VFUB 4ZSOE 5HD8D 3G6LA 1J0ZA 3VFSA 5JA9A 2IKHA 2XI9A 5KS9E 2VDLB 3VNMA 4XNDA 5LXGL 3AMCA 4OCYL 3NG5A 4DEFA 6CGTA 3NQVA 4YSEA 2G5BB 2V0TA 1A5CA 4Q58C 4AWUA 3R8QA 3EBVA 5CEZE 3W1PA 5HDBE 3AU6A 3QQXA 4OQVA 3LPFA 5AYYA 1IYXA 1R5IA 3O81A 3T55A 4HGXA 1V79A 2JXMA 1KIUB 3IMBA 1BLNA 3BP4A 4C55A 4PFHA 4WV1A 1KBGH 3ZHFA 5DQDH 1IEBB 4AZCA 3SYOA 1CXLA 2DN7A 1AO7E 3TA3D 3ABRA 2YBRA 4ZFQA 3WF2A 1SLWA 2FBJH 3VYLA 3CFKB 3WUWG 4NQDA 4B5NA 4GT0A 3V5OA 3BSZA 4NZ3A 4Z0SA 5F1NA 1FQ0A 3MJ7A 4JG1H 1ADQA 4JPGA 4JY5L 2GHZA 3E96A 4JTLA 4QGTA 5IDIA 5K1NA 1SFDA 3L4ZA 3KJ6H 4GRMA 3IGUA 4OCSL 3THMH 5CJXC 1L3WA 1BBJA 4LK4A 5HJDA 3RCYA 3MNWA 3QCUH 5KVDL 3VXMB 3WS3B 5IESH 1OE1A 4YJZL 1SY6A 2JJVA 4AKQA 4UM9B 5KZDA 1XCTB 1UWEH 3DBXA 1XR2A 1VENA 3MP5A 3GVWA 4AL8L 1MAJA 5DZ9A 2WSRA 3SECA 2UZXA 2ALDA 2GKIA 1DUZB 5LAXB 4F57H 5MEPB 1VJIA 5E0QA 1T0MA 3UJ2A 1E5AA 3VKAA 2EDDA 1AZCA 4AU0A 4HNVA 4NZJA 3SCMD 2X2YA 3PG8A 1U1HA 3P30L 2Y0FA 2OSLA 3ARXA 3MTXA 1TFHA 4X6CF 1K77A 2J3SA 5CZXD 1MQQA 3W0KA 4RE2A 2DYSB 4UIMA 2NVAA 2C15A 4HLZH 1Q9OA 2R24A 2Y7EA 3LY6A 4DK3A 4AE1A 4G3YL 5CSUA 4F15B 5BVPH 1SZRA 2E1WA 3MRBA 2IBGA 2CLEA 1HCVA 2Q86A 2WXHA 4YHML 4WRLA 3V0SA 3PWIA 1QMLA 2ZVIA 3GWQA 3L2LA 3IFLH 2D03H 2Y07L 3NL6A 4OVVA 4Y2LA 2IOOA 4GUFA 5A8QA 1Z9SA 2BWGA 2DTML 3FFOA 2B8OT 3SOBL 1YN7A 4M8UA 4FL4C 1F6YA 2EADA 2I25N 4LL4A 3EADA 3QPXH 1ASPA 3VXSE 1AGCA 5GGSY 2E5CA 4TSAL 3QW3A 2ZT9C 4RRPM 3T4YB 1CFNA 1P0EA 1P7TA 5B1CA 3N44B 4IF2A 2O4MA 1W1TA 3QCVH 1UFGA 3TN6A 3IRCA 2ZTBA 3KTSA 4TNEA 3UGRA 3V5CA 1DUYA 3CPLB 2C5DC 3X1FA 3QG6B 3LRHA 1EDHA 4XVJH 2AJSL 3W72A 3VUSA 5LGXA 3GSNL 3VU2A 1FVCB 3O8XD 4Z2JA 2WWKT 3DVNA 3I10A 4LW7A 2C9QA 2AZUA 2WO4A 4QFUA 2BM3A 3MT1A 5FAGA 4KK8C 5BV7B 2O6DA 5I1AB 2ZOKB 5CBAA 3R0DA 1DN2A 3RILA 4M8VA 4FAMA 2D0GA 2O7QA 5J57B 2EDTA 2XWEA 2YXGA 1JNEA 2DDQL 2W65B 4UTAL 3B8DA 1L5GA 3U36B 5DXXA 1CWVA 2FEJA 3H53A 1F86A 3QJTB 3NIFF 4WW2A 3TO4C 1ND0A 2GFBA 2XM2A 1XH3B 1RBLA 4HF5H 5JUEL 3C08L 3K6FA 2R4SH 5LN8A 2XN1A 3PBMA 2YN3A 1QOKA 3KHOA 4TVDA 1JGUH 5DD3H 2I07A 2HRLA 3WFZA 3ISIX 2O1AA 2C13A 1LM8V 1I4FB 3TSDA 5CH9A 5EOQH 1HFBA 4ZQTA 1UG9A 1S5IH 7TAAA 1ACZA 4U4BA 5E93A 3TW7A 2VX4A 3UMTA 4YDLB 4E3VA 3PXJA 4ZBCA 3MV11 2PP3A 2OR8A 1OGTB 3HCVA 3UO1H 1I3GL 5T8GA 4KRPD 2QCNA 1E0OB 1NGYB 3N41F 2DZVA 1JGEB 1Q45A 4B9PA 5EWIL 3PUOA 4PMEA 1KV8A 2YMXL 3U0HA 1MPAL 2YCEA 4JREB 1BVKB 4A6YL 3V6FB 5E1QA 3EFFB 2OCJA 1WFIA 3FFDB 3ARWA 3LKNA 3WJSA 2B7OA 5CILH 4KHXH 2YD4A 2D0HA 4OZGB 2JIEA 3UZYA 5FIEA 3ZKMD 3X3GL 2XPGB 4JNZA 4NQSA 4M6OH 1JVKA 4LP8A 1OFRA 4D94A 3U2OA 5HK4A 1IEXA 3R1GH 4NQXB 3NFSL 3MMEB 1W72L 4IPLA 2BP8B 1C08B 1MXSA 1VJSA 1YNTA 1O5RA 3ZKXC 4M1DL 3ISWA 3BL3A 3CSPA 4PWKA 2AV1A 2HQAA 4G6ML 3UYRH 2J75A 2NXGA 1D5IL 3HGJA 3ELQA 5K39B 1R6VA 1RY7B 4PU2A 3V4PA 3I6LD 2ZCKH 4XO6A 3LHPH 2CK2A 2VC2B 1B3IA 1MLBA 1PZ2A 4CN4A 1U8HA 3D0LA 1R3KB 3EBGA 4KRLB 4N42A 2Y7MA 2VABB 4KGLA 5KVGE 3VZZA 2AKRA 4DN4H 4L6OA 1YQVL 3LTVA 2EIZA 4V33A 3L9BA 4LHUA 3PCYA 2HJPA 4K23L 3HGSA 4V11A 3VXRE 3S9ZA 2FTAA 3AU1A 3EGXB 3QH3B 2WZAA 4MCYA 4K3JH 5C6TH 1XRSA 4Z7WF 1M7UA 2J56A 3SE6A 2EPLX 3VDHA 3M0IA 3ABQA 1DFBL 2HE8A 4P23C 5CJOH 3R0NA 4FX6M 5J5RA 5DLMH 4RFNB 2L7EA 3RA7H 2FZ8A 1E8WA 4YDJA 1OQFA 4MTVA 4UYQA 1VLIA 2QR0B 3KOWA 2I7OA 3QPQC 1EEYB 3QJZA 4WFHE 2AI0L 3KNBA 1IIGA 2NLJB 1CFTB 2G4GA 2QKIC 2OX5A 3B2VH 4W9LC 4A6GA 5IMKB 3DRTA 4RV3A 5DJ0A 4HAKA 5A2JH 3VAVA 2FYYB 2D2GA 2QQKH 4GEIA 5FL1A 1CXIA 3MBEB 4WHBA 2LVCA 3ITXA 5M1TA 2BZNA 3K6SB 2VMFA 4LL9A 5D9NA 2Y5QA 4DTGH 3PWLB 3MLXL 3X1GA 1N5YH 2YPLB 5E08H 4ES8A 3SQLA 1S5MA 2ABBA 2FVLA 4EIGB 4NERA 3FAWA 4UDUB 5EU6D 5HBBA 3UA3A 3VIJA 1DIDA 5FF6B 2YPVA 2DKMA 3IDGA 1B5TA 3QS2A 2A9AA 2ZUSA 3QDMD 3PS7A 3D0CA 3SDAB 2FEEL 3IJEB 3EB4A 1REQB 4JHUA 4NUJB 3MDJA 3BLDA 5BS0A 3L17A 1Q9KB 4JM4L 1OCQA 1ES0A 3VZYA 2EVHA 2GI0A 3B2PA 1TJIL 1RSCA 5JHDD 4JX6A 4JN1L 5D7JB 2OXHA 4I18B 2Q71A 3IU4H 5DK2B 4Y4FD 4ODHH 4H44C 4N0FA 3WQ5A 5JBEA 1DBJH 2WMPA 4GSUA 2CO2A 4DW2H 4X9BA 1NOAA 4OLUH 2A38A 5DLLA 4GUJA 3W76A 3HR6A 3VWJA 3FTYA 3RKPA 3FQUA 3EYSH 1WC7A 5HHQB 2FJHB 3AU0A 1EEPA 4KCWA 2L4OA 3ZHNA 4CADA 5JH2A 4N1EA 1HEHC 2EDRA 1LOSA 2M1KA 2ZWNA 3EJJX 4FXGC 3KP1A 1Y7VA 2R8SL 3BUIA 1K4CB 1GC1H 3P77B 4DKEH 2WLJA 3G08A 1ZK9A 5FV1L 4F7TA 2PO6A 3UJIL 4GVGA 1F6LL 1DQXA 2IAMB 3QAZC 3RGBA 3D25A 2B77A 1Q1PA 1XKYA 2P5EA 4WRHA 3JV6A 3MJ8B 1LEGB 4KQ4H 3NL5A 5HHMD 2UWEF 4C6BA 1PE1A 1J05B 1SN0A 4WVXA 2KERA 5BPPA 3SUTA 4D7PA 3PBYA 1IBGL 3VYPA 2EKCA 1YRKA 4RDZA 3WN6A 5AYUH 4ZSOA 4MJ6B 2MNRA 4MDRA 5I18L 4DUXA 5FC9A 3ERPA 3H4WA 4QTFA 1CYGA 3KDOA 5GRUL 1VS1A 3HE6B 4XN1A 1BQGA 2AEWA 3JU2A 2YOCA 2ZWKA 9RUBA 3WD4A 1AZRA 4WKAA 1ZMYA 3IANA 5DI8B 4PJ9C 4KZEL 4B15A 5F89B 3RJOA 1NFDB 5EPMB 5JDJA 3NEVA 2OXGB 3W11C 1OAZL 1SFSA 2DYPB 2GK1B 1MIEH 1KC5H 5EU7E 1IC0A 3FAXA 1AVAA 4XMPH 3CDFA 5JNYB 1E0WA 3TJ4A 4PREA 1RHHA 5K1VA 1I6NA 3ZR6A 3NQ7A 4GSXA 4TOYH 1ZSDB 4YDZA 3AMLA 2HKFL 3DBNA 1J2BA 1SJEA 3KPPA 3CC5A 3V6OE 4K7FB 5AC4A 3GMQB 3FT4A 1HKIA 3RM8A 2NY5H 3QLDA 2IG2H 4E5XA 5BVJA 4OF8A 4HIPA 4JHOA 3U7YH 4O02L 2IAND 3LQGA 3NQDA 1GQLA 1QNSA 4GRLC 3B0XA 4HU4A 2CO4A 5FKYA 1KCBA 4RNHA 2RKXA 4XZ9A 3NIYA 2YDRA 2Q8AL 5BW7C 1UOWA 3WHE0 5DO8A 4LEEA 4OD2A 2AJXH 4JXCA 4UOJA 4H19A 2Z8WC 4C60A 1YE4A 1JFQH 1MNUL 4FTVD 1HINH 4GG6B 1J8HB 1FHDA 4KEMA 1S7QB 3PQYE 1ASQA 3P2VA 3L5XL 4LVGA 4IBWA 4FQHA 1HKMA 3MGAA 5IMMA 5AVXB 5IB1A 3KPMA 4JGDA 4U1SA 3HS8A 3KYNB 4JY6B 4R97B 2V2TB 1ZVNA 4WDIA 1L7TH 5D1ZA 1PKQA 4M56A 4UNUA 1WZ1H 4XQ6A 2AL2B 1T80A 4AH7A 2C9SA 4G8GD 2C1HA 4FQ1L 4KKNA 4U6TA 1AXTH 3K72A 4GAGL 4PWJA 1ZLSL 2CIPA 1XIWA 3FTVA 2IMNA 3UERA 1JNNL 2EGZA 4AGNA 3E6HA 2FNBA 4Z7WE 2ZOUA 3B0VC 3GEFA 4PJGF 3P0WA 4GAFB 4OE7A 2NY1D 3WEBA 1OB1A 4KWWA 4RRPG 4OUOA 1UVQB 1L0PA 4OFQA 3X11A 1LQAA 2X38A 5MEOA 4PYGA 4YHNA 2HT3C 1IAKB 3BT2L 4UT6A 3UAFA 3F7YB 2WUCH 4PGCA 3AXXA 1CC3A 4H5SA 4AXWA 1WGVA 3BX7C 3QHFH 3ULVE 4KRZA 3UYPB 4FPSA 3T08A 3EZJB 1N55A 1HH9B 3QJHA 4LGSB 3FB6A 1HWWA 1E43A 4KKCC 1G0DA 1E9PB 1FH2A 4I5UA 4L9XA 3PBWA 5LIUX 4FF9A 2CKBH 4A2LA 5EBWA 2PYFB 3D69B 4WU5A 3VKJA 2MTPA 1DXFA 3NZGA 1NF7A 1P1ZB 4ECNA 3OF6A 5D9OA 1MVFA 5F88A 2XISA 2QUUA 3ZOAA 1NFIB 5I76A 5TTRA 3G8RA 4M0XA 3K0WA 2Q8XA 5G4HC 5C0CB 3MI6A 1G4MA 3WLWC 3ZS4A 1WBJA 2XWTB 5H37H 3BCFA 4F2UA 3L3OB 4XO9A 5DRWA 3T3PE 4TVPD 2L8AA 4GY0A 1Z9NA 3LLXA 1ZWIB 1A3QA 3APDA 3TWAA 1QI5A 4A7QA 4WU7A 1WDPA 1BGAA 4TQ8A 5MP6H 1EWEA 2Y3AA 5GJSH 5ABHA 1FH9A 1UH4A 1YEWA 2Y1ZA 4FLOA 2EEDA 1IE5A 5B39G 4AYSA 3FJLA 3IXTB 2R94A 1IM3B 3RB7A 5GZNC 3TBYB 1RZJC 2PDFA 1F5WA 3MANA 1W16A 3UDWC 3UGUA 2CHWA 1LO5A 4LVNB 3RWDB 3GXIA 1GVFA 4TNVF 3DX2A 1NJ9B 1TO5A 2NLYA 3WEOA 4C6PA 4Q8UA 3OJ2C 5H35B 4U1LB 1KGCE 2ENQA 2JKXA 4WUUB 1Z8AA 4HHAB 4NPYB 2FLIA 5D70H 1H6FA 1SM3H 2CLHA 3WD2A 3BGAA 1A4JB 1XGPA 2D69A 4DNHA 5FCUH 3IRPX 1CK0H 2UWEE 1MW2A 4O18A 4E2VA 4TTGA 4DPQA 3B4YA 4HGWB 3GSQB 1KB9J 4NZUL 2IH3B 2XZAL 1PLGL 3HLAA 2JEQA 4LY8A 4Y2DC 5EU9A 2FPYA 1T6WA 5IB3A 4Q52A 3MTRA 4N24A 4LRNH 3LG3A 4L4VB 4RNIA 2VDMH 5HYJE 4Y5VC 3G77A 2VX7A 4GX8A 3O3EA 4F8TA 2W79A 1V7YA 4LLYB 3FONA 2VAAB 4GYJA 5A6BD 3AREB 4OI9A 3LEPA 3DMMC 3MRPA 4XRCA 4AQ8A 3PWVB 4ZZ9A 3EYVB 1PF3A 1LMKA 3C0LA 3PVFA 2XNAB 3P0VH 1P6WA 1X4YA 4Q8WA 1V5XA 3URQA 4WJG3 2XV6B 1PTGA 2WXJA 3TOPA 4B4HA 2R1WB 1HCYA 4J35A 2VXQA 4J2PA 1HQ4A 1C16B 1B4RA 4OLVH 1A21A 4K3DL 3TBVB 4TUOB 3F83A 3A3YB 3RKDD 2ZSVB 2YAOA 1O7VA 1ZBCA 1MKFA 1YNQA 3X1NA 1BXXA 1ZANH 2WANA 4KTEL 1EQCA 4IS6A 1G67A 3WIHA 1U91B 1D7BA 3G6DH 3H9SD 3LBMA 2WSPA 4P2QE 1OQOA 4BK9A 3ZJ6A 1KFAL 3TOYA 1A5BA 2OLAA 4AMAA 3S4SG 5FWQA 2A3LA 1MVUA 3W74A 2JMRA 5JQIB 4P2OC 4M7LL 3U1SL 2F7RA 2AP2A 3M0YA 2QZ5A 2CJTA 3SR7A 3WH8A 4QDPA 5C8JB 4ZTOH 2DWXA 1UC6A 4PTUB 4F66A 3C09C 3LS5H 2LOEA 3ZL2A 2OKTA 3GPSA 4D6HA 4DZ8A 3PZVA 3G5ZB 1K3ZA 3POCA 1B0GA 2EUZA 4X6CA 1AYRA 6PCYA 4MY8A 2P28B 2ALRA 3DHMA 1Z44A 1X7QA 4ZL1A 1FZMA 2VI0A 5E6IB 1KCZA 5EC1B 3D2UA 4JX0A 3BI9X 2X1PA 3IJHB 2ABAA 1MCSA 1I8LA 5D7LE 4R9XA 4L8CA 4R7NA 1JULA 4LRTA 1YPZB 1YPXA 1GA2A 3UTQA 4LO9A 3O6LL 4PUJA 3B2DC 2XRAH 2XH7A 2DH2A 3NFNB 2BVUA 4N8UA 4AHPA 3KYOB 5GPRA 2DSKA 2AEPH 5BQ7A 3ETTA 3H70A 3FBQA 1QLFA 4GISA 4L2YA 1PZAA 2MRYA 1NDVA 3FTXA 2RFXB 5F8QC 5K9KA 3WFBH 1CF8H 3LKQB 4P46A 2NV9A 4HUCA 5DUPH 3GBLA 1IL1B 3LTPA 3SN4A 3EH1A 1PE31 2R4RH 3HG4A 3KVDD 3QUXC 4JIRA 3MO1A 3VXUE 3S2MA 3TA4D 2YL6A 1JNHB 4YYCA 4MNHA 2DEXX 3P67A 5E4EC 5IV2A 1QDSA 4FS0A 4FX5A 4KCVA 1IEHA 1JPKA 4LSRH 5EOTA 5J3HD 1WDAA 3LI1A 2VMCA 2OCCB 1VLWA 1ZCCA 3LHUA 3GC2A 1PKMA 4G7EA 1URLA 1FFRA 4I0CC 3M0JA 4BZ2L 2R7EB 5TFSH 3KFTA 3GS0A 4DPPA 4UBDC 4TUKL 3MRFA 3W6LA 2DFAA 4N2CA 4FLQA 3LS4H 1G7JA 1HOEA 1RJQA 4HSAC 1P4UA 3KLLA 1K6AA 3DX8B 1ZFJA 3WFLA 4RIRA 3VE9A 3BP5B 3OO2A 2BVQB 1AXSA 1HHHA 1DVUA 4PSRA 4NKIH 5FI8A 3UBXI 2E3VA 4NHCH 2B31A 4MMXC 5F44A 3VWKD 4JO1L 4B5EA 1KFGA 3JUZA 5CD5D 5FYJD 1WBHA 1CB4A 3QDHA 3FF8A 4GINA 4OZOA 3UF9A 4KKQA 5GRXG 3BPWA 2FB4H 5F7FA 4PRNB 3H6OA 1I8UA 3NRQA 4FA8A 4M7KL 2H6RA 2Z6FA 1MHHB 4X0KA 3GTNA 2YOAA 4QRTB 3C5SA 1WAWA 2HH0H 2R2EB 2X5PA 3KPSD 3PY2A 2RH0A 3SQSA 1E4HA 3FOLA 1UGKA 4X8GA 1HNGA 4AX3A 5ID1B 1P9MC 4AIZA 4NAEA 5CCGE 4P2RB 2PDNA 4MAUH 1OPGL 2VDQH 2AQRA 1E28B 1AMXA 3VXOB 1MFVA 4EI5B 1U4EA 3G1SA 4BZ1L 5HOSA 2HG5A 4RZCA 3B1TA 3TWBA 4WX2A 3PZUA 2YSTA 3ECWA 5E8PA 5IKCA 2RGMA 2CCLA 1VACA 3RG6A 2PETA 4A2SA 3REWB 4BWUA 5JBFA 3V0WL 4ZXBC 1CBGA 1AGBB 3GIYA 3O6FC 3WJWA 2Z91B 1HG3A 2YPIA 1HOCA 4HA4A 1TTBA 4LOFA 4M1GH 1NPUA 3BWUC 2AAVA 4XP5L 1NC4A 2ZP8A 4GAYB 3II2A 3L95B 4BXVA 4C65A 1HJUA 3PQYA 5F7DB 2PDGA 4QTHA 3B9KD 4IMLB 4AVIA 3OLIA 3TFCA 2WHLA 4IX2A 2GGEA 3MGTA 3W87A 2WQVA 2WMKA 1OC5A 3MX0B 4FE9A 3MVIA 5EGRA 2FMOA 3GJFB 2Y61A 4U3AA 1IAOA 1A5FL 3G1XA 1TZIB 4MWAE 2EH7H 3LGDA 2Q8LA 4IIQB 4XP6H 3W25A 4PY7A 4LLQB 4OQTA 4YFLI 4I3SL 4Y2OB 1T66C 3WDIA 1ZP4A 4HPYH 1JPMA 4LCRA 4J3XA 5H1WA 3UWVA 1BZ7A 2YFOA 1ZIAA 1CTNA 1DQDL 3GDBA 2NNXA 4Z7WA 1XAKA 2F19L 1ITCA 4L9ZA 2P5WD 2C79A 1F11B 2W0LA 3QPKA 3QXAB 4AW4A 1N3NA 1XQKA 3F4VA 1YEKH 3KLSA 3W70A 3QYCA 1I2NA 1I7UB 3NAAH 2X41A 1A4AA 3VD7A 3KCJA 2MQCA 2Y6SD 3SAZA 5F7LB 2PWEA 1WSST 5F1VA 2ZG2A 3E8VA 2EG6A 5IT2H 4JFWA 4G9DA 3KXFD 2VTFA 3I7SA 1TMLA 1F8IA 2R0KL 1WDRA 2NY4C 5DT1L 2XWJA 3OGVA 3CVDA 4HHWA 5A8GA 2HPTA 3GDLA 2PRMA 2NNCA 4XPHL 1J8SA 3OAZH 3AT8A 3D18A 3CIAA 4MQ7B 2EDKA 4D8PB 1FNSH 4FYTA 4M3PA 2SODB 2ZWSA 3SGUA 1ONXA 2OYKA 5BOOA 4GW1A 1CL7L 2VUOA 4WIWA 4XOCA 1HYSC 5IB4B 4HXBL 1OSPL 1RZIB 3T0XA 3QPEA 1KIQA 3QDGA 1WWWX 1MRCH 2ZUNA 1HE8A 2KT6A 1NAKL 4FMKA 3WUZA 1T03H 3S1WA 2YQGA 4O57A 4IRZH 1BWWA 2AK1H 2JIWA 3I6KA 1R5VA 2X10A 3UVAA 4KPHH 4UQ2B 2F6UA 1YUHA 1OEPA 3BGMA 1HKKA 3C2AH 4KNTA 2R1MA 3QEHA 4JFFB 1FZJA 1MDTA 2GSGA 1DJYA 4JIQA 3FZUC 4JLRA 4JR9H 4U1HA 1A3ZA 2V8LA 2DUAA 1H6TA 3EO1B 2V3GA 2VXVH 5E6UB 2EDFA 1KM5A 4DLMA 3H0TB 3O0LA 1ASOA 3T40A 4ALDA 3VFTB 4WUKH 3WQWA 4LSVL 3ULUC 2J78A 4KZDH 2PUZA 5EU3A 1M7IB 4O11A 1HHGA 4MNJA 4ELMF 1RP8A 5DMKB 1QFHA 1C5CL 1XIMA 1UXSB 4M7JL 1U3ZA 1XB3A 2JLLA 2BSSA 4XWOD 3CUPB 3HVNA 3B34A 2UWEA 4WCYH 4IRSD 3ZUCA 3LGEA 3KL3A 4AT6B 4HW6A 5CBIA 1JWMA 4JN6A 3DV6A 4OSUL 2P8PB 3DSFH 1TTJA 1BQLH 3QUHA 3N6JA 1Y07A 4JFQB 3W2KA 5TQ2L 1RK0B 4PRAA 2WQAA 5EO0B 4X4YA 2B9BA 3ILQD 4EACA 1I3RA 4D9LH 1LUCB 4O17A 3ZE2B 5HYJA 4FJYA 3TL5A 3W83A 1XH2A 4O52A 3TCLB 3L2IA 5JXEC 3BDYL 1XGRA 4A05A 4XP1H 4J3BA 4HIXH 1E5NA 3LIZL 3PPHA 5DD1H 4GNVA 4OJCA 5C2BL 2I26N 3GLCA 5J6HA 3TVMD 4N02A 4Y4KA 4DO6A 4YNGA 1U33A 1FBAA 3M6DA 5K69A 4B0MB 3IGAB 2P45B 3IDNA 4Y6GA 4DBEA 2YRBA 3PXLA 4ZX6A 4Y16B 1SR9A 1ZT1A 2DIKA 3GUFA 2ANUA 1MFUA 3RNKB 2CR3A 4F3HA 2XPYA 1L3NA 3SN1A 4NLHA 4FGMA 4RW5A 3UCRA 4HC1A 4QHKJ 3T8LA 1ITBB 4HUUA 2GJ6E 1UP0A 5I15L 4MJID 3O45B 3MSRA 3WYZA 7ODCA 3D52A 3NSDA 5C7XL 4WKXA 1MFBH 4HEME 3ILDA 1BMWA 1H61A 2J9XA 4PE8A 1K9FA 1KFKA 1MNSA 4AF0A 2K1MA 5DF0A 4MKVA 2NXHA 2R2CA 5KTEH 2B4CH 4IKJA 2QCFA 2OQJB 4XPGH 3H1ZA 4CQCA 4LLDB 2GL5A 4P2QA 3APFA 4DJFA 5ITFB 1U2HA 3Q37A 1KRAC 4OB5H 2X8RA 1P7KB 3U2ZA 3IGXA 3AO0A 3MODH 1FAIL 5CG7A 1XGYL 5DTFA 4WJEA 3V35A 1CU4L 3UPWA 1T96A 2J74A 1RXOB 4HIJB 4AY8A 2IWFA 5FM5O 4IICA 2V9UA 3SKUD 3SCOA 1FL5A 4MPQA 1QA9B 2W07A 2DMHA 3RDKA 4Y9BA 1QBLL 3N2BA 4E8GA 1SDAB 2KPWA 3HC0B 4HCDA 3E9UA 4O2FA 5KG9A 2MMXA 2ALAA 2A9MH 5IHUH 1PY0A 3S1XA 2IGLA 3K7UA 3VTMA 3D0AA 2V5BA 2O6FA 1XZ0A 4M6QA 1GZHA 3V6ZA 4TQTA 2YDSA 5HY9B 4V1YA 1L6PA 2QQNL 3BURA 3L21A 2UXFA 4O1FA 2AK4D 2ZCHH 2GY5A 5CMAB 1FWNA 5EHFA 4YFLF 4HWBL 2AVFA 4P5SA 3S5OA 3MGOA 4PJGA 2YD1A 1MFEL 4ZQCA 2YGOA 3A3WA 3BPLC 2X9YA 3PWNB 4UQ3A 3MV9E 1CR9H 4X42A 1UR1A 2VFFA 3OXRA 5H2BA 3LERA 3CM4A 1RIVH 4A4AA 2DI8A 3KPTA 2CGRL 1RY8A 1W1YA 3G22A 3VXUA 1LWIA 2IH1A 4W9JC 5FUOL 4PTDA 4PS8A 2B2XH 2OL3L 1ZSHA 1P5UB 1KRCC 2R2BA 5D96C 4KK9D 2NY0D 1PL3A 4GC4A 4UT7L 3MXWL 3B43A 1VFLA 2D9QB 2G9HB 4YH6A 4PFEA 3UXIA 2GQ9A 1NWOA 2PDPA 1YMHA 3FB8B 3P0YH 2WD0A 3NOIA 3EFOA 2Z7WA 2NTSP 4QAMB 4XTIA 3NO5A 3FO9A 1S5NA 1OTUC 3FT3B 2E0PA 2VR7A 4C57C 1QPQA 2Y88A 2AMGA 5GGRB 1CLZH 2VLJB 4YK4B 1PZ3A 4EN3C 1DHKA 3MUAA 5LHEA 2CBOA 4WW1A 2FECI 4PH8A 1PTZA 2V8ZA 4J1OA 2XGIA 5F2MA 3M1BB 4R0LA 4AEOA 5CJ8A 2AV7B 4K8RH 1TVNA 2JFCA 2GSJA 5DLCA 4HXAH 4YQXL 3NFPB 5GGTL 3PDOA 1Z0NA 2X30A 1TV4A 4ALAC 3SKMB 1OSZA 4MAYA 4U3SA 3VTAA 4UTHA 5E9DD 1TVBB 3AB0B 1S9VA 5F7MC 4NQCA 1S9WA 4FZ8L 3KTXA 3S5YA 3X1BA 4JAWA 1NSNL 2OTUB 3UY8A 1KQYA 1GSMA 3PUGA 1ZCOA 4OFYD 2H2SD 3NCFB 4BK8A 1TMHA 3OTRA 5DD0L 1YXCA 3FO0H 3NQ8A 3FU5A 3IMTA 3KPNB 3L5WA 2CXGA 3S3BB 3SGKC 3CUZA 5KYYA 1IJNA 2P0OA 2EXTA 1AOZA 1N2RA 3N1QC 5CUSL 2E9MA 4BEIA 3ARFC 4LRSA 3DO7B 3S3CB 5AVVB 4DGIH 1N6VA 2AW2A 1NCGA 1QSEE 5FA3B 4K2UL 2GJJA 1M9WA 1M6UA 5SX5H 2VXTL 5F9WB 1US0A 4HIEB 1FG9C 4ZTPH 5HJXA 1TZGL 3G1RA 1URZA 3CFIC 2L04A 3QUKA 1G7LB 2FCBA 3RFZB 3QLLA 2NZLA 4ONGH 2XWZA 2OZ4H 4OZIB 4IU2B 4IJ3B 3C60A 4TM9A 5FDWA 3VC5A 2NDFA 3MRHA 4EZLA 1U3YA 3AZUA 5D6CA 1VRXA 3R8BB 4D9QD 4AGLA 3H54A 2ED8A 3BJLA 3GIZH 2DQWA 4TX8A 5D7SL 3OG6B 4M1BA 2ATAA 4YC2B 5T9BG 2I24N 1IR1A 3S1GA 1RJLA 1RZKC 1UFUA 1PL9A 5MHSE 1DVFB 1M1XA 1EGMA 4MWAA 5U7SA 3ZPDA 3LDBB 3CLWA 2VDPH 3N3TA 3GC5A 1Q0YL 5B3JF 4YMZA 3H9HB 4S39A 5C09B 4WFFE 3TIEB 4N7QA 2VLLB 4ZO9A 4NYUA 4AQAA 2ZUYA 5AW1B 15C8H 3V0VA 2ATKA 3KRUA 3U0TA 2PCPB 3QPYA 1SUJA 1KWGA 2I60H 1RI8A 4DN1A 2E28A 2WBJA 2VDOL 4OZ4A 1JOIA 3C8KA 1FYTB 3SKNA 1CIDA 3E0FA 3B8IA 2P8MB 4PVNA 2GTZA 4LGXA 2BNQD 3PYCA 1ZBWA 5LXGH 4OCYH 1SJBA 3W84A 4PBXA 1PKQE 4LQ1A 1JCTA 4R83A 5E9NA 4QF1B 5FO2A 3H2EA 1E27A 3QJFB 4WWKD 3FNKA 3GS4A 5HYFA 1W6TA 1D6VL 1Q6FA 1CDYA 1TTGA 3DJSA 1G9ML 3BISA 2VIRA 1XSIA 1EZLA 1AJZA 1Z3RA 3FCTB 2W5FA 1T8XA 3SGDH 1QUNA 3WE1A 5HYEA 5EV7A 5T1KB 4JZJC 1FL6B 3TEZA 1OF6A 1ORQA 2AMXA 3Q2NA 2V5KA 2NY6C 4Q6IC 1HJSA 4NOFA 1U3HC 4JY5H 3K3QA 4QT5A 5DQ9B 1FO0A 3EKGA 1BIIB 4FP8L 3LQAC 3LDVA 3LZPA 3QC6X 4UUJB 4DP7X 4AQ1C 5KVFL 1PYWA 12E8L 3IJ8A 4OCSH 2YC1B 3U6XA 2WXPA 2DQEL 4PGDB 5KVDH 2V4LA 5DZLA 2N3JA 2G2NA 2Q3ZA 4GZIA 4HJUA 1Z6KA 1XCQB 1OOWA 3P3UA 3HO8A 1C92A 4AKPA 1KF9B 4N8VA 2DT2A 1DJIA 2E56A 3KCPB 4WTZG 4AL8H 1P5VA 2J20A 2H3NB 3C5JA 3ENLA 5IJBC 3WK0A 3MWAA 3QY7A 4FXLA 1QI4A 1XCXA 2ZCZA 1NAML 2DWTA 4X9SA 2EJAA 3PHQA 3P2BA 2HKHL 4U6YB 1IMHC 2YCIX 5GSVA 3P30H 2XQBL 1J7VR 4W7WA 4OCMC 2J77A 5KBDA 4PLJC 1VFUA 2WJEA 1U8KA 2OXNA 2OR9L 2DSUA 1VFFA 3KBPA 4RMBA 4MA1C 3DV4B 2HWGA 4QTGA 4YSRA 2XSBA 4LCWD 3FB7B 3FHQA 4N87A 4G3YH 1ECZA 2WQ8A 3WY3A 5EF3A 4IKIA 4LASL 3QBTB 4PP1D 1HKLL 5I06A 1MWOA 3F7VB 3CL8A 4YHMH 5DK0A 3FFCD 2FEDD 3S5NA 5DHMC 2Y07H 2ACQA 3K30A 1V7AA 4YL4A 4F93B 1BECA 1ZHLA 4IP5A 4LTSA 2X2HA 2QDWA 2DTMH 1TREA 1A4KA 1MREL 3SOBH 3NPWA 2Q2LA 4KJPC 3F00A 2KLRA 3NQGA 3VCRA 3D33A 4NIYE 1SHWA 4TSAH 1KEGL 1SQMA 7PTDA 2IWKA 3JTTA 4NIRA 2DOCA 3NA9L 1AG0A 5D38A 3DXAD 2ERJB 3WKPA 3TYUA 4ABVA 3QIBC 1TWWA 3KP0A 2NT1A 3H7VA 3OLEA 3RWEA 4G80B 5DSCA 2ADAA 1MJ7L 5F3BA 4ZOAA 4HHLA 4BHUI 2G3IA 2AJSH 2HFEB 1ZTXL 1AMKA 4KKXA 2GJ6A 3GSNH 1KXVC 1G7PA 3N4EA 7A3HA 3W1UA 1BAFL 1QW7A 1EERB 3BJTA 3L3HB 3TZVA 3DGDA 4HEMA 3LKOB 5I75B 3L5AA 4NNBA 1UM5L 4U0QB 1A50A 5C9JB 4LX4A 1RD5A 1N5AB 2J1YA 1N0LB 1JUBA 2OWWA 2DMBA 3QR2A 4AG4L 3ZW3A 3FKRA 5ERWA 2EDMA 5DVMA 3PV6A 1NC2B 1UB5B 5JW4N 4J4PA 5AB0A 2DDQH 4UTAH 1IEVA 1R87A 3RWHB 3PULA 5ISZE 1BPLB 3FUJA 1OP5H 5HGBA 3MUGB 4WWNA 2VITA 4B50A 4HKXA 1CFSB 5JUEH 4NN7B 3MNVA 3C08H 2QJJA 1BZDA 5I23A 2YL8A 2EDLA 4R3SA 4ZQMA 2BPBA 1FNAA 3IJIA 2GK0A 3BQUB 2OB3A 2BXZA 4MG4A 1BYDA 8XIAA 1KPRA 1RULL 4QJ5B 1X97A 4A29A 5FO7B 3ET9F 1C9SA 1I3GH 4F5CE 1BXCA 3IVKB 4OOUA 3D85B 4X4XA 2YB4A 5EWIH 3ECBB 2YMXH 1MPAH 4Y19A 5D1XB 4A6YH 2CKSA 1A3RL 3PABA 1ZLUH 1TVDA 3LKPB 1T3FB 2J7GA 3K6NA 4JRFA 3WQCA 1D7CA 3QQ3A 4I5RA 1INQA 4YTQA 1JVOA 3CZLA 4Q7NA 2GVJA 1H3PL 2F1BA 5M94B 3X3GH 2J1KA 1TCRB 1SR0A 4OFDA 2HS8A 3ECQA 3MV9A 4DVRL 3OKEB 4KXCA 3ASOB 2OX4A 2W0KA 3NFSH 3VGAC 1W72H 3MFFB 4UNTA 2HVJA 3MPCA 1E6ZA 4FQQA 4BKSC 4X6CE 4H01A 1L6GA 3SQMA 5JXQA 3F62A 4P3WA 5ESVB 4QRPB 3CLEL 4M1DH 3HJ0A 1I82A 3I4KA 1I9RL 3LV3A 2DQ6A 4G6MH 3VQ2C 5D2NC 2P80A 4E4UA 1OCBA 3FDWA 2X0UA 1XGUA 1D5IH 1EBPA 2R15A 2HROA 3IDJA 1A9EB 2IALA 3FXYA 1JYVA 2BSED 3Q9PA 3CPUA 4ADTA 1PX8A 3ZTJH 3ZLQC 5J06A 2XY2A 3IN2A 2Z4QA 5AHFA 1ZXQA 3AIQA 5CINL 2HLFC 1YEIL 2IXUA 4M7LT 1NUFA 1B4LA 4F15C 1FNFA 2MKWA 2V6HA 1YQVH 3C86A 4NHUA 5ANHA 3E0WA 4Y9PA 4K23H 2C7UB 3VJ6A 5CHNA 1V77A 4TNWF 4KO9A 5C0JA 3MNZB 2R1LA 4MZYA 3PAJA 4PIRF 2J8FA 3MDUA 2EYTA 3FF7A 1DFBH 4YEFA 1KLGA 4U31A 3H3KA 1W9VA 4RVBA 4HYRA 4LE8A 1U8OA 3CAFA 1ZGDA 3HC4L 1H0DB 1I8JA 4UTIA 3CH0A 1EUTA 2AI0H 2PR9A 1BJMA 4NJAL 3VFMB 5AG8A 3S2NA 5TDOB 5D7LD 3FB5B 4WHYG 2DICA 3PZ9A 5FJJA 1SQ2N 2YCLA 5DXWA 3MLXH 4BWLA 4HDIA 3UXLA 4CU8A 1U8LB 3KH3A 2ZUXA 4JZOB 8FABA 2XM1A 5HNUA 3H2OA 3QHTC 4PCFA 2Y1HA 3CZJA 2PYEE 1Y6NR 1S7XA 2GGJA 4ELMA 3RWFA 3PLYA 4JRXD 3STLA 1OE2A 5CP3H 3NJIA 3FTWA 4QOKA 5C54A 3R79A 5BV7C 4NP7A 4JM4H 1L6XA 4YNYB 3NIFE 4B0MM 2Y6ZA 5SV4A 5KN5A 1TJIH 1FCUA 2M8XA 4JN1H 2DYRB 3B2UD 5F7HA 3MMDA 1JEZA 2E7HA 5HYQA 4D0BA 1J79A 4HHPA 1QSEA 3GLZA 1CENA 5T3ZE 5ENWA 2JK5B 2B1OA 1UHVA 3B9EA 4A8LA 3UBXA 1TA3A 1LDSA 4ZMWA 1PZ1A 4I6VA 4TS6A 2QF8A 3AIVA 4N90D 5FYKD 1T22A 5IEHA 2FBRA 5LIXX 1FFQA 2PW1A 2CZFA 4P2VA 1D2PA 1KM6A 3W23A 1SMOA 3IETB 5IQMA 2X6CA 4EP8C 3VFPA 4RWYL 1QW8A 3LTYA 1QLRA 5EEYA 3MV7E 3MPGA 3TIDA 3UABA 3WTWA 3BUYA 3FU8A 4YDLC 2HX7A 3GGWA 4ZUWA 4MNMA 1SYVA 3KLQA 2C9PA 3VM5A 4LAMA 4E6MA 2R8SH 2ZP0T 2KLSA 4FSAA 1ZT7B 1V6XA 3N6QA 4W1TA 4JREC 1YDYA 3KUMA 3C2EA 2TODA 3UJIH 4WGXA 4XUYA 3PTQA 2RJHA 3HI1A 3MRKA 5F3HB 2J66A 2Y7FA 4KCUA 2R0LL 1DJNA 1O1ZA 5KSAA 4KY2A 5GGUB 2LU5A 3K13A 4Z7VB 1ICQA 3O0RL 4X6FA 2V7NA 1IBGH 4L29B 4HFWA 3TBSB 3USZA 5DRCA 1GOFA 1GVSA 3NYDA 2MPVA 1CICA 4J1UB 3M7WA 5CSZA 1VKFA 2ADIB 1RMFL 2OZ8A 5I18H 4D9RE 5K59F 1XXXA 4V1DE 5GRUH 4LYKA 5E5MB 2QCHA 3E2RA 1V8EA 1UENA 2WPGA 1LO2L 4KZEH 1CDHA 5TDNA 1OAZH 3H8NA 2NDGA 4XMUA 2HJLB 5HATA 1SZNA 1VSCA 3N9GL 1JUKA 4CDHA 1OCZB 1Q66A 3MRJB 2IAAC 5E94B 3U6RB 2HKFH 3V4BA 4IEFA 5F2IA 2HRGA 4RA3A 3T65A 2GW5A 1UT2A 4JQ3A 5KSUA 5I3HA 5ABFB 5DZAA 4L37A 4U3HA 5SWQA 4OFVA 4PB9L 1H15B 1TZ9A 4L23A 3GBEA 3FC8A 1E6NA 1CN4A 3FQTB 4O02H 2P3ZA 5FEWA 4M43L 2JFEX 5D03A 4AQZA 1PWMA 4NQDD 2HE5A 4RFNC 3LXCA 3FSWA 2Q8AH 1SF3A 1GCYA 2DQCL 4AZ5A 4P2AA 5DU7A 1U5VA 2A6KA 4J3OH 4PMVA 5IEKB 2X53A 1W5NA 1MG2C 2C9UA 3HMWL 3E3QE 2IOMA 5BOJA 3CS2A 3WIFA 3MBEC 1MNUH 2P7TB 4ZAKA 4I0KA 5CLZA 5C08B 1KYOK 2Y7OA 3WY1A 4BH8B 1PKYA 2FWSA 4W8AA 4B53A 1F4XL 4JQXC 3WQEA 3CE1A 3THDA 3L5XH 2F6AA 1QFWL 1WHPA 1KB3A 2RGSA 2Y9RT 2ESVA 3P14A 1IEIA 3LA4A 4XBPB 3SZKC 3QDGE 2ZA2A 4M00A 3SKOB 3SDAC 3LPPA 1D7KA 2Z7GA 2XWDA 4IPPA 2ARJB 4RQQB 4FQ1H 4XE5B 4TL5A 3OR6A 3HMCA 4UTBA 1H5YA 2XN9E 2C3VA 5D9SB 4GAGH 2P24A 1ZLSH 4QRBA 5D7JC 2DVUA 4I18C 3CLMA 3RXZA 2EE3A 2YQ2A 5CPNA 4O8AA 1AFVL 4OJDH 1RLWA 2XZZA 2X0YA 3PNZA 3E5BA 4AENA 1OP3H 5DMIL 1S9XA 1SYSA 4LSUL 3R11A 4A55A 2XFXA 5CM1A 4AY1A 2QELA 3EBIA 4LAUA 1PSKL 1VPYA 1LNUB 3WJJA 1NVMA 4HSOA 2F74B 1U5HA 5C0IB 2XACC 5C86A 2ZTJA 3OGCB 1TWDA 3BT2H 1OQXA 4X22A 1OABA 1S5HB 1PG7W 1R0MA 5ICXB 3TJPA 2Q1EA 5FUZL 4W9EC 4AYGA 3Q3GA 1E6SM 1B9BA 1GJIA 3P0GB 3D30A 2CHDA 1UWXH 3VH8A 4JQIL 3N1PC 4NSKA 4I7ZC 2B5IB 2IAMC 1LEIB 1EIBA 4PTMA 3OKNA 4GACA 5C0AA 2QW5A