3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
2CPUA 2WMGA 2ZOXA 1W9VA 3FW6A 5A94A 3PZ9A 1MW1A 2YBTA 1TVNA 2CIPA 1RPKA 2Y8VA 3D5HA 4MNLA 3I3EA 1CBGA 4W5UA 3CMGA 3GNRA 3CZKA 2FHCA 2WVVB 1WDSA 1QPKA 4P8VA 4D6CA 1KQYA 1R7OA 2EACA 2CKSA 3CUFA 2BS9A 5EFFA 3AISA 2WVSA 1HVQA 4B16A 2EXOA 4UOZA 4OBSA 3BMVA 1H0GA 4NZJA 4TTUA 4TOQA 2VRQA 1UWQA 1QNOA 1UQZA 1RP8A 1SR0A 1K9EA 6CGTA 1E3XA 4R5EA 1MQRA 5JIPA 1CGYA 1Q6FA 4BZYA 2UY4A 1J9YA 4FNUA 2OYKA 1BF2A 3BVUA 3GXMA 1PEZA 3IJ7A 1G01A 5CPQA 2YFNA 3WF1A 1GHSA 1QI4A 3POHA 4J3SA 3GXIA 3AZSA 4P7OA 2GSJA 1CXHA 2ZUUA 2V3DA 1V3KA 1X1NA 3WD4A 1M04A 3RPMA 3WDPP 4GXPA 2E8YA 1KFWA 5AY7A 1ISWA 5CXPA 3QHOA 1E0XA 3EJSA 3NIYA 1AMYA 3ZO9A 3BUBA 4GQQA 2Z1SA 2JE8A 1PZ3A 3AIEA 4KGLA 4GKLA 4A3HA 1WP6A 1TVPA 1JGIA 2Y8KA 3NCOA 3ECQA 1V6XA 2BFGA 2WHKA 2CNCA 5E70A 1XH0A 2ESCA 2XFRA 3J7HA 3L2LA 3UR7A 1QW8A 1BPLB 1JZ8A 3W6LA 1KGUA 5DT5A 1X6LA 1W9XA 1U33A 1JI2A 3WF3A 4AZHA 2X2YA 2J7BA 3AXXA 3MUZ1 3A5VA 2QV4A 3ZSSA 1BQCA 7CGTA 1V3JA 4EKJA 1GQKA 2Y5EA 5I77A 1HX0A 5BRQA 4DWSD 1JYVA 3DECA 2CHNA 4L4PA 4PMUA 1VFUA 2WXDM 3F5JA 1IV8A 1JZ3A 4W5ZA 5E6ZA 1HKJA 2VX6A 5A6KA 3GXPA 3ARWA 2VOTA 2W66A 1GW1A 1BYDA 5IFPA 1CIUA 1GHRA 3MUAA 3ZJ6A 3KL0A 1QHZA 1J12A 2YDSA 2V5CA 2JF6A 1LJYA 5GNXA 1GVYA 1JZ5A 4C7GA 4CU7A 2WHJA 1J18A 1FP8A 2WCAA 2GJRA 3M46A 2DSVA 2PWFA 1WPCA 3AZRA 3EDEA 4AD1A 1OWQA 4F79A 4CN1A 2O92A 4HP5A 3D4YA 3VIIA 2E9BA 2VL4A 3AHZA 2ZX8A 1V6VA 3CPUA 1BYAA 1JG9A 4FLQA 2V38A 3VGHA 3T2QA 2O9OA 4ZXLA 1HKIA 1GONA 5CGMA 2D3NA 2ZUTA 1AQHA 4M1RA 1EQPA 2EBNA 3BXWA 3BVVA 1N82A 4XZWA 4C7FA 3WL1A 2OSXA 3TV8A 1C91A 2DSKA 3GH4A 2FHBA 2G8ZA 2VX7A 1MFVA 3GH5A 3EJPA 1UD8A 4W8LA 3LXCA 4ZEPA 1V08A 5HXMA 2DSWA 1DWFM 2VZVA 4FMVA 1IT0A 2CXGA 2EADA 3W4RA 5I3DA 3VD9A 4LYQA 1E73M 2WC4A 1SZNA 4L4OA 5A8QA 4IPNB 4M80A 2W62A 3WH9A 2XTKA 3WDHA 3LMYA 1EH9A 1BYCA 4W93A 3LXAA 1E43A 1W2VA 2UY3A 2QLYA 1KTCA 4W8AA 2D0HA 3DHPA 3VSVA 1B9ZA 1ECEA 3ARZA 2F18A 4UZSA 3W82A 3SUVA 1D3CA 2VJXA 1W2PA 5CPTA 3OBAA 3W27A 3WF2A 1WNOA 2YA2A 2XN0A 1R75A 1DEDA 2PSPA 2NW0A 4GPNA 1VBUA 2VNCA 2VQUA 2YDRA 4OUEA 1WDQA 3APGA 2DGAA 1PX8A 3DDFA 1CGVA 1VIWA 5JBFA 5A6BA 1CXEA 3SUUA 1E6PA 2DT0A 3BVXA 8CGTA 5DT7A 1E56A 1GOKA 1GQLA 1ESWA 3IJ9A 1KBKA 3CLWA 3KL5A 1U30A 4GQRA 5CGTA 5CPSA 1OBAA 3VGFA 2J4GA 5I79A 1JDAA 1V0NA 4OBRA 4IPLA 1MQPA 2DH3A 4JFUA 2J7EA 4KWUA 3IANA 5E6YA 2WKLA 1E9LA 3VTRA 1EXPA 2PI6A 4HMCA 5HOSA 2BHYA 2Z1KA 3CZEA 1KWGA 3WEZA 1MW0A 2YA1A 1V3IA 1GUVA 3K4DA 3OZOA 3AI0A 3GBEA 4JKMA 1HXJA 4PN2A 3LPPA 3HJEA 4ZE5A 4AMXA 3MUIA 4ACZA 3L4TA 1W9UA 2XUCA 2F7QA 1UHVA 1ZBWA 1A3HA 2D20A 5D9NA 4X9YA 3WD3A 3KWXA 1V6WA 1MXGA 4CVUA 2FDMA 2O9TA 2DT1A 2XG9A 1E6ZA 2G3MA 1JFHA 4OGZA 2BY1A 4X0VA 4B9YA 4BQ4A 1K9TA 2WC7A 3B8SA 1KCLA 3CHFA 1J01A 2PBOA 2G3JA 3U5YA 1XC6A 3M7SA 1F4AA 3WQ4A 1UH4A 2VR4A 1EHAA 1G5AA 4HOWA 4QLKA 4W84A 4BS0A 3F4VA 3EJQA 1EHNA 2DT3A 2VCCA 1UKTA 3VSTA 5CJ5A 5CLWA 3WBEA 3ZR6A 1UR2A 1NWTA 4AIUA 4H8VA 3WMSA 1JAEA 3IJ8A 1VFOA 1E70M 1GQJA 2GK1A 1ZBKA 4H8HA 1KBBA 1JFXA 4TTGA 2XWDA 4W8BA 3BVTA 4U33A 1M01A 4P7RA 4Q7NA 1BHGA 5D9MA 4H04A 1H0IA 3WUFA 1I1XA 4PTVA 4JCMA 1NM9A 5DFAA 1ISZA 1KTBA 1MWOA 1PBGA 2WLZA 4AZ7A 2F1AA 4UQDA 4CUCA 1SMDA 2CETA 4ZXOA 5CG0A 3CBWA 1QBAA 1C92A 1B1YA 4UQBA 1PX3A 2YL9A 4FNRA 2EPKX 3PZVA 2GJPA 3GXTA 3SCPA 4AZGA 3NSXA 1PCPA 3L4VA 3DYMA 5JUVA 1UR0A 5I78A 2VMFA 1FH7A 2FH8A 2JIWA 2XM2A 4JFWA 3DDGA 4IISA 1S46A 1CGUA 1WB0A 4LYRA 3O2LA 2FE0A 3F5KA 1QHOA 4UR9A 4AD4A 3K8KA 4E8DA 3WY1A 4CN6A 1WCGA 3LRMA 2EO7A 4EK7A 1JIBA 1UD6A 4RE4A 3TP4A 5BCAA 1UR1A 2YL8A 3E1F1 2EQDA 4HOZA 1GOMA 2OYLA 1BFNA 4RE2A 3CMJA 1H4PA 5KZ6A 2J7FA 1YQ2A 1UR8A 1UH3A 4ATDA 5JIWA 3HMCA 2W92A 4BQ5A 2OW7A 5D9OA 5CQ1A 1CGWA 1QI2A 3VNYA 1K6AA 2WM0A 4XUYA 3I3BA 1R87A 3A21A 1C8QA 5A6AA 4UZUA 2PWGA 1F4HA 1BVZA 3WEMA 3AJ7A 1CGTA 4DUWA 4NF7A 1KXHA 3ZT5A 5ABFA 4K68A 5IHSA 4HU0A 1TUXA 1KXQA 1QNSA 2DH2A 4KMQA 1ZJBA 4AEFA 4QLLA 4UQCA 1B3YA 3AOFA 2WZIA 3NSNA 2VVNA 1HXKA 3PHAA 1V02E 2A3AA 3WFZA 4HTYA 3AFBA 4GI6A 3MANA 1HF6A 1NH6A 1B3VA 3BAWA 1NOWA 1QHPA 1W1VA 4M56A 3ZQ9A 1US3A 2FGZA 2GDUA 4PBGA 1ZBCA 2EPMX 2WBGA 3CZSA 4BF7A 3VX0A 3VOCA 3WENA 4XB3A 1RD6A 2J7DA 3HG5A 2XGIA 2VVSA 4DM1A 5ABGA 1CZ1A 2YL6A 3GZAA 1UQYA 4GZIA 4NXSA 3WDJA 1EQCA 5FIPA 2JF7A 3WD2A 3BUIA 2WMHA 2YIHA 3ARQA 3DC0A 2NT1A 4J3XA 2J77A 1ITXA 4W89A 1V02A 3UESA 1CXLA 2J8GA 4ZE4A 4PMOA 4FF5A 4AZCB 2FGLA 3U5UA 1D7FA 3VDAA 3WD0A 3IAQA 1XSIA 4Z2JA 4JAWA 5A1AA 1CXKA 2BHUA 2D0GA 3A3HA 1R33A 4N0RA 1UZ4A 3LX9A 2ZIDA 2XSBA 3CO4A 2WVVA 4MB3A 1H1NA 4DWSC 2VURA 4HA4A 2CBVA 4TUFA 3AHVA 3K8MA 2CEQA 4LPCA 3BLPX 2BXZA 2BY0A 3PZTA 2XPKA 3DX0A 2WVTA 1NWUA 1QWUA 1Q6GA 1HJSA 1EDGA 1PAMA 1FOBA 1ITCA 2VX5A 3ZM8A 4MDPA 1SFSA 2D22A 1DTUA 1US2A 2XJ7A 4JKKA 3G6MA 5HBFA 2PWHA 4HZ8A 3W29A 4F9DA 2CERA 3LPGA 3WQ6A 3AS0A 1C90A 1EA9C 2XIIA 4DM2A 3IGUA 2ZUWA 3CGTA 3WNNA 2BY2A 9CGTA 1PZ2A 1W1PA 3DHUA 2YLAA 3AZTA 3MO4A 3WIJA 5A6MA 3VGGA 5DEZA 2QMJA 1UR4A 3D3AA 3CUGA 3VD5A 3HG2A 4D6EA 2F7RA 1B0IA 3AQUA 1JZ7A 4MTVA 1W9DM 3WMCA 4DWSB 3VIKA 1BGGA 4FLOA 4UOJA 4NI3A 1Y7VA 1W3HA 3PZIA 2EEXA 1TE1A 2J25A 5GPRA 5CLTA 1R46A 1PPIA 1K9DA 4M8UA 1PS2A 1JNEA 1WAWA 2IGTA 2XGBA 2D73A 2ZUMA 2VCAA 4PTXA 4PMNA 1WZAA 1J0ZA 4S3JA 1NOUA 2V3FA 1E6QM 3ARPA 5I24A 1X6NA 2J7CA 4U3CA 1EOKA 3VU2A 2ZUSA 4E2OA 4U5KA 4MNKA 4HZ7A 4JKLA 3N11A 4AY1A 1OD0A 4QFUA 4BCEA 2A3EA 3GTNA 1J0IA 1UKQA 1XCWA 1R8LA 3NUKA 3VKKA 2J74A 2UY5A 3BSHA 3ARSA 1FHLA 4AYSA 1FFQA 4AZIA 1NWSA 4PMYA 4CVWA 2WNWA 1NQ6A 5FL1A 1UD5A 3VDBA 1JF6A 3AYRA 4Z2KA 4LGXA 1V6YA 4JHOA 2C7FA 3KE0A 1KR0A 3SCUA 5A2CA 1CYGA 3TA9A 4MAVA 2XSAA 4UNIA 2ZXBA 3BLBA 2WCSA 3WFLA 2F8QA 2UY2A 1E1FA 4J3TA 1U2YA 3L4YA 3H55A 4P7NA 1UA7A 3EJRA 1MYRA 3MV01 3ARUA 1J11A 1CEOA 5M5DA 4TVCA 1P6WA 2G4FA 4ML4A 4H41A 4WSJA 1CECA 4U2ZA 2W91A 3WY4A 1PE31 4HOXA 2CKRA 5BXRA 4BQ3A 1VJZA 2OWCA 2YDQA 5BYWA 3A47A 3GXFA 2WZHA 4WLCA 3EDFA 3OGRA 4PCTA 1JNDA 4NZCA 2DDXA 3UEQA 5C70A 3BAXA 2WYSA 1XSKA 4MJ2A 2FH6A 3MSGA 1WZLA 1W1TA 3WQWA 3RJYA 4UFHA 2E9MA 1MQQA 3ARYA 1TCMA 1XYZA 1OSEA 4WIWA 3BUQA 5EFDA 4TX8A 3ZR5A 1UYQA 3AIWA 3GH7A 4MB4A 4C7DA 2YL5A 3CZJA 1GJWA 2PWDA 1J0YA 3EDKA 1EOMA 4PEEA 4LYPA 1V3HA 5AYBA 4NX0A 3WQ5A 1BVNP 4Z2LA 3PZNA 3KEHA 3WSUA 3WNMA 4QAWA 1RH9A 2VO5A 1HJWA 2X8RA 4V27A 1PIGA 3VIJA 3VUPA 3W24A 5DO8A 4WKAA 1VF8A 2C8NA 3WY2A 4AMCA 3FY1A 4WF7A 3UG3A 1QVBA 2A3BA 4IM4A 4OZOA 1E1EA 3S2CA 1LWHA 2DSUA 3CUHA 4MB1A 5IHRA 1EIBA 3S5ZA 3N13A 1VEOA 1Q6CA 3GYCA 3N9KA 2XWEA 4HA1A 1C7SA 3LRKA 1TFVA 3PZUA 1H49A 2GVYA 1XH2A 4J3WA 4AWEA 4PUDA 4CD5A 4CCDA 5M3WA 3FAXA 1IZJA 1DHKA 1UG6A 2WSPA 3CUIA 2G3IA 3N18A 2C0HA 3PTQA 1CXFA 1QNPA 5I6SA 1TMQA 2YA0A 3A24A 2WMKA 2VQTA 3T0DA 1JXJA 4FLSA 2XN1A 3BCFA 3SURA 4AIEA 1GZJA 2VX4A 2DQXA 1H09A 2E9LA 4URIA 1H3GA 3DX3A 3I3DA 3VPLA 3OG2A 4AXNA 3TTOA 3AIQA 3SCVA 5LYRA 3WEOA 1FP9A 4DO6A 3L4XA 4OOZA 3QR3A 3RM9A 3D51A 3N04A 2ZUNA 2QPSA 3SCTA 1KCKA 2ZE0A 3RILA 2WW5A 4MJ4A 3VGBA 3BLKA 4W86A 1XRVA 3VIHA 3W37A 2JEPA 1WZMA 1XYFA 1C8XA 1FFRA 5C8BB 4GO8A 3W26A 1HJQA 4QDMA 3ZOAA 3MMWA 5I5RA 4CD6A 2WCGA 1ZBVA 2CBUA 3DX4A 3HU7A 3MUY1 1HNYA 1OINA 6TAAA 1ODZA 4ATLA 3NSMA 4NXKA 1HJVA 2A3HA 3FXYA 4EE9A 2BHZA 2J62A 4AYGA 4RL3A 2QF8A 1TQTA 2CCRA 1UD4A 2AMGA 1HWWA 2WWDA 4UFLA 4AW7A 1QI5A 2BY3A 5A8NA 4OKDA 3BMWA 3SCWA 3IK2A 4A4AA 3VD7A 1JZ6A 1KB3A 2E0PA 1TA3B 3OZPA 3VIPA 2XVKA 4PSPA 1BG9A 1UKPA 2OW6A 3HG3A 3LRLA 3VILA 3N1AA 1BLIA 2WVUA 4MDOA 1W3KA 1Q6EA 3WNLA 1QX1A 1MW2A 5FD0A 3RM4A 3T2OA 1I1WA 1O7AA 2FHFA 3WNPA 1HKKA 3QGVA 2WKGA 4D6JA 3MMDA 5TD4A 5FL0A 1KXTA 2ZX7A 2WC3A 2E3ZA 3A4XA 2WHMA 2XFYA 1DWJM 3WF0A 3PBGA 3N12A 1Q6DA 1G1YA 3DX1A 4AC1X 5C71A 4LQ1A 1ZB5A 1W9PA 4GO9A 2VZSA 1E55A 3WUBA 1UZ1A 2W63A 5A6BD 3CHCA 3WD1A 3RM8A 1DP0A 2WLYA 2ZWYA 1BTCA 3K8LA 2NSXA 2UWFA 1XGZA 3VM7A 5HDRA 3A22A 2XVPA 5I0DA 4J28A 2X1IA 1XV8A 1BGAA 4DUVA 1H2JA 4CD7A 1C93A 2Y2WA 4JFVA 1E15A 4CD8A 2E40A 1C3FA 4OOUA 1V3LA 1ZJAA 4PSRA 5E9AA 2VRJA 4Y7EA 4DO4A 1TQSA 5EB8A 3AHYA 3AMLA 4Q22A 3WH6A 3B9AA 3IAPA 3GNOA 3A6OA 1HKMA 2EPNA 5E09A 1MXDA 2GK1B 4FLRA 3EMQA 4JHZA 2W61A 1E4IA 1AQMA 2VZOA 7A3HA 1QWNA 4U2YA 3LPOA 2CBJA 3UETA 1UD3A 3HZ3A 1L8NA 2WMIB 1ISYA 4YN5A 3UERA 3AIRA 2PWEA 4X0NA 1CTNA 2VTFA 2X2IA 2X09A 3VDHA 3VX1A 1E9TA 4EAMA 4AZBA 5E0CA 5GNYA 1UKSA 1DWHM 1A47A 2VC9A 4P8XA 1VRXA 1E6SM 1PSPA 3T0BA 4QCFA 3QHMA 1L0PA 1HJUA 3ZJ7A 3VIGA 3CHDA 3WNKA 2BV9A 4MNMA 2E4TA 5AYIA 1VB9A 1HIZA 4OIFA 3VM5A 2VRKA 4GZJA 1CLXA 4D6FA 5DF0A 5IXEA 3CH9A 3BAIA 1E5NA 4PMZA 2GJXB 1E40A 3WN6A 5CZKA 3WBAA 5A6SA 1TR1A 2ZICA 5BXTA 1R86A 3MV11 1E72M 1K9FA 3AROA 3PTKA 1ZU8A 2YLLA 1ZL1A 3W28A 3VDCA 1JDCA 2XN2A 4U3AA 1MFUA 2OYMA 4PCSA 4JIEA 1WZKA 2OWWA 2WHLA 4AD0A 2RGLA 3LXBA 3RDKA 1XH1A 2BVDA 3BAJA 5ECUA 4D72A 3VD4A 5BRPA 2XYLA 2DSZA 1UWSA 1KR1A 3BAYA 5M17A 4D6DA 1B2YA 3MU7A 1W91A 1VFFA 4H7VA 2PBGA 1NWRA 3WDRA 4CU6A 4U31A 2X05A 2WMFA 2DIEA 3PZMA 1UUQA 1UASA 5HPCA 4KH2A 3EJTA 1B3WA 3H53A 3AMKA 5CSYA 2V5DA 4ATWA 3JUGA 4NSBA 2EPLX 1JYNA 3ARVA 1JZ4A 1V03A 4AZCA 4H2CA 1BSIA 2PC8A 2YBUA 4AD5A 1EGZA 3OIHA 3HG4A 3VGDA 2JEQA 4MAZA 4PMRA 4CU8A 1ZS2A 3T08A 2D2OA 3BH4A 1R85A 4JZ5A 3W81A 4HPGA 5BXSA 1M7XA 3K4AA 1CENA 1GORA 5E0FA 3OGVA 3WL0A 4FK9A 2ZX6A 4P8WA 3NYDA 3O9NA 4J3VA 4W7VA 2B31A 3ALGA 1M03A 2VCBA 4HA3A 3MI6A 1CGXA 5LA1A 3VMNA 4JCLA 3W25A 4DO5A 1Z32X 2WPGA 1B31A 4WKFA 3GM8A 4MADA 4YHEA 1VENA 1WDRA 4NRSA 3EMZA 1LQ0A 1PS3A 1GOIA 1RP9A 3ZSTA 2PB1A 1JL8A 2RGMA 1JD7A 2BVTA 4N42A 2O9PA 3L4UA 4V2XA 3RMEA 4XX6A 5F7UA 1GCYA 3ZT7A 1H41A 1VAHA 1LG1A 1XCXA 4PMQA 4DWSA 3L4ZA 3VIMA 4YPJA 2WK2A 4P7LA 1BYBA 5JBEA 4D6IA 1FH8A 2WZEA 3PZGA 5IDIA 4F8XA 2D24A 5BROA 1OGSA 3WDIA 1HTYA 4UCFA 3WY3A 4F9JA 4KRTA 5BXPA 4W88A 5ABEA 1W9BM 2XM1A 6A3HA 3KLKA 2WMJA 5HNNA 1VFMA 4PUEA 3ARXA 5EBAA 1LWJA 4NZFA 3OB8A 3FNDA 1DWGM 1GOQA 4M29A 3L2MA 1Q4NX 2YJQA 3WKZA 4D1IA 3EMCA 2OLHA 3AS3A 4H8UA 3RO8A 5DMYA 1TQUA 5A2BA 3CZNA 5LA2A 5JBDA 3BCDA 3H54A 2ALWA 3ZIZA 1H11A 1OCQA 2HVMA 3GNPA 4FNPA 1WDPA 4EANA 2JFEX 1EDTA 4PRWA 2Q8XA 4UFIA 4NRRA 4B3KA 3AS1A 4GZEA 3W38A 2YFOA 8A3HA 1CNVA 2ZUVA 7TAAA 1B90A 4W85A 1UKOA 2W5FA 4TVDA 3CZGA 3TOPA 3BVWA 4QCEA 1XHGA 1OT2A 5E1QA 2J7GA 5A2AA 4M82A 4WJXA 1V0KA 4ZENA 1PIFA 2J75A 2J7HA 1KWKA 4AD3A 1OT1A 2V3GA 3AMCA 1UWRA 3WQ8A 4JFSA 3NDZA 2GUYA 4Z2IA 3OLDA 3VINA 1HVXA 1XSJA 2EAEA 3D52A 1JD9A 1TG7A 4DUXA 4WSKA 3T09A 3AS2A 4W87A 3W0KA 3VVGA 3CHEA 2MANA 2X2JA 4PMXA 3TTQA 5HPOA 1FH9A 1J0HA 1JDDA 3MSDA 3SIMA 3QOMA 3VIFA 3EDDA 3PZOA 1AVAA 3CZLA 3S6TA 4PTMA 1W32A 5M03A 3OGSA 1VEMA 1CXIA 2F7PA 3VIOA 5ABHA 1V0MA 1UH2A 1V3MA 3FAWA 4QLJA 3KL3A 2VZTA 1QW9A 3AIBA 3KLLA 2OWXA 1VJSA 1GQIA 1ODUA 1E6NA 1FHDA 3T2PA 1LL4A 2W4XA 1E4NA 4A3YA 2DT2A 4CCEA 5A95A 3RJXA 1R34A 3ALFA 2EABA 2ZX5A 5GQBA 3VO0A 1JZ2A 1KXVA 2F1BA 1NARA 3SUWA 1CDGA 3TTSA 1JYWA 1DWIM 4GI9A 3W53A 1OIMA 3EBVA 3L4WA 1T0OA 4D1JA 3NDYA 3WH8A 1I75A 2NT0A 5GNZA 2BNJA 5IFTA 1JI1A 1B30A 2X0YA 1UA3A 4QP0A 4B3LA 5BWFA 1R7AA 3POCA 3KZSA 3D50A 1DWAM 1WKYA 1QNRA 4IUGA 3WMBA 3VSUA 4KRUA 4AIOA 1ISVA 2ZWZA 4AZ5A 1EDQA 3O6AA 2J8FA 4HPHA 1QI0A 2VZUA 1E0WA 1GOOA 2J79A 4MB5A 1J0JA 2VUYA 1LG2A 3BUDA 1ISXA 2J78A 1SMAA 3VMOA 4D71A 1KQZA 1G94A 1OGGA 2VR5A 5D4YA 4UQEA 1CLVA 4W7UA 3A4WA 3SCNA 3WDQA 1J0KA 4U5IA 3AHTA 4PYSA 1QOXA 3AHXA 3HN3A 3AYSA 3SUSA 4CD4A 1UOKA 5D9PA 3CIVA 4TX6A 1OD8A 1W3LA 3OA5A 2XHYA 2JIEA 1IZKA 3AXIA 1WE5A 3FHQA 3U7BA 4XV0A 4XZBA 2IUZA 3PZQA 3UG4A 4JL2A 3T0AA 4M24A 2DEPA 4TXEA 1TQWA 3WH7A 3U57A 2AAAA 2VT0A 3WF4A 3MMUA 2IXVA 4E8CA 5I2UA 5I23A 1LL6A 2BXYA 4UFKA 2EPOA 1OGBA 4CN4A 3ZJ8A 2D0FA 5KEZA 2D1ZA 3SUTA 2O9RA 4B9ZA 1E6RA 3FN9A 1LL7A 3CV5A 3CC1A 3UR8A 4HMDA 4ACYA 5EMYA 5FKYA 2G3NA 3F5LA 4J3UA 2CBIA 2F61A 3WH5A 3CZ8A 4FNQA 3G6LA 3SEPA 1KGWA 2GFTA 2QHAA 1HJXA 1TA3A 1UR9A 2IXUA 1GNXA 3GXNA 3M6DA 1SYTA 3ZJKA 4KGJA 4TVUA 3CUJA 4JFTA 1XD1A 1E5JA 4UQ9A 4HMEA 1LF1A 1O7DC 3VMPA 3DX2A 3U7VA 1E6XM 3AIVA 3B9DA 4HU8A 1E71M 3A4AA 3ZMRA 3EJUA 2WB5A 4FNTA 3S5YA 3BC9A 1OM0A 3FHAA 4WK9A 3DYPA 4OJYA 4R27A 1AQ0A 2WAGA 2BVYA 2E8ZA 5AC4A 3SCOA 1NP0A 1LLOA 4ACZB 3EDJA 2WANA 2X2HA 4YHGA 1MW3A 3II1A 3THDA 1B3XA 5A8PA 1GJUA 1BG4A 1JF5A 1E3ZA 3A23A 2ZXAA 2DPEA 1W1YA 4ZFMA 3WUEA 1MVYA 2J47A 3PTMA 4F66A 4UTFA 5FCZA 5A6JA 2CYGA 2CHOA 5D8WA 3SCQA 1EO7A 2X0HA 4AD2A 1EO5A 4CGTA 4D6GA 1JXKA 4PTWA 3RIKA 1FA2A 2XVGA 2A3CA 2AOSA 2D3LA 1CPUA 3LPFA 1NP2A 3K46A 1NOFA 3AMDA 1G9HA 1E0VA 5AC5A 3GBDA 3TONA 3N17A 3DYOA 4B15A 4AZ6A 3D4ZA 2D23A 3W6MA 1HL8A 1D2KA 1UWUA 1GPFA 3UCQA 2WMIA 3GDBA 3MS8A 3BAKA 4WKHA 1CWYA 1QNQA 4MNJA 5A8MA 1W3JA 1V6UA 4GINA 5D8ZA 2F2HA 3THCA 3SCRA 3WQVA 1UD2A 3QHNA 4BQ2A 4E4PA 3BGAA 3RCNA 4AISA 1GOWA 2WWCA 3VD3A 2EJ1A 3WELA 2ZXQA 4P8UA 1J10A 1HP4A 4JL1A 4UFJA 1JAKA 1HP5A 4W7WA 2HISA 4AMWA 3OLEA 4RE3A 3PN8A 4HZ6A 3ARRA 2GJXA 4Z2GA 4LXFA 5A69A 2GDVA 1M53A 1B3ZA 3OLGA 1HT6A 3AMGA 4LX4A 4CKQA 4V28A 4D6HA 1H5VA 5FOOA 1JYXA 3N15A 4UQAA 1TQVA 3EYPA 4J27A 4BA0A 1R47A 3B9EA 3WUGA 2F7OA 4M81A 1OIFA 1XD0A 1HL9A 3VGEA 3QOKA 4CCCA 2ZX9A 3WNOA 2CITA 4GI8A 4Z2HA 1YHTA 3UG5A 2YKKA 4S3KA 2YOCA 1KGXA 2V3EA 4FNSA 3TTYA 2CESA 5A6LA 4UFMA 5A3HA 3MKKA 2VI0A 2WSKA 1HN1A 4P7QA 3GXDA 2PF0A 1C8YA 2JALA 1WO2A 5ABFB 4J7RA 1GVIA 2QMKA 2Y24A 3AICA 2QPUA 2ZXDA 3M07A 3VNZA 1PX4A 1O6IA 5CSUA 3ARTA 4GIAA 4PMVA 1HI7A 1V0LA 4PMDA 5A8OA 2TAAA 3SCSA 1G0CA 1PJ9A 2WBKA 2W67A 3NJ3A 2Y4SA 3BSGA 3CTTA 1VBRA 1UWIA 2XFFA 1TZ7A 2XVNA 1E4LA 3AXHA 2OSWA 1QI3A 1QBBA 3K1DA 2DIJA 1UWTA 1C7TA 2XVLA 3BUPA 3OLIA 4UOQA 2XIBA 1BAGA 1OB0A 2FYVA 2OSYA 1E4MM 3ZT6A 2G41A 4MPKA 5LA0A 4AEEA 3AIUA 1VEPA
chains in the Genus database with same CATH superfamily
4L23A 2HUEA 4GUOA 3HS0A 4LBUA 4J2QA 2BS9A 2R23B 4RBPK 4D8OA 4LT9A 4TTUA 1AY1L 1D7BA 4XIAA 1SR0A 4YFLF 4L2LA 1MQRA 1CGYA 2UY4A 4XZLX 1BF2A 3RL1B 3GXMA 3DURB 3MAWA 2OMZB 3LNEA 4M1GH 1GHSA 4H8WC 3Q65A 4AHQA 3AREA 5CCGE 2XH0A 5HD8D 1FVDB 3H9SD 3WDPP 4RGMC 4MVBC 5B1CA 1GC1H 4M00A 2PP1A 2CKBB 1A5MC 1PMYA 4G1EB 3QIWB 1E4XH 3HBZA 4ZO9A 2HV5A 3R94A 2BFGA 1V6XA 4QAMB 3CV2A 1Q2SA 3FQRA 3VWKB 2ESCA 1L9MA 1WKFA 5H37A 2CE6A 4D9RD 3DX8B 1W0VB 4B0MM 2Z0BA 5EO1B 4U10A 4DPPA 2PAJA 5BW7C 5AL8A 3VC5A 5G2IA 4RNJA 3VI4F 1HYSC 3LN4A 1M7IB 1RU9L 4H6RA 2W9EH 4X6FB 3CX2A 3RAJL 2CWRA 2WXDM 4XP6H 1DVYA 4TS6A 5J1AA 1IV8A 1AL8A 5E6ZA 2JELL 4M5PA 3TFKC 1GHRA 3N3EA 1PLCA 2XSKA 1AD9B 4GAYA 2KZ1B 2FMNA 1JZ5A 4PUBL 3LI1A 5KYXB 2EUXA 4M48H 1G4EA 4ORGB 2NY6D 4LCCA 2VGGA 3TQ0A 4HP5A 1CL7H 3AHZA 3M44A 2V38A 3VGHA 3M0XA 1HKIA 4PJ7F 4WRLA 3EH5B 1PWMA 3JV4A 5D05A 2G2RA 43C9B 1Z3NA 3NJNA 3EJYD 2DKMA 4YZFF 3TV8A 4IBVA 5EU7C 2OV0A 4LARH 1IR1A 5JHDA 1OAJA 1R5WB 3SDXF 2I5QA 3VI3A 4A38A 1IC0A 3EXLA 1E4JA 2CGYA 1A9EB 3B4UA 2IFFH 3O6FC 4Z0XA 4Z7NE 5JTWA 4L2YA 3WH9A 5HYFA 4ZAKD 3QCVL 3UZYA 1OP5H 4MWAB 3WS3B 5C8JB 2V5JA 5T3XL 3HF3A 2IIJA 4AUBA 3QUYB 3TU9A 1WTLA 4E9XA 2GT9A 3ZKXC 2DF3A 3CHQA 1URZA 3EB2A 1ETZB 1OCJA 1WDQA 3X11A 3APGA 1PZBA 1DJHA 2C3ZA 4JDZB 3UFIA 4HJWA 2HEJA 1NC2D 2BNQE 5GJNA 2CGRH 3GK0A 1YDOA 5HHME 3GMOB 3I75A 3IDYB 2J88A 4FCHA 1GVQA 5I79A 4C6FA 2YPKB 1J8VA 4GNVA 2WLHA 4WR3A 1AFVL 1UACL 4BF9A 3PDDA 3O11B 1EXPA 3S8WA 1MIML 1PIIA 3CUPB 3W2DH 4XNUL 4G8TA 1HFUA 4ODHH 2EXWC 2NWSA 2WMPA 1HO4A 4YDNA 2F7QA 3MODH 1CFTA 3WD3A 3S46A 5MEND 2DT1A 4I7UA 2P5NA 1QASA 32C2B 3JZUA 4PJ8D 3QIUC 3PGDB 1ACYL 3DKJA 3APNA 3BFWA 1OLLA 3JWDC 4QOKB 2YD2A 1RZIA 1K3UA 4UIMB 5I5MA 1R30A 2OO0A 3LS4L 3HQNA 4QRBA 1GGUA 2HH0H 1FYHB 1GTHA 3RWEB 3JTTA 1KBBA 2CDGA 1TO4A 4AL8L 3DKLA 4U33A 1YPZA 1OCCB 2ENPA 3WUFA 4JQ1A 3LENA 1G7VA 1T40A 2REQB 3SE4A 4DW2H 3NTCH 1MDRA 3OTRA 3IJ6A 4Z7VE 3RIFK 3QIBD 2PP7A 3O1NA 1ZHNB 4P05A 3LKNA 2GJPA 5DS2A 1WFMA 4HT1L 3DYMA 3RVVD 3GKWH 4M6OH 5GGSA 3DXAD 1G6CA 3EAUA 1Z0NA 4L37A 1RMFL 2YRPA 3BO9A 4JRYA 2Z2BA 1WCGA 2DW5A 3WJXA 1FGVH 1KV7A 1RJQA 3FOLA 4JO2L 1QAPA 3E1F1 3BG3A 1JPSL 1J4EA 2HBXA 1ICSA 1FHGA 3GS0A 3KS6A 2J7FA 3BZ5A 4NY2A 1FF5A 4ATDA 1DSWA 2EYRB 3CDZA 3N1FC 2Y7LA 1KBIA 3GB6A 3OM3B 4GCXA 2YXVA 2R0WH 1QI2A 3UWZA 4X60A 4KKZA 3LDBC 1Z5LB 4LLMB 1BVZA 3TBYA 4DUWA 1X5ZA 3QWOB 5AVQB 1A3WA 3NRFA 1F42A 5JOEA 4WWOA 2VXQA 2OX5A 2EDRA 3VZZA 4DKFH 5LHDA 4QLLA 2WZIA 1CDUA 3SYOA 4ZCWA 3AFBA 5A40E 3CL6A 3LIZH 1TTCA 2YK1L 4BV1A 1S9XA 2LU7A 4AJYV 1TJGL 2VEFA 3NIDE 4Z6AT 1INQA 5BXFA 4R6UA 3NSJA 3GMLA 2C4XA 4X6BA 1I4FA 2P4AB 3EA3A 1YECL 3O41B 5LGKA 3WDJA 3BK0A 2ZYSA 3TN6A 3MUXA 2OTUA 3D69B 3SCMD 2EHHA 2OR7A 2RDWA 1A5CA 3NL6A 3EKLA 1HAUA 4JAWA 3C6LB 4JZJB 3KPRD 4Z76B 2VGFA 2UY7B 2C9VA 2GJJA 3HPSA 4TUFA 1Z9MA 2R23A 2BXZA 1IKFL 4NOBA 5ANME 1IC5L 2O56A 3RRXA 3MJYA 3KS0J 4H2HA 3W29A 4NIKB 3IUIA 3AS0A 4EPSA 3DURA 2XG5B 2DQJH 2WNGA 1YX1A 4H8WL 2PCFB 1KTLB 5T1JA 1KB5H 2BGQA 3THQA 3UAEA 3WJLC 1FVDA 2Z6FA 4CSPA 3WMCA 5EOTB 1TQCC 2HT4C 5F4XA 1ADOA 4QHRA 3FN3A 1NL0L 5JNYB 3NG3A 2Z7YA 5L2KB 1L6YA 3FTWA 4G1EA 4QIUA 1PS2A 4P2QB 2WTPA 2OZ4L 1A3QA 5KSVB 3B40A 1A5FL 3VWKA 3KLAB 4JN6A 4BH7B 3DX8A 1W0VA 3TZVC 3G1HA 4L4LA 5EO1A 5DYOB 3VXPA 2EKGA 3PJUA 1UKQA 2XFWA 2JKAA 5E93A 4X6FA 3UYOD 4AZIA 1NWSA 2PF8A 1ZP4A 3HI5L 1J5CA 3NH7L 5KAQG 5E8NB 3EGXB 4LO9A 5C3LD 5CSZB 3AO0A 1AD9A 3DDMA 3DK2A 5KYXA 3N73A 3WLIA 3F8UB 4ORGA 3DFNA 4PY7B 3GTIA 2SEBB 1KW1A 5E8EB 2P0IA 5IG7B 4TVCA 2DMKA 3GSXB 4L48A 3VA6A 1BWMA 3KNBA 2RGSA 4Z23A 3MSGA 4M7TA 4OF3A 3NCJH 3P69A 5TDPB 3PP4L 4QRRB 5DVNA 1KBPA 2KLRA 1R5WA 3DTUB 5AYBA 4M0XA 4Z3GA 1R2SA 2GJ6E 2AAVA 5JDSA 1A9EA 4OGXL 2IWGA 3BE1L 3UBPC 4IQLA 2LLGA 5ES4B 2OZ0A 1A4CA 2LLLA 1IIHA 2R29H 4IHCA 4RUBA 1EIBA 1J6OA 3NDOA 1GG0A 2RDXA 5HGAB 3LY6A 4AGQA 2YAOA 3N18A 4MQXD 3QUYA 4B92A 5I6SA 1R9XA 5E1AB 5IHUH 2VXTH 3CPRA 2V6AA 2BSTB 3CM4A 3DX3A 3FCGA 2AQ3A 4JDZA 4CQAA 2XBZA 4ATTA 1FP9A 1A3LL 2HWGA 4OOZA 3U2IA 3QR3A 3D51A 3ECUA 2ZKMX 2WO3B 4NNYA 1ZXQA 1T0MB 3NFUA 3QJRB 2NXYB 3BSMA 3ZQWA 2HT2C 2YPKA 3DX4A 3KPNB 3V55A 2Z8SA 2X2UA 5DCEA 3WK3A 4ATLA 4EE9A 4L3CB 4RL3A 3UTTD 4Q6IC 4WUKH 2XACC 1M6OA 1UKPA 4IOIA 3HG3A 4TL5A 1I82A 2CH8A 3D05A 1W3KA 1Q6EA 1I1WA 3WNPA 5GIRB 3NJGA 5KINA 32C2A 3K2GA 4KQ4L 3S9YA 3PGDA 3B34A 4X4YA 5I66A 1KENH 3JWDL 4GO9A 2G2PA 3WUBA 3TCTA 2NY5H 1A3LH 3RWEA 5DHVB 2HX8A 3H7BA 3RG6A 4DUVA 1O5QA 3SZ8A 2Y2WA 5LN8A 4O50A 5CKGA 1E15A 5DHMC 1A7QH 1NANI 5CKAA 3ZZSA 2NY3B 4GB9A 1ZHNA 1OP9A 1E4IA 2RHGA 2FWLB 1CYXA 1L9OA 4IGBB 2EIEA 2FJHB 4PRPE 1ISYA 1UM6L 1HE7A 1AR1C 5ITFB 3PWPD 2PTYA 2PDCA 1E6OL 4P8XA 5TH2A 2KZWA 1E6SM 3QUZA 3ISIX 3ZJ7A 3X3GH 4XCYB 3RHGA 3OO2A 1ILSA 5EGRA 4HF5L 1AQ8A 3UYRH 3GT6A 4IRJD 1GT8A 1E5NA 1O5KA 2EYRA 1S7TB 3BKYL 3ZXAC 5EUOB 1Z5LA 4G42B 4LLMA 3QWOA 1HK6A 3O6LH 3H23A 4DXXA 3ZWSA 2R2CA 2HSAA 1D6EB 4N2OA 3RDKA 5AG9A 2BVDA 2XPYA 5J6SA 1KR1A 4A6GA 4PJ9C 2PDJA 1MCRA 2F54D 3UWEA 4ZUSA 2FLBT 2VABB 3NZRA 2PCQA 3LOTA 1JZDC 3MPCA 1PY9A 2MPAH 1UUQA 1ZANH 3O41A 3UAJD 4JQXC 3I7QA 2HTLD 4I5XA 3PAYA 4KESA 5D2LA 1D7DA 1JYNA 3SIKA 3JRKA 3HPFA 4ZQCA 1QFEA 2CO3A 1EGZA 4JZJA 5F7WC 1FNSL 1L2QA 4Z76A 2JJSC 5AOZA 2UY7A 4AMKH 1UGNA 2D2OA 2X1RA 3MA8A 1SQ2N 1GORA 1TPB1 2B20A 1JHKL 1UWGL 4P8WA 1IGFH 1YQVH 5EORH 2Y06H 3PBYA 3V4UH 2KL6A 1WV7T 3JU2A 1B54A 2XX0A 4H8PA 3WUZA 2FQEA 4Q14A 2XG5A 4DEWA 1NGQH 1RP9A 2PCFA 1KTJA 1KTLA 5FB8A 1IC4L 4Q4MA 2BVTA 2H6UA 4V2XA 5D96C 1JWMB 4DEPC 1SDYA 1NLBH 5EOTA 3QPXH 4YPJA 5JNYA 1JP5A 5L2KA 3LNFA 3O0FA 4WSGA 2CDFB 1W9BM 5HNNA 5KSVA 5ICUA 3KLAA 1GS7A 1Q4NX 5FYJH 4KO5A 4BH7A 4JPGA 4WY0F 4DPCX 4MSSA 1P0NA 5DYOA 4FGMA 1XUZA 3ZMNA 1JPDX 5TQ2H 4UBPC 4DGVH 3O05A 3CZGA 2UXGA 4AVHA 2J75A 5E6RB 3NDZA 3QN3A 3SYQA 3DV6B 1A53A 1H1ZA 3ABZA 1HVXA 4TQIA 5CSZA 2PURA 5IQLA 4DUXA 4NJHA 4IPJA 4A6YH 1UJQA 4P2VA 3TTQA 4PY7A 2SEBA 5E8EA 1RCOB 3BLEA 2GCYB 5JQIB 5FECB 3GSXA 4I3RL 5FXCH 3NCMA 4DKTA 1E6NA 1SXNA 3BL3A 3UTZB 2DT2A 4CCEA 2NVCA 1XF5B 5TDPA 1SHWA 4BQ9A 2A83A 2AJZB 1Y5WA 1EXGA 4QRRA 2O5XH 1CDGA 1XLBA 4JLRB 2IQDA 4S3BA 3L4WA 1ZHBB 2ZP8A 1YNLL 3EJJX 4LCWE 5CIPB 3GKAA 2XBDA 3D6GA 4DVRL 5TQ0L 3UJTH 4XO5A 1G7PB 1JS4A 1ZPTA 3L3DB 3CLEL 1E0WA 4MB5A 4YFDB 1WDDA 2AL2A 5HGAA 4GSRA 1E28B 4U3HA 3BAEL 3QPYA 2GB2A 3KOYA 3FCPA 3X3FH 2DWYA 5T5FH 5ABDE 4Q4SA 5E1AA 3E2HB 4JN1L 5KZCD 1WYIA 2BSTA 1I9JH 2DMBA 4CD4A 4LNVA 3DX5A 1DJZA 2Q7NA 2OMXB 2NZ9C 2VFDA 1WUZA 3O2VL 1LO4L 1T0MA 3QJOA 2DTSA 1I1CA 1MCWW 4XAPA 2EC9T 3MMUA 3IFLH 4XH2B 3KPNA 1JJUA 1QSFA 2BASA 3VNJA 3SR7A 5I76B 1NIEA 2D0FA 4L3CA 3RY6C 4O8AA 3QY6A 4WXZA 5FHBH 1CICD 1FZKB 2DLGA 3ZL2A 1GVRA 4G9PA 2A73B 3ZJKA 5HDQL 3BW3A 4PUWA 2A3LA 3CUJA 1CE1L 4XNZB 4PJ5E 5B1JC 4L3ED 4N28A 3C5ZD 5KYWA 3N14A 3EJUA 1NCBL 3VD1A 2H9GB 2Z8RA 4JEJA 2CIIA 4P5MB 4QXVA 3BJSA 3VQ1C 2W6RA 3O3UN 4FYSA 5DHVA 2ZXAA 4ZFMA 1MVYA 2JKSA 2R82A 4F66A 1RUAH 2WQXA 4LCIH 1NZRA 2CHOA 3WQOA 3BGMB 4FQ2H 4WWID 2DV6A 3RIKA 1N2VA 2A3CA 3GHBL 1CB4A 1CPUA 4OGYL 1KV8A 4H7CA 3N17A 2BNQD 4IGBA 3VKCA 1GPFA 1VHNA 2FJHA 2JKJA 5HHMD 2IDFA 1KBVA 5LXGL 1X5FA 1ADWA 1W3JA 4IMKC 3FUKA 4X7TB 1GOXA 4FQ1H 1LT8A 3WELA 4QDWA 5MEQB 1J10A 4XMUA 1M56B 3HUJB 4ZT1A 4W7WA 4XHJD 2VDLB 5LNVA 4LUYA 1KLFA 1U83A 1GZPA 4JO8A 1KB9J 2FB4H 1PVNA 1BJ1J 1O1HA 5EUOA 1PL3A 2CM6A 2XC8A 5LB1A 2WIMA 4G42A 3FS9A 3RYMA 4NX5A 2FGBA 3BWSA 1J8HB 4BE5A 4YE4H 4WRHA 1EBHA 5B39G 1D6EA 3UG5A 2HG5B 2QQ6A 2FX7H 3R4IA 1KJ3H 2OKTA 3G04B 5SV3A 4FF9A 1WT5A 3GAKA 3ARGC 3KDOA 5E6IB 3JZYA 3MKKA 3I9AA 4CSZA 2VABA 4JHAL 4AWUA 1V79A 3KVLA 1GVIA 3AICA 4ZUUB 4NIYE 2CO7B 4GIAA 2YD9A 1ZLPA 1TVHB 5A8OA 3G08B 3QPKA 5KVGE 3V0SA 5SWSB 4ZFZB 2HFGL 2E28A 3QNZB 5I71C 5C9ZA 4HYRA 1TZ7A 2XVNA 1Z7AA 1FBIL 3GR4A 3IIVA 5AWNH 2DQHH 4H9YA 5HUOA 3B7YA 1RLDA 1IO4C 1C5BL 7PTDA 3N6QA 2BIHA 1Z2KA 5J7CC 1PV8A 3LBOA 3WQFA 5I3IA 3AG2B 4NO2A 4HK6A 3I3EA 1ONEA 4WFFD 1WDSA 1QPKA 2A7BA 5K2ZA 3TWAA 3AISA 3MFGB 3IBOA 3Q37A 2G5WA 5G4HC 5J8LA 1UWQA 1JWMA 3BQ6A 4EN2A 1LZOA 1ADQL 5LXXA 2Y36H 4GXVL 3GUTB 4LSTL 1G01A 2XTLA 1GOHA 4KROB 2Q7YB 3GXIA 4JPSA 2O5NA 4WO4C 4FOJA 4HX1B 3BUBA 1GVFA 1MZHA 4KGLA 3AYTA 4B91A 5A3ID 3NCOA 1IR2A 5DURD 1OPOA 4MJHA 2B1OA 2HRWA 1TPFA 1LVEA 4BCYA 1IBYA 1HG3A 3LVTA 4HZAA 2PLCA 3DV6A 4HD9A 3IF1B 2FB2A 5JZ7C 5EULV 1XGUB 3A5VA 4DQOH 3WE1A 4PE8A 2JK5B 2EEBA 2WWNA 4XAKE 1R3HB 5FJOA 4PMUA 1ZK9A 1WA2X 4ODVH 2GCYA 4JD4A 1OCWH 3ARWA 2PU0A 1DSFL 5FECA 1I2QA 3HMWL 3SDCC 3E8UL 3FTXA 3P62A 3ZJ6A 4CNSA 4GKTA 4WJEA 1Z9PA 1GVYA 4CU7A 4KKQA 5C9KA 2Y3NA 2F1EA 3UTZA 1DDTA 1XF5A 2UXTA 1UWYA 2AJZA 1X3DA 2JKXA 3W01A 2G3FA 4YPGB 1PUDA 4JLRA 3V0HA 1ZHBA 2ZUTA 3LUTA 5L6YL 3OG3A 4C90A 4RDQF 5CIPA 2EBNA 3GIZL 4O11A 1P4LB 5GGTL 1G7PA 3WL1A 2DJ4A 3BN9C 2M1KA 5AW4B 2I16A 4H9XA 5BRBA 4PPTA 2WN3A 5M1TA 3HFYA 3E1ZA 4F2EA 4A67A 2CW6A 4HV8B 1Q8JA 4JKNA 3GAYA 2GVGA 1J93A 2DUXA 1E28A 5E56A 1U1HA 3FJNA 4FKHA 4BK4A 4IBLT 3Q01A 4XNXL 4MTMA 2IGFL 4BH8B 3F3HA 1MREH 1G9ML 2OMXA 1TTJA 4G11A 2DJLA 1EZVY 4YK4B 1OCBA 2W9LA 2B0SH 2G5RA 1AANA 3W7LA 1R75A 4N26A 2G2NA 2Z8WC 3MRJA 4XH2A 1YRKA 2WW8A 2VQUA 5I76A 2BB0A 4RESB 5FO7B 2R24A 1FZKA 2PUZA 3CLWA 3QK0A 5ECJE 1S78D 3PHSA 4U0QB 4XPBH 4TOYH 2A73A 2WXGA 3VGFA 3T0EB 4LW7A 3KUMA 1VYRA 4P4KD 2QHLA 5IB5B 1EZWA 4ECLA 4HMCA 3LHYA 4OT1L 6REQB 2DQUH 3UMNA 4KRMB 2H9GA 3ZUCA 4P5MA 4W1TA 3FU6A 4P46B 2ENYA 1ZBWA 4GXMA 4JY9A 2D2GA 2O9TA 4XMLH 3F58L 2APWA 5IR1B 2WC7A 3TN5A 5JHLH 3VTAA 5I09A 4W84A 4Q4KA 2J1KA 2VCCA 4HC1H 3BGMA 1NCAH 3TF4A 3P0GB 3EF7A 3UBXA 2EC9U 3GG8A 4J2XA 4O1CA 4NILA 3DJRA 4D7BA 1OABA 4A2RA 4Q89A 4GT0A 2FDBP 3Q8EA 4XCCL 1YDPB 4JICA 1M3UA 4MKVA 5HVHC 7REQB 1KM4A 4ZX5A 4X7TA 4PP1C 5JW3L 2GSEA 1PTDA 4QHKJ 4AC7C 2BG5A 4DOHE 3QQ9D 5MEQA 3HUJA 2X30A 5E03A 3NSXA 3QWRD 4PRHE 1XL4A 4G5ZL 5AKRA 3GPEA 3S34L 3F4DA 3O2LA 3O8XD 2R4RH 4HQQL 5L9DH 3P9MB 3VNMA 4Y5YB 3LRMA 1JNNL 4AVKA 4DJEC 4NAJA 1CFVL 4QE4A 1J8HA 1XLGA 4NGHH 3N43B 3HAEG 3CMJA 5H8PA 5D2TA 4MS8D 3F6LA 2HG5A 5F0LB 3G04A 3MOQA 3RWJB 2DM2A 4AQ1B 4V33A 5E6IA 1G1OA 1JQVA 2PWGA 2R83A 2DZBA 3GI9H 4HU0A 5I6XB 5TE6H 4ZUUA 2O6EA 1W72H 4OFKA 1I9RH 4J3ZA 5CJNA 4BWLC 1TVHA 1B3YA 2OEJA 5SWSA 4ZFZA 2F5BL 3WHXB 3GHPA 1TETL 3OF6A 3QNZA 3ENLA 3ABGA 4IOTA 3DX6B 4F57H 3PGFH 2A9CA 4PRPD 2CGZA 3DX7B 2J7DA 4NKDB 2EG6A 2QSQA 5HWJA 4N5ED 3Q06A 1MJ7L 5FIPA 3OIXA 3C9NA 3ROLB 4XKMA 3B5TA 2LE9A 2XQ0A 2Y7QB 2BVQB 5AENA 3GFUA 3QJTB 3TJ4A 1RH8A 4O9HL 4X4ZA 5AAPA 2B9AA 2VN4A 1SRDA 1CU4H 4DBUA 1VCBC 2CBVA 4JE0A 2FEDC 3WG7B 2JFCA 5FGRA 2C16A 1KYFA 2A74C 4PMJA 12E8H 1YNTF 3GUTA 1C90A 3T1WA 3DHUA 1AHWC 1RUKL 2DD8L 3HC2A 1QVOB 4EXPX 2Q7YA 1XLFA 2X87A 2L3BA 4IK6A 2DW7A 2XZ7A 5FFLA 4RMVA 5FGBC 1N6QH 1R19A 4F0MA 2FFCA 1LQBC 4HX1A 5C0BE 4QYOA 4XB8A 3L21A 2P52A 1A3RL 3F65A 1RZ7H 5GJTH 2VCAA 3MI3A 1KPRB 3AGWA 2ZUYA 3ARPA 3H2WA 1BZ7B 4BXSV 3RWDB 1G84A 3VU2A 3IF1A 4U5KA 4MA3B 1XGUA 5F1NB 2W9DL 3OMIB 4FXJA 2JK5A 5D2YA 3QSTA 1HH6B 1HINL 1XCWA 4KIEA 3W22A 4MD5A 3PUDA 5AYZA 3PUOA 3WTYA 1LGVA 1UD5A 1JF6A 3U9UB 4JHOA 2K4AA 5J56B 2WHVA 2ZXBA 4EDWH 4Q32A 4CKVX 4LP4A 1EEUA 3FTSA 2Y7EA 3ELAT 3G5XB 2J7LA 2A21A 4ML4A 1T7YA 4YPGA 1OFPA 2QVMA 5BYWA 3GXFA 4H19A 1X8CA 1P4LA 3B8YA 4U0RB 3QFWA 4OGAD 4HCRL 4Q6YA 1YEHH 4HV8A 4RLDA 2G2RB 4B96A 5KW9H 2VO5A 1JMXA 5JIQA 3WJJC 1UGKA 1ZZMA 2PW2A 4HNOA 5AHIA 3T81A 1KCWA 3ITOA 1SXBA 4DHGA 3UG3A 1BD2D 4A66A 1LWHA 4BH8A 4XK2A 4YS1A 1EJ7L 2Z35B 3L1FA 3EOLA 3MGAA 4K71B 2XWEA 4LBSA 3VWJB 1DQDL 2MIZA 5M94B 3RGTA 4Z0XB 3PTQA 1JCLA 2QPEB 4X83A 2YA0A 2VX4A 3HNSL 3QMRA 3GLAA 2FZMA 2QQQA 5IFHH 4AU0A 3ONBA 5FO7A 1OTUC 1K8CA 5GZOA 1NEZG 3QZAA 1K03A 2XDFA 1RV8A 3CBJB 2GBVA 5J12B 5C8BB 2QELA 3MMWA 3GYRA 6REQA 1W8NA 3FSVA 4O1DA 4ADSA 3EX3A 2XRAL 4HUWB 4PGCA 4A4AA 5AD0B 3VIPA 1BG9A 4M7KH 1C16A 5PCYA 3ME3A 1ORSA 4P46A 4OLVL 1URIA 3QGVA 4XMWA 2RDTA 5IR1A 1H50A 5B1KA 2HB0A 2XIDA 3A4XA 3SECA 1MN4A 1GKEA 2FJGB 3GD6A 4P2RA 3OV6A 3ZDXB 1ZSDB 3UP8A 1VFLA 4DPQA 4PJXE 2ILLA 2YBGA 3MXVH 2YEQA 5ICYB 3DGGB 5AHLA 4UI2A 1YDPA 3T40A 2WGNB 5TBOA 1Y6NR 4JFOB 4RPQA 5EMLA 2PXYC 3WFDL 7REQA 1TJMA 3WH6A 1WIPA 4H0LC 5F44A 4OI7A 3FH8A 1TZGH 1TREA 4NZ3A 4I89A 2NVDA 2RCSL 4KTGA 3L9EA 5DFTA 4J5VA 4PN6A 1QTPA 2HAZA 3LCIA 4OLVH 1OQOA 3CFDB 3VDHA 4YUEH 4C6MA 5DFWH 4G2DA 1P5BA 3O9WC 3QUKB 1A47A 3GHEL 4PJ5D 4QWWC 3FONB 1KRAC 1AD1A 2IQ9H 3P9MA 4C6OA 2Y70A 1ET5A 4Y5YA 3F01A 4XVEA 1HESA 4MY8A 4QTIL 1OE1A 3GBNL 5DVKA 3C08L 1QWKA 3KYAA 1NDYA 1CURA 2JJVA 4C56E 5IQMA 3KOZA 2BVOB 2CLMA 1FDJA 3NYZA 3MV11 3AROA 1SN0A 4JRYB 3RWJA 3WIHL 2GY7B 4IIZA 5E2WH 4DGYL 3UZEA 4ZMVA 3G1VA 4E5TA 2X88A 5D1XB 4F7MA 1BXUA 3NCCB 2ATPB 1FC1A 2WY3B 3NGFA 2HX9A 4A7GA 1XGYH 3WHXA 4NJKA 4O54A 4NQDE 1QG3A 1XBVA 2DJMA 4S1RH 4OV9A 3DX7A 2DQFB 4NKDA 4TUOB 2Z27A 5I5JA 2UV3A 2NZ1A 4KH2A 3EJTA 1JJKA 1KM6A 2VLME 4M1GL 2V7HB 5D02A 1JV2A 4IIQC 2GUBA 2BVQA 4LDLB 1ONRA 2IPWA 1P4BH 3BZJA 4OD1H 1LYXA 1JUFA 2FBJH 1GC1L 3NCWA 3K4AA 2OTUB 1E4XL 2WIIA 4NQ1A 2ESVD 2GPTA 3X2QB 3O9NA 2PLMA 4HLJA 1WSST 3ANYA 5EB9A 4X5WB 4WKFA 2AXJA 4NRSA 1ZHKA 4Y4HC 1BSLA 2XA3A 1QVOA 4K7PH 1F3DJ 5JW4R 4IOFC 1JE6A 4X9BA 1P0BA 2JQXA 4UYPA 3LZRA 2W9EL 4HHGA 4ES4A 1KZYA 2VMEA 2D9QB 2F53B 4XP6L 4Z3HA 4LEBA 3EF4A 2VWTA 1EEQA 1IE4A 3PRZA 3TIMA 2WMJA 5D2XA 4CNUA 1KPRA 1IAIM 1VIZA 4M48L 4PJFB 1BZ7A 2E9JA 3RWDA 1VLXA 2XV2A 1CL7L 2ARWA 3T8MA 4MA3A 1NJ9B 4DJFA 5F1NA 1Z9LA 5SWQB 4K37A 4HPNA 4GFSA 2BNUA 2MKWA 4WU5B 3DGRA 1HH6A 2PABA 2X0VA 4F2ME 3IJHB 4FHJA 1XDJA 3SYAA 2K7QA 3NIFB 4QY8A 1TZHB 3U9UA 4Z2IA 3PXHA 4LHUB 4LARL 4E5XB 2OZ4A 4IK7A 3VXPB 4DLFA 3T09A 4GY7A 5HQMA 1Z9OA 1QOKA 1KFKA 5IREA 4Y19B 3NG5A 3QNFA 5I8EB 2IFFL 4YFEA 4H25B 3A13A 2PS2A 3SIMA 3G5XA 1BECA 3TCEA 5HJYA 4N6QA 5TNVA 4PTMA 4KI5D 1E30A 5BW7A 3T6QC 5T3ZE 2OWXA 4LC6A 4JPWH 1FHDA 1EAOA 4LIQH 3D2TA 1CJYA 1S2WA 5F8QC 4LSPL 1YADA 4H1LH 2ZX5A 2OZTA 4XPHH 1AIFB 2VR3A 1Q1PA 1CCZA 3PU7A 3K0WA 3EBVA 3KNBB 4WGKA 2VWEC 2CGRL 2WZMA 1B6DA 3ULUC 5BWFA 3TYAA 1MDAA 4IXXA 3VSUA 4AZ5A 2VMJA 2Z35A 4HPHA 1I8AA 5HHQB 3VWJA 4ENZA 3H3BC 5JDSB 2Q01A 2J78A 1IIKA 3W2DL 1GVEA 1XDTT 2NOYA 5DUBB 4ODHL 2PF6A 3SCNA 3UBGA 1A22B 4PYSA 3O45B 2VAJA 4HCGA 3CDYA 5B80A 3MODL 1XO8A 4TX6A 1A4BA 3MV9B 4UT7H 1P7QD 5T33H 2H3XC 1PE1A 4LSPH 4TXEA 1B88A 2VD9A 3K91A 1LL6A 2NY5C 1E6RA 3SE9H 4I3SH 2HH0L 4WSHA 2XPGB 1MHHB 3E2VA 4NNYB 4HUWA 3CZ8A 1UIOA 1IEVA 5AD0A 3QZWG 2IXUA 1GGCH 2XZZA 1SYTA 4LCUB 4DW2L 3NTCL 4QRPB 4NASA 3R4RA 4XNYH 1BVWA 1ZV5A 4PV1C 3PJLA 5J04A 5B7FA 3LBCA 1QRNE 1ZY9A 4XGZB 1M6OB 1WA3A 4ZYKA 4IOIB 2FJGA 2YAQA 5F7DB 3BZEB 1SQ7A 2OZ8A 3N2CA 1NP0A 2EILB 3FBKA 3EDJA 3GKWL 1ZSDA 1XMEB 1FVCB 4M6OL 2ZDSA 4JFYB 3EYVB 4EPDC 4HIXH 2Q8AH 2JWYA 3BQ5A 3UC0H 2J47A 1FGVL 4X4YB 5I66B 5ICYA 4QO1B 5FCZA 3DGGA 2CYGA 4JFOA 3ZVIA 2HK1A 2X89A 3HJZA 3SOTA 3TU6A 1HXMB 3K46A 3W6YA 3H7BB 4UNTA 1MRQA 2R0WL 1FLTX 3KM2A 5BZAA 1XS2A 2ZTBA 3S8HA 4DUOA 3CFDA 3TWYA 4PS4H 2VFIA 3PYCA 3QUKA 4DKFL 3FONA 3PWAA 4BGDA 3RPKA 2VUKA 2WWCA 1TTRA 3LIZL 4YL2A 1VBHA 3OW1A 3G6JF 1NCGA 4DEFA 1G6VK 4DK3A 5A69A 2BVOA 5TH2B 3TSBA 1OKEA 3QUZB 2A0NA 4UQAA 4G7QB 4YXHH 5CPOA 1H8LA 4QRTA 3I68A 4BI5A 5D1XA 2ATPA 3QH2A 3TVMC 2YOCA 2AVGA 4OTXH 2ICSA 2UVFA 2WSKA 4JG5A 5I03A 1JTPA 1S7XA 4FA8A 2WWKT 2DQFA 4TUOA 2UX6A 3GJFK 3KW7A 5IDZA 1TEGA 2DQJL 2V7HA 2NY4D 4BFGA 4YNGA 1ZVSB 1M7UA 3M16A 4ZUSB 1B3OA 1KB5L 4MOZA 2AZUA 2Y5SA 2F6AA 3AXHA 2E9GA 4LUTB 4PRHD 5HR6A 4YXKH 3BUPA 2J44A 1HNGA 5D2LB 5EWIH 1TTUA 3S48A 2VLJE 5CP7B 1IBGH 2QKIB 2A99A 2CPUA 1EAQA 3OAWA 5XIAA 3WZ0E 2PO6D 3QRGH 4WV1B 4XZNX 3ESPA 3D5HA 4X5WA 5KANI 2GQ8A 4INFA 3HRZB 3AY4A 4LB8A 1TG8A 1KBWA 2YWYA 3IETB 3V0WH 4MKTA 1A5OC 3CUFA 3T3PE 1MWAB 3C2VA 5C0AE 1JZJA 1GEHA 1QNOA 1Q7ZA 1NKRA 1SGJA 2F53A 3F7PC 1O60A 3RVWD 5M2FX 5FEZA 3BVUA 1PEZA 3JVGA 4IQEA 2C15A 5TPWH 5FB8B 4H9ZA 1RJCA 1DEEB 2XZ9A 2H7WA 5HYJB 5DANA 1WAAA 5EU3B 4PJFA 1E0XA 3KPSB 1TTFA 4GQQA 1NJ9A 1XTMA 4A3HA 5SWQA 4S23A 2AEWA 4L0PB 3TOYA 4WU5A 5BWAA 3WK0A 2K7PA 1XH0A 3IJHA 3UR7A 5F2LA 2WJEA 5I2IB 3PJSB 5KS9B 2PP3A 1TZHA 1JI2A 3NCJL 4AZHA 4LHUA 4E5XA 1HEJC 3BGFC 3W7IA 2I17A 3F7JA 7CGTA 3QYCA 4BHYA 4KNUA 4Y19A 5I8EA 3LHPH 4H25A 5BS0B 3TXZA 2R29L 3V9FA 4CGUB 1GW1A 3H7VA 3AABA 5IFPA 5U4NA 3RLSA 2I56A 4NQEE 1SXCA 4KK9D 3FULA 2YDSA 4DTGL 2JF6A 1LJYA 6XIAA 5MHSD 3ZPDA 5M95B 5AVZB 4U1JB 1SN2A 1P0KA 3EDEA 5IHUL 2VXTL 1TKKA 1AIFA 5C0BD 2JNZA 4O0KA 1KYAA 2QT6A 2X7LB 2O30A 4H6QA 5DVOA 4M1RA 1FYTD 4N6EA 4XZWA 3ULVF 1KFEA 4LAJH 2A83B 2JI1A 4ABUA 4B90A 1BXBA 5HHQA 2E6DA 2DJUA 1A7PH 1O6VA 4OCYH 1CVRA 2GHWB 5DUBA 3M0JA 1A9BB 4WUKL 1CQYA 2ARJQ 3Q44A 2FIRT 3O45A 2ICEB 4DRSA 1ZV9A 1XBRA 3WOVA 4DTGH 1KLZA 4C4KT 4GRLB 2AL2B 3MV9A 2QLYA 3GZQA 4EI0A 5C54A 4EN3C 4B7LA 2Y22A 2I60H 3EJCA 3MUHL 1D3CA 3M5VA 2YPLE 3ATEA 1KENL 2J55A 1EGVA 4OUEA 3DKHA 2HPIA 4CDHA 1VIWA 2NY5L 2XPGA 4JTHA 1MHHA 4X6DF 5DJYB 5D1ZB 1GOKA 3SBPA 4K8RD 3ULUH 4S38A 2JJTC 2JK2A 3MRFB 3MP4A 3LHTA 5L0QB 4LCUA 1QSFB 2P5WE 3MUJA 1A7QL 1M71B 2W0UA 2ZONA 4QRPA 4LSVH 4WGWB 4R7XA 3O4LB 4KEZA 5HVGB 3TJIA 3KR3L 4YEEA 4XGZA 3BIAX 1XZ0B 1U1UA 1DXEA 1MW0A 1XYMA 5LXEA 1F3EA 3EBHA 5F7DA 3BZEA 4ZFFB 7TIMA 3AWNA 1HCVA 1FVCA 2VJ0A 4JDBA 3KWXA 4Q6IA 3V95A 5KYWB 4JFYA 1I2OA 3EYVA 1Q2RA 3TNNA 3NQVA 2BY1A 3PG9A 3X3GL 1WWWX 2YD1A 4JIPA 2AEIT 3G6AB 4QO1A 2CIIB 3UYRL 2WN2A 3ILQC 2NQJA 4IBZA 2P8BA 1HXMA 4AE0A 2XWDA 4Z7WE 4EUPH 2HRGA 2K45A 1NINA 3C60D 4D8ZA 3N5AA 3O6LL 3K2IA 3V4PH 3V4LA 4KZ0A 4EF3A 1KLYA 3BXNB 2P9RA 3KR3H 3DMMD 1A64A 2EPHA 4M93C 1PX3A 4EO5A 4UOW0 1A8ZA 4ODXA 4IGNA 3KJ4B 3HTWA 1JCNA 4V1DA 4AH2B 5F9WC 5D7JD 2R94A 4OLYH 2VUNA 2MPAL 1ZANL 1CGUA 4Q8MA 1S5VA 3NA9H 1QHOA 4O0ZA 3G1RA 3T9WA 3GD1C 3UAAA 1Y8BA 2ZZ1A 2CKNA 3SODB 4ZB5A 4N2HA 1KLFB 1GZPB 3MZTA 5T1KA 5EO9B 3R0DA 1ONXA 4AMKL 5LSMA 4CJ1A 3H8NA 3W07A 4NQXB 3WLSA 2E6FA 5D9OA 1T6WA 1XLIA 4MXVE 4US5A 4K38A 3TX9A 5AB3A 1R87A 1C8QA 1IGFL 4CQ9A 1YQVL 5C0ND 1X7TA 5EORL 2Y06L 3P74A 3V4UL 3NO5A 5FDWB 4ALAH 5IHSA 4N3TA 3KTXA 5KANG 3S2LA 4LBEB 2VLKB 2PRHA 3BFQG 1GYUA 4KTYA 3WFZA 3IEAA 1NGQL 3MANA 1HF6A 1NH6A 1ZVSA 2I7OA 1F5ZA 2XDHA 2GDUA 3H2AA 1XPGA 4LUTA 4LVNB 2H3NA 1NLBL 5ABGA 4MGXA 2DBLH 3QPXL 1JNJA 2CD0A 3QGAC 3UYCA 4KC3B 5CP7A 3H4WA 3BIKB 2VSDA 4PY8J 1CXLA 2QKIA 2J8GA 4F9PC 4AZCB 2DP3A 4ENED 3MLYH 1HO1A 4WV1A 2HLFC 3MBXH 1LJMA 3HRZA 5FYJL 4C56D 4TQTA 1IKNC 3MYZA 2OXNA 4K5MA 2CR6A 3IETA 4HHHA 2E7HA 1MWAA 1NFGA 5TQ2L 4S0TD 4NO2B 4DGVL 1IKOP 3KXFB 3ICJA 2NR6C 4TTDC 1AZZC 3IN0A 3NFNB 4H9UA 5IWLC 5A6MA 1WS8A 1VPXA 2OG9A 1SBSH 1TZIA 4E0CA 2GGGA 2GYIA 4YSQA 1XFBA 1DEEA 5T1DH 4I13B 4K7PX 4NQDD 5HYJA 5EU3A 4A6YL 4AYID 2WJFA 1W9DM 4DWSB 1YEGH 3KPSA 1WHOA 1RY0A 4A8RA 3F62A 1IQWH 3QXTA 1QSEE 4P07A 3VYNA 1M2VB 4ONHB 1ADQA 5G2HA 3ZE2F 5I2IA 3PJSA 5KS9A 4PLJD 3GMRA 4E2OA 4F8NA 3H4GA 2GSIB 4WTZG 3N11A 2O5XL 4UTWA 1OSPH 1MZRA 3MKVA 2DI9A 4DP2X 5BS0A 1P69B 2WWKO 3UJTL 4Y2LA 3T0VA 4P5TB 4WK2B 4Z2KA 5A2CA 3G1YA 4Q6KA 1XGRB 4O4YH 1FO0H 1FX6A 1L8PA 3C2YA 2ALDA 3I65A 1HDMB 3LEVH 4DIXA 3ZZLA 5H37G 4G43B 3L4YA 1ACZA 4U1JA 3H55A 3NPSB 3X3FL 5T5FL 3H2QA 2HNHA 3HB9A 4FQPA 1KTRL 1I9JL 2X7LA 3RPDA 3G0XA 3KPQB 3NVQA 4NZCA 5CWSB 1RFDH 2P76A 5ILTL 1PG7W 1EX5A 1B4KA 3IFLL 3SGEI 3ZYIA 3GDRA 3FQNB 3GB7B 1WD8A 5B22A 1CR9H 5IGXH 4Z2LA 2ZF8A 1JGMA 2UXFA 5FHBL 5CPMA 1A9BA 1BYOA 4NZ8A 4DGUA 1QVBA 3T7VA 4IM4A 2ICEA 3RLVA 3S5ZA 4GRLA 3GYCA 5DK3A 3QC6X 2F38A 2GVYA 3K74B 1AYRA 5GGTA 3M0ZA 5I5IA 4CDGC 3UFYA 1YSOA 1CXFA 1LILA 4PRNB 4FLSA 2VCOA 3SURA 1OF8A 5F21B 3VPLA 2J12B 2BGNE 1S7UB 3KCOA 5DJYA 5D1ZA 3RM9A 3F03K 5ILTH 3E3QC 4PS8A 3MRFA 2EE2A 4N25A 1XYFA 1RUAL 3MRJB 4LCIL 4HPYH 5D4QA 4R34A 1M71A 3MUY1 3V0DA 3O4LA 3GFZA 4FQ2L 3CB3A 1PYFA 1ITUA 1WCQA 1XZ0A 2H3DA 4IFKA 4ZFFA 2OW6A 2QAPA 3ES7A 1FA4A 1TZAA 2YQGA 3H4FA 4IT1A 2HFEB 3NOEA 5DD0H 4P2OD 4HPXA 1UEYA 3BPOC 3QAZB 5FL0A 3DH7A 3FPXA 4FQ1L 4YLCA 3X1BA 1G7IB 1G1YA 3G6AA 1M6UA 3U9WA 5L2JA 2DEXX 2GVLA 2NYYD 2OM5A 2VZSA 1UZ1A 5A6BD 5DUPH 2FB4L 3IVUA 2IDQA 2X4OB 3S9DB 3RWFB 3BPLB 3VM7A 5HDRA 2O93L 3A22A 1BXAA 2JKPA 1XV8A 5BRZB 1XZWA 2WSRA 1NEPA 4YBQC 2E40A 3D85B 3WUWB 2Z2UA 4WZ9A 2Z9TA 4FOMA 4YE4L 3BXNA 3WLOA 3STBA 3MV7E 3UBXB 3L54A 3V6OE 2FX7L 1KJ3L 4JHZA 3HURA 2BNRA 4PTUB 3LPOA 4PH8A 2H0FA 4NQSB 3BESR 3K71A 4GJIA 3CUZA 3HZ3A 3G3DA 2VEGA 3E2QA 4AH2A 2P3YA 5GGUB 5I8CB 2FEJA 4C4KO 5FCSH 4Y16C 2WO5A 2IKGA 3QP3A 1QRND 1L6FA 5CZKA 1RZKC 5EO9A 1TR1A 3B37A 4NQXA 5AWNL 3VFPB 1K8YA 2DQHL 2D3JA 3PTKA 5DHEA 3Q2VA 1MFAH 2ABBA 4RX0A 2X4PB 1FZMB 5F1OB 4JHBA 3B03A 2V9QA 3WNJA 4UV4H 4XCNB 4WKZB 3W28A 2AW2A 5D5ME 4I0PB 4F2BA 3BSZH 2NTFB 1OM9A 5FDWA 3BFOA 1KJMB 3V2AR 2RFGA 4LBEA 2VLKA 1CYWA 1ZT4B 4NN5B 1CQKA 3MU7A 3BZFA 5I6LA 3TFCA 1NWRA 1F7BA 4M5TA 3V0GA 1S1PA 2BOEX 3UXIA 4X4KA 3NBNA 2ZG2A 2Q9OA 2Y36L 2X12A 5CSYA 4RSYA 3U4AA 4L1BA 3ARGA 3BIKA 3STZB 2BHFA 3UJ2A 2I14A 4AZCA 1X4ZA 2X9YA 3FRUA 4NIRA 2V5KA 3ZR4A 3E0GA 4RA3A 1OT4A 4KEMA 1BEYH 4KK5C 1M7XA 1TIUA 3C9NB 4WI5A 1HW6A 3MREB 3GVVA 1GR7A 1HQ4B 1YJDC 4W7VA 3KXFA 3L65A 3B9OA 4O2FB 4JCLA 4S1QH 2BX5A 3W11D 2BWIA 3NFNA 3DO3A 3MNWB 4LT7A 1M1SA 4DQOL 2XN9A 3H8AA 1N5YH 3RMEA 2YZ5A 4HISA 4DWSA 3LZLA 5C0CE 1FORH 4FXGC 2XWRA 3ZJAA 2RH0A 4ODVL 1OCWL 3D2UD 1LUCB 2AJXH 4YOKA 3WDIA 2JXMB 3QORA 1DBAH 4W88A 1M2VA 4PUEA 3ARXA 4ONHA 1AL7A 2WTRB 2MHAB 4JDVB 3RDTC 5DZAA 1TQUA 4QYOB 5K69A 4U1NB 1BGXH 3E5PA 2GSIA 4FNPA 2Q3XA 3A67H 3NPVA 3I6GB 4B3KA 4EI5C 2VLJD 5BUGA 1JPGA 1LOLA 3TOPA 4RK8A 4P5TA 2GUYA 3LYRA 1S1RA 5FWRA 1XGRA 4BEUA 2QL1A 1AG6A 2DU2A 1KGIA 4W9ZA 4EE2A 1HDMA 4TVPE 4UT6H 4G43A 4A68A 1YY9D 4J3OC 3H3PH 4MD5B 5EMKA 3C2FA 4OR1A 1MJUH 3QV7A 3MLXH 1S5NA 2NNAB 1ONWA 5F1SA 3KPQA 3GC4A 5MI0C 1MREL 4KZCA 5CWSA 4HWBH 4Y5XB 1XVSA 4HLEA 1E4NA 2GBTA 2B0SL 2WQVA 4Q8UA 4RZKA 1EP3A 2F1BA 4ZW7A 1IXNA 3USZA 3FQNA 3GB7A 5DJAB 2R1KA 5HI5C 4JTRA 2OELA 4AWSA 4V2BA 4TOYL 4XPBL 1T04B 4DZBB 2ZZ3A 3KZSA 1LL1A 1WKYA 1ADDA 1EDQA 1I0BA 2ZCLH 1QLRB 4QF1B 2R0KH 2IGLA 4FJYA 1YN7B 3CE1A 4KEVA 1SMAA 2DQUL 4JM0A 3DWTA 1OGGA 4HSOA 2PW2B 5IQOA 4PRNA 3MI2A 1DXFA 2PDGA 5L7XH 1UOKA 1QTWA 3MCLH 1SM3H 1S7UA 4OZGE 4XMLL 1JCMP 4NQED 3U46A 1BZQK 1WJ3A 5FF6B 5JHLL 4M24A 3IE4A 4OCNC 2VDNH 4N9GB 4HC1L 2D1ZA 3C0LA 1NCAL 3ZDZE 1DBBL 3AM8C 5EMYA 1EPXA 4JUSA 3FQUB 2OGYA 3GMQB 2HFEA 1M9HA 4FL4B 1QPRA 3QI9B 1O7DC 4I18C 3SO3C 1IGJB 3B04A 2NVAA 2GJ6D 1G7IA 4PGCB 2IQAB 4CAGA 1C16B 1ORSB 2E6PA 3UACA 4F8QA 4YSAA 3NQ6A 4J6RH 2Y1VA 1WDAA 2ADFH 3QARA 4YR6B 2X4OA 3RWFA 3P4MB 2R4RL 5L9DL 4FEIA 5I16B 3WLRA 3C2SA 2DOCA 5BRZA 1NUDA 3U8GA 4ANUA 4N2CA 3JYCA 5EOQH 1J5OH 3D85A 3WUWA 4P2RB 1BQSA 4NGHL 1V55B 4OIIH 5D8WA 2X0HA 5CZXD 4CGTA 1DBBH 4WWKC 4ZMTA 1FA2A 1OK6A 2PDIA 4DKEH 1HHKB 2BIQA 2D3LA 4TNVF 4PTTA 4H7ZA 5LIKX 2ALAA 2ED6A 4G5AA 4MFDA 4PTUA 2YOAA 4NQSA 1QRQA 3EB4A 1A4JB 3GI9L 5GGUA 2BDNH 4LAUA 4U6TA 5I8CA 4GUHA 5TE6L 1JDFA 1P1MA 1W72L 1I9RL 3SSJA 3U1PA 3F2CA 3UJEA 1GOWA 4U1GC 4P8UA 5FGCB 3H7UA 1JAKA 3PN8A 4KHXH 5EEUA 4F57L 3PGFL 4FMKA 2GDVA 2NQ9A 1F1DA 4HGKC 3VFPA 4S39A 3QPQD 3DESA 5E4IA 2X4PA 1FZMA 1POJA 3N15A 4XCNA 4WKZA 4I0PA 2NTFA 3GO1H 4TM9A 3T4AB 2OBGA 4M81A 3HR5B 1KJMA 1JGUH 1P2CB 2BZCA 4FALA 3AXLB 4OM0H 4JQVA 2I9EA 5KTEH 4QEEA 1CU4L 3A4JA 1G69A 5IJCC 1ZT4A 3SADA 1XKJA 1EUTA 3SQBB 4DJEA 1F18A 4F0SA 1L4IA 4P7QA 4O2EB 4F7MB 4JPVH 2YR1A 12E8L 2KKQA 3LJ3A 4JIIX 3ARFD 3WIHA 4NN6B 5F3HB 1W56A 2YD8A 1VZGA 2WBKA 3STZA 2XQYA 2XYCA 1ZDQA 2AXGB 1AS7A 1RA5A 2WBJB 5EG6C 4A7TA 1N6QL 1FH5H 1HWGB 5DQ9B 1RZKH 4HKZB 1T41A 4KWSA 5GS1C 3RPTA 4JRLA 3MREA 2OMVB 1U3HC 1YPIA 4M19A 1JV2B 1RZ7L 4BJHA 1HQ4A 5GJTL 5E9DB 3FW6A 2YBTA 1A7BA 5BOZG 3S83A 4O2FA 4DI8A 1NFDF 1YBQB 4FABH 1JUFB 1ETJA 4AK1A 2GK0B 3MNWA 3KBFA 2VISA 1KB5B 2WIIB 2OMWB 2CR3A 4NYLA 3OYXA 3H6JA 1Q5MA 1ZHKB 1LUCA 1TX2A 2JXMA 3UTSB 5GZND 1BWLA 4EDWL 2X3AA 4QRSB 4POYA 1GGTA 2WTRA 2GSJA 3R0KA 4UTTA 2MHAA 2HCVA 4JDVA 4HBKA 3RGVC 4HHMA 4TO8A 3PABB 4U1NA 2CO2A 1GGBH 1OIOA 3I6GA 4R7OA 1N64H 1YJDH 5DD5H 4BD4A 1ME7A 2XFRA 2WINB 3BX7C 4IM8A 1YEHL 4B6ZA 3DFTA 2IKJA 2X9XA 2F8IA 3AXXA 2D2JA 4HBQA 5HINA 1S7WB 2BNUB 1X5LA 4RGMB 5KW9L 4FX8A 1WX0A 2TRSA 2QDGA 5D1QC 4QY8B 3W0WB 4RJEA 3CWOX 2GWGA 1RAKA 2NNAA 3WG6A 1PDZA 3SGDI 3PWGA 1C9SA 4UTUA 2B7QA 1FP8A 1W5NA 4Y5XA 1WFUA 1EPFA 2Y6SC 5JHDE 2DY2A 1QWHA 3VI3E 5F7KC 4BKLA 5IFHL 5DJAA 5JYMA 1N4XH 2CLLA 4X2PA 5AYXA 1A5SA 4PJBF 4FXLA 3RY5A 3W1MA 1T04A 4DZBA 1RV6X 2ITFA 3HLAB 3K80A 2E7FA 2VDGA 1JRHI 3GH4A 4HHPA 1QLRA 4QF1A 1MI5E 3O6CA 2ZOTA 1YN7A 2O0TA 3LXCA 2WNZA 3BTNA 2VZVA 2BP3A 3FPYA 3G1AA 4J3OH 3PNUA 2CXGA 3RAOA 3SPJA 4GABA 3FZUD 4P49A 1SZNA 1PCSA 4M7KL 5A8QA 4AW4A 4LB4A 5JA8B 2OODA 5ITBH 4K3ZA 1W80A 5F2GA 1ECEA 1OTSD 4PJIF 3TYEA 2ID5A 1A4AA 5FF6A 3UJJH 3WF2A 1WNOA 3S1GA 5K4XA 4N9GA 2NW0A 2NXZC 3MTWA 4YVVA 2KX9A 3UABA 3O6FB 3PL6D 4E36A 3REWB 5FHAH 4ZR8A 3KEDA 1RVGA 5AOJA 3FQUA 5IHLB 1TPXC 2ZYHA 4L65A 3MXVL 3SGGA 1T7ZA 3GMQA 2YEVB 2ZYFA 3QI9A 3GHRA 3NNTA 3CXOA 4P5KB 2OEKA 1IGJA 5H8DA 2PI6A 3A5FA 1TZGL 4JJHA 3PUGA 4LVHC 4LCWD 1UR3M 5T91A 3O63A 3ZKXB 2IQAA 1F8MA 4GLEA 5EMUA 1JZFA 4JKMA 2P8CA 4ZE5A 3L4TA 3S42A 4YUEL 1UHVA 1ET7A 5D9NA 4YR6A 2FDMA 3P4MA 1E6ZA 3IMWA 2G3MA 3IXAB 2IQ9L 4GBXD 5I16A 1KBGH 3RWCB 4ZYKB 4B4HA 1K77A 5ALBH 3F4VA 4C6QA 3VSTA 5CC7A 2JCCB 1JVNA 3SZKC 1HHKA 4Q8QA 1XQKA 3Q2NA 2ZOKB 4OGQC 1EVUA 2BERA 5E2WL 3IUHA 1A4JA 2FFIA 2Q3OA 4Z7QE 1H0IA 4YO0B 2KPWA 1NM9A 2Z1VA 4G83A 2ADAA 3IM1A 3QIUB 1RUMH 3TWCH 5JPMC 4XVOA 3FSOA 1XGYL 4LU0A 4YHYC 3GXTA 4GJJA 1Q9LB 3J2PA 3RHWK 1CFMA 1A6ZA 4GOSA 4MWFB 4S1RL 2HG0A 5A2IH 4LVDA 1WB0A 3ZVHA 4G8IB 3T4AA 4Y2WA 4N1HB 5D9SB 3HR5A 1P2CA 4QRFA 1E2WA 3AXLA 1BFNA 1P4BL 3L3JB 5IBXC 4OZFH 4OD1L 4BRJA 2IOOA 3LIZA 5EU6A 3OZMA 2FBJL 1JXFA 2ACSA 1X4XA 5JW4M 3SQBA 3I3BA 2BWGA 1CBJA 2QT3A 4GGBA 3DUGA 4U1MA 3IIPA 1QWGA 4QRTB 1KXHA 2EYSB 3UBXI 4O2EA 2BGSA 3OHXC 1UURA 3WQEA 4HH8A 1KXQA 5LG1A 3GU9A 3RUBL 1IAII 1ZJBA 4LF2A 3VFRA 3LN9A 4Y90A 2YLKA 5F3HA 4C47A 3KVJA 5E24E 3SW6A 4K7PL 2AXGA 3GKFA 4JM2C 2WBJA 1NQKA 1OOAA 1ODAA 5DQ9A 4HKZA 1S7XB 4IHBA 4HOMA 2VVSA 5I0ZA 1F90H 4P3CH 5DHYB 2E68A 3LDBB 2OMVA 4J3XA 4H6EA 2ROYA 5L88H 3UDWA 4FFZH 4FEZA 3CQFA 5E9DA 1V8HA 1OX6A 3PWVB 1YBQA 4WGHA 1SDDA 5GVJA 4I5UA 5F9DC 4LNYA 2A85A 2GK0A 2WP3T 1L5GB 1W54A 4Z3TA 1KB5A 4IIQA 3NIGF 2BY0A 2OMWA 3FTUA 1EDGA 1OK0A 3GLZA 1JNHB 3PSWA 5HBBA 4N4QA 3VFSB 5AYYA 2HPMA 1W1PA 3AZTA 3UTSA 4KHTH 5EMJA 4QRSA 1D9EA 1R3LA 4WUUB 2H2SC 5GRXG 1A3ZA 1BQUA 5ISZE 4MA1C 3F4NA 2D7MA 1QPPA 4GNJA 4LPVA 3PABA 1R4XA 5D37A 1C9DA 5JMOC 2Z31C 3S5LB 3DG7A 1PPIA 3UU0A 3RTQC 4Z77B 1QA9B 2DEWX 4JPWL 3TQPA 2GKIA 3EKGA 3WLNA 1QZ1A 1YO4A 4LIQL 2WINA 3NZ1A 4LLWB 2PTDA 1WBXB 1X6NA 1MRDH 1EOKA 4IF2A 1U8LB 4XPHL 5DFVC 4Y8DC 5IQNA 1THFD 4OCMC 1WA1X 1S7WA 2AKRB 1AG0A 3S4SB 4A6YB 3ONCA 2RIKA 4BHUA 4LQFH 1TQCB 2QTVA 2UY5A 1FHLA 1FFQA 3W0WA