3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
2OSWA 1HKIA 3IK2A 3QOMA 5IHRA 3DHPA 7TAAA 5ABFB 2ZX9A 1TVNA 2WZIA 4PMQA 2BY3A 1KTBA 3AHZA 2AMGA 1ESWA 1ODUA 5FOOA 2Z1KA 2DSZA 2NT1A 3D4ZA 1G0CA 1ZBVA 3VD4A 2J78A 3WUBA 4W5UA 3ZOAA 3W28A 4JFWA 1M7XA 1CDGA 1TG7A 4UOJA 1HI7A 1PS2A 1KTCA 2WHMA 4CN4A 3AFBA 2FGZA 3UG3A 3WNOA 5GNZA 2A3HA 2NT0A 1R7OA 3EJTA 4J7RA 3KLKA 4JCLA 4BQ3A 5A2AA 2EXOA 3VU2A 2O9PA 3AS2A 1W1TA 1ZU8A 1JFXA 3PZVA 3WQ8A 1D7FA 3D5HA 1CXFA 2PB1A 1WCGA 1C7SA 1BQCA 4ZXLA 3KEHA 2D3LA 3UERA 3SUWA 3WDHA 2WZHA 4P8WA 1V6UA 4MB1A 2B31A 4E2OA 1C3FA 4GI6A 5CPSA 4GO9A 1J9YA 3AIUA 5ECUA 1QNSA 1E6ZA 2AOSA 4HU0A 3CLWA 1UD2A 3ZJKA 2EEXA 4L4PA 2X0YA 3KL0A 1KR1A 3EJRA 2PI6A 1IV8A 2EABA 3LXCA 3T0AA 5BXRA 2YL6A 3AYRA 4P7RA 3EMQA 3AQUA 1GVIA 4J3XA 2JEQA 2ZX6A 2VUYA 2CEQA 3SCSA 2WMHA 3UESA 1JDCA 3WDJA 1WDSA 3WN6A 3SCPA 3W24A 4NZJA 3SCTA 1W9BM 2VX7A 2ZUVA 1EDQA 1BG9A 1HF6A 3MSGA 1EIBA 1EGZA 2WMJA 2ZX8A 2VMFA 1TQWA 3N13A 1MW0A 4JZ5A 2PC8A 1DWFM 4U3AA 3HN3A 1PAMA 1JZ6A 2ZUMA 1I1XA 4MDOA 2CPUA 5TD4A 3HG4A 4AD0A 1TVPA 4J3UA 3RM9A 2Y8KA 1K9TA 4TOQA 1MYRA 4QP0A 3RM4A 4TUFA 4CD8A 3RCNA 4AZ6A 1KGXA 2DH2A 4CU6A 3EMCA 4UFJA 3WQVA 3NDYA 3MMDA 3SCRA 1PS3A 4HZ6A 5D9NA 3OGSA 1U2YA 2WB5A 1W9UA 1JYVA 1ZB5A 1E40A 1QI2A 7A3HA 5I24A 4J3SA 6CGTA 1BGGA 3K4AA 3OZOA 1G9HA 4NI3A 5A8MA 1V3MA 4YN5A 1GCYA 1TUXA 3VSVA 4NSBA 3LXAA 1PX4A 3VM7A 1J0KA 1AQHA 5M03A 3KLLA 3SUUA 2DPEA 1NOUA 4WKFA 3BH4A 3N04A 3HG3A 1J01A 3WMSA 1XHGA 4UFLA 5CPTA 1FH7A 3MKKA 3OZPA 1J0ZA 1V0NA 1UD8A 4EKJA 1QVBA 4ACZB 1KQYA 4JIEA 1V6YA 4M8UA 1E9TA 1JAEA 2UY3A 3T2QA 1J0IA 2V38A 3AIWA 4IPLA 2D0HA 4IUGA 1NOWA 3RILA 2DT3A 5BYWA 2CXGA 2Y24A 3LMYA 1X6NA 3RDKA 5A8QA 4QLLA 4UCFA 1CGVA 4M29A 3LX9A 1K9FA 1LL4A 3W6LA 5CZKA 5A6LA 7CGTA 4FLSA 4JL2A 3PTQA 1JXJA 1M53A 2ZE0A 3WH8A 1SZNA 1BVZA 3MMUA 2BXZA 1UA3A 1O6IA 3U5YA 4JFSA 1W3HA 3POHA 2XGIA 3WNPA 2IGTA 2WWDA 4U3CA 1CPUA 1GOKA 1TQTA 1MW3A 1E56A 3ZSSA 1JNEA 2XG9A 4JHOA 3WFLA 4AISA 2WANA 3TA9A 2VO5A 5JIPA 3ZSTA 5DT5A 5A8PA 1PZ2A 3TTSA 1VEOA 3CC1A 1WP6A 4NXKA 4W89A 1GOOA 3WDPP 3BLPX 3OA5A 3A24A 3QHOA 4OIFA 2G3IA 1E4MM 1UR1A 2WXDM 1WZLA 1ZJBA 2X0HA 4FK9A 3DECA 3ZQ9A 2JALA 5LA1A 4MAVA 5EBAA 1JZ4A 3F5KA 2YDSA 5E6ZA 2Y8VA 2Y5EA 1P6WA 5FL1A 4P8UA 2WZEA 1GOMA 4M81A 2WLYA 4J3TA 3SURA 3VKKA 2XVLA 2GJXB 4MNMA 2OWCA 4W5ZA 5AYBA 2PBGA 3W27A 5FIPA 3A22A 4AYSA 1L8NA 4HOXA 2CBIA 2E9BA 1V6WA 1UD5A 4A3HA 3D52A 1W1VA 1XC6A 1FA2A 5I79A 1HP5A 2D24A 1OBAA 3S5ZA 1XYZA 2V3GA 4WSKA 2CESA 1KXHA 3VGBA 4F66A 1A3HA 1V3IA 4OJYA 2YJQA 2BVTA 2F7RA 5BWFA 1E43A 3S5YA 4URIA 4D6GA 1I1WA 1JZ8A 2GJRA 4AIEA 3BAXA 4CCEA 1UKSA 2DIJA 1EOMA 4ZE5A 2WHKA 1N82A 3VNYA 1YHTA 4OBRA 1W1PA 4L4OA 1HJXA 5F7UA 3EBVA 3BC9A 2OYKA 1CEOA 2WMFA 3GXNA 1ISZA 3TV8A 1TA3A 1FP8A 4CKQA 2OSXA 3PHAA 4UOQA 4HU8A 3AIEA 4RE2A 4MADA 2YLLA 5A6SA 1NWRA 1XV8A 2XHYA 1M04A 2BVDA 1GQIA 3SUSA 3CZLA 5HPCA 1H49A 1B3WA 1V6VA 2WVVA 3T08A 1CWYA 1OM0A 1C91A 1BSIA 3QHMA 4TVCA 2G41A 4GQQA 2WC7A 1BYBA 5BROA 4E4PA 2VT0A 6A3HA 5EFFA 2FGLA 2WNWA 3QR3A 2CKSA 3BGAA 2E8ZA 1W9PA 3K1DA 2E8YA 4GZIA 3CMGA 2GVYA 5C71A 3CGTA 1CXLA 2BV9A 3UG5A 3FHQA 3MS8A 3VMOA 3HG5A 1VFFA 1H0GA 1NWTA 4B15A 3AZTA 1WE5A 3VD5A 2GSJA 3OLIA 3OBAA 3PZQA 2G3MA 1JF6A 1WDQA 3I3EA 4UFKA 2QHAA 1HVXA 2ZWZA 4LGXA 1JF5A 1ZBCA 1UKTA 1UHVA 5HDRA 1SYTA 4IISA 3EJUA 3OGRA 3BUPA 4OUEA 3W26A 1QWNA 2EAEA 3D4YA 4Z2KA 5AY7A 1W9XA 2ZXDA 1H2JA 3UCQA 1E6QM 1E4NA 1B2YA 3CPUA 4P7OA 3WDRA 2J62A 1HJSA 1PPIA 4V27A 3A5VA 4W93A 3BCDA 2CBVA 1H4PA 3KZSA 1QHZA 1E70M 3TTQA 3EMZA 3JUGA 1MVYA 3VDBA 3AMDA 2BHZA 1WB0A 1AQMA 2YL8A 1R8LA 1VRXA 3N9KA 4WK9A 1JDAA 2E40A 3ALFA 2VZOA 4AYGA 1W3LA 3FNDA 3WBAA 1KXTA 2DSKA 2X1IA 4C7GA 1WNOA 2CCRA 3ZJ6A 4CD5A 1E1FA 1ITXA 2WW5A 3MUY1 4HMCA 4Z2LA 1BG4A 2WVTA 2YA1A 4KRTA 3L4UA 3FAXA 3WEZA 4P7LA 1UR8A 3VDCA 3L4XA 4TVDA 5I77A 1E1EA 4N42A 5IDIA 4FNRA 2GDUA 3MSDA 1LQ0A 5BXSA 3RJXA 3VDHA 2W91A 1HKJA 3NSXA 1XSIA 1TZ7A 4AC1X 5A6JA 5D9OA 2XWEA 2G3NA 3VGGA 4OOUA 1SMDA 2ZICA 1VEPA 5E1QA 1V3KA 4CVUA 1V3LA 4AZIA 1OT2A 2YBUA 1AMYA 4M82A 1LG1A 1TMQA 2YDRA 1PSPA 2D73A 1EXPA 1XSJA 5IXEA 1DEDA 1MQQA 1PJ9A 3FHAA 2D2OA 2WBKA 4F9JA 4V2XA 4PSRA 4AZCB 2O9TA 2WMGA 2VCBA 4PMXA 2EJ1A 2ESCA 3BVWA 3GBDA 3KL3A 3ZT6A 4D6JA 5M5DA 9CGTA 3A23A 2WSPA 3MMWA 1E5NA 1ODZA 1E0WA 2CIPA 2WHLA 2YL9A 4UQDA 2BY0A 4P7QA 2W66A 2PBOA 1LF1A 4BQ5A 2E4TA 2F1AA 1BAGA 1HP4A 4PMOA 3LPGA 3WH5A 1CGTA 3EJPA 5DMYA 2DQXA 1M01A 2VOTA 4FNTA 4YHGA 4CU8A 1TQUA 1OIMA 3DX1A 3PBGA 1GJWA 3CBWA 4LPCA 4TX8A 2VQTA 3LRMA 1XCXA 5D8ZA 4W85A 1J12A 2E0PA 1NP2A 1BVNP 1VB9A 1E6RA 4AD5A 1VFUA 3A4WA 3AIVA 4ATLA 5A8NA 4ATWA 3PZMA 3BAKA 4UFIA 3WSUA 3L4YA 2O9OA 1QNRA 4MJ4A 1CGUA 5DFAA 2CHNA 1JFHA 3NDZA 4PCTA 1ISVA 3W4RA 4FLRA 5JUVA 4XV0A 1QWUA 3H53A 1B0IA 3NYDA 3OB8A 3PZUA 1B3YA 2BHUA 1GQJA 3WD2A 2X8RA 4Y7EA 3VIOA 4JKKA 3AYSA 1XH0A 2J7CA 3CZGA 5DEZA 3RPMA 1KR0A 1MW2A 1C93A 4QCFA 1KBBA 3PZNA 5D4YA 4A3YA 1J10A 1E9LA 4P8XA 4GZEA 4NRRA 3ZM8A 3K8LA 1UOKA 3W81A 4ZENA 3T0DA 1XCWA 1PIGA 3ZO9A 3I3BA 3NUKA 3VVGA 3VIPA 1KXVA 3VD3A 3VM5A 2XM2A 4PTXA 1J0YA 2EO7A 4AZ5A 4HMEA 3AISA 2BXYA 4MNJA 3W6MA 1CXEA 3N17A 1MXGA 3AMLA 4PRWA 4LYQA 4UFHA 2VR5A 5HOSA 3N15A 2V5DA 4YHEA 1B1YA 3NJ3A 1B3XA 5GNYA 1JIBA 4H7VA 1VIWA 1RP9A 3VSUA 4OZOA 2JF7A 1C8XA 2F7OA 4F9DA 4DWSD 3MO4A 3BLKA 2ZUUA 2FYVA 3K8MA 3WMBA 3GBEA 4Q22A 3WD1A 2ZXBA 2CKRA 2PWGA 4UQAA 1W9VA 4AY1A 5BRQA 2W62A 3VUPA 2X2JA 1BPLB 3KE0A 2VCAA 2YA0A 4XB3A 1EO5A 1UUQA 1Q6FA 3IJ7A 3WKZA 3WUFA 2XTKA 3GDBA 5CSYA 1EHNA 1QW8A 5D8WA 4JFVA 4HZ8A 2J7DA 3SIMA 1MFUA 2CERA 3QHNA 1R46A 3L4WA 2A3BA 1UWRA 3VINA 4BS0A 1IZKA 2VTFA 2A3AA 3ARPA 3W25A 1NP0A 1E5JA 1ISXA 3LPOA 3M7SA 1C8QA 1CGYA 3VD7A 4JAWA 2XIIA 3NIYA 4WKAA 3MUIA 1EOKA 3DC0A 4ACYA 1D3CA 3BAYA 3WEOA 1X1NA 3AIRA 1UYQA 1HXJA 1UR0A 2WHJA 2A3CA 4JKMA 1NM9A 4W8AA 3WDQA 3VIFA 4CVWA 4GI8A 3UEQA 1QNOA 2XVNA 3BAJA 3OGVA 4MAZA 1QPKA 1NARA 4DWSB 4J27A 2EPMX 1H11A 2VR4A 2NSXA 2VI0A 1LL6A 1KCLA 4D1IA 2DH3A 3VIMA 3ARYA 2W61A 2GDVA 3GXPA 1RD6A 3U7BA 4AMXA 1W32A 5FKYA 4CUCA 2J25A 4X0VA 2ZOXA 2ZUTA 3MU7A 1HL9A 4H8HA 4DO6A 1W1YA 1JYNA 1MQRA 4W87A 5A69A 3WH6A 4W7WA 2J74A 1K6AA 2XYLA 2GJPA 1PIFA 3HG2A 3WF4A 3APGA 4P7NA 1NWUA 1FH8A 2IUZA 2XSBA 3DX4A 1CENA 2RGMA 4D72A 3BLBA 4Z2HA 4W84A 3L4ZA 1GORA 4ACZA 1F4AA 1XYFA 5I0DA 4AXNA 3AHYA 3IAPA 1UWQA 4PMZA 2Z1SA 4FNQA 1KCKA 4PMVA 5CQ1A 1HJWA 5AC4A 4K68A 2VCCA 1JAKA 1UWUA 1V6XA 2BY2A 3VIJA 2QF8A 1OD8A 2E9LA 3N1AA 3WH7A 4B3KA 3CV5A 4BA0A 1R7AA 2CITA 2XN1A 1BTCA 1BF2A 4DUXA 2D20A 4PMNA 1NQ6A 4DWSA 1R33A 1GJUA 3DX0A 1E4IA 3WMCA 5I78A 4MPKA 1ZS2A 1KWKA 4S3KA 2EACA 2PSPA 1CGXA 4R5EA 1Q6CA 1WAWA 3DX2A 3SCOA 3BMVA 3EYPA 3VOCA 3WH9A 1ISWA 4HOWA 4B9YA 1US3A 4KWUA 5E9AA 2YLAA 3VIKA 1E0XA 1RPKA 3WQ5A 1TE1A 3T2PA 5KEZA 1UQYA 4BCEA 1O7AA 3SEPA 1CTNA 1TCMA 3ARUA 3W29A 4PMUA 2X05A 4AW7A 1GOQA 4NZFA 3BVTA 1HL8A 5M3WA 3WELA 1VBRA 2ZXAA 3BVXA 4MTVA 3CZKA 1E6NA 2W92A 1EQCA 4UZUA 1KGWA 3A21A 4M1RA 4F79A 6TAAA 4WKHA 2XIBA 3F5LA 4PTVA 3MANA 1UQZA 4HTYA 2D0GA 1KGUA 3CZSA 2WCGA 2Y2WA 5JIWA 3DYMA 3BVUA 2C8NA 4CD4A 3ARXA 4H41A 4H2CA 1HKKA 2OW7A 4CN6A 1QNPA 4PTWA 3OLEA 3AHVA 3CIVA 2EQDA 3ZT7A 1Q6GA 4CCDA 3H55A 1GNXA 5A6AA 4KMQA 1SR0A 1R47A 2D1ZA 3I3DA 3FXYA 4UZSA 3AXIA 1Q6EA 1E73M 5E70A 3RMEA 1J11A 3WF2A 4WSJA 1B3VA 2QV4A 3GNOA 3H54A 4DUWA 1BYCA 1LWHA 3PTKA 2XFRA 4Z2JA 2OWWA 1WO2A 1GQKA 1EDGA 1ISYA 1W3KA 4N0RA 1FP9A 3BVVA 3BUBA 4AZHA 4JHZA 2WK2A 2EPKX 5I2UA 3GTNA 5BCAA 4DO5A 4DO4A 5BRPA 1E3ZA 1TFVA 1XH2A 2JEPA 1IT0A 5ABEA 2F18A 4GO8A 3BCFA 5CGTA 3M46A 2WPGA 4HA1A 1ITCA 4KGJA 3W82A 1CLVA 3ALGA 1PE31 1G94A 4JCMA 4ZFMA 2WVVB 3M6DA 4EANA 5I6SA 2VZUA 3WEMA 2CYGA 4ZEPA 4AEEA 4LYPA 1KFWA 4J3VA 2PWDA 1PX3A 1CGWA 4M56A 3SUVA 1UKQA 1VAHA 3IJ8A 3ZJ7A 1QI5A 2DT2A 1XSKA 1B3ZA 2XVKA 3MI6A 1E4LA 3LXBA 2BFGA 2E9MA 3SCWA 4XX6A 2ZIDA 1GOWA 4C7DA 5JBFA 1H1NA 3T0BA 1R87A 4DUVA 3WNNA 2J79A 2OWXA 1H0IA 4GPNA 4W86A 3CHCA 3L4VA 2YFOA 2O92A 3B9EA 2YA2A 3EDJA 4CD6A 3WF1A 5DF0A 3OIHA 4LX4A 2YFNA 3AS3A 1HNYA 4W8BA 4AIOA 1UZ4A 3BXWA 4PN2A 1OB0A 4H8UA 3L2LA 1DWAM 1C92A 4E8CA 4D6HA 1UZ1A 1VEMA 2WYSA 3THCA 2FH6A 1US2A 2X2YA 1WZMA 2WSKA 1Q4NX 5DO8A 2EADA 1CECA 3VTRA 3M07A 1JD9A 3VX1A 5ABHA 1I75A 1V08A 1FH9A 1W3JA 1DWGM 3QOKA 5FD0A 2OLHA 3WL0A 1XD1A 3OLGA 3OG2A 1DHKA 5A6BA 2W4XA 2WKLA 2XPKA 3GXDA 2JE8A 3MUAA 3PZGA 2ALWA 2IXUA 4JKLA 2CHOA 2VJXA 2YL5A 4GKLA 2X09A 1VBUA 4PEEA 2F1BA 4MB5A 2WC4A 4HA4A 4UQEA 1B90A 2MANA 2UWFA 4J28A 2DSVA 4FLOA 1GHSA 3AROA 1JYWA 2QLYA 2DT0A 3W0KA 3GXIA 3GNPA 4TXEA 2CBUA 5E0CA 2VX4A 1Y7VA 4NX0A 4UQ9A 4B9ZA 1BYDA 1EQPA 3CH9A 1VFMA 2YBTA 4QAWA 3SUTA 3EJSA 1KBKA 2J7FA 2FHBA 5CLWA 2DEPA 4AD4A 4UNIA 3RJYA 3THDA 5C70A 3GH4A 2OYLA 5EB8A 1QOXA 1MFVA 5E6YA 3K46A 2JIWA 3AZRA 5KZ6A 1C90A 2XSAA 1AVAA 4GI9A 3B9AA 3VGFA 3WNMA 2BY1A 2F7PA 4YPJA 5A3HA 2EPLX 4EE9A 3WDIA 3HMCA 2ZUWA 1QI4A 4CCCA 4TTUA 1T0OA 1DP0A 3SCUA 1UKOA 2RGLA 2VNCA 3S6TA 1Q6DA 1ZBWA 2QMJA 3GXTA 3KWXA 2F61A 1E6PA 4DM2A 1VFOA 1LJYA 3BUDA 3AMCA 2VVNA 5A6BD 4BQ2A 5ABFA 1HXKA 3A4XA 3BAWA 5LA0A 4EK7A 2WCAA 1TR1A 5CSUA 5HNNA 2BHYA 1VJZA 3WY4A 3A6OA 1UR2A 1OGGA 2XVGA 2XFYA 1LL7A 2FH8A 3ARSA 4AWEA 4BQ4A 4CD7A 3AHXA 4NF7A 1XRVA 3CO4A 2G3JA 1J18A 4KGLA 1JGIA 5JBEA 2V5CA 4RE4A 1KB3A 1W2VA 1E0VA 1JZ3A 3CZ8A 4JFTA 1GHRA 3MV11 3ZR5A 3N18A 1JZ7A 4MB3A 3ARZA 1L0PA 2VRKA 2HVMA 5D9MA 1D2KA 3CHDA 1QI3A 4U5IA 1OWQA 4S3JA 1B9ZA 4AMCA 4WLCA 2XGBA 2EPNA 3GXMA 1EHAA 3WD4A 1OD0A 2FDMA 4PSPA 3VGEA 5A2BA 1E55A 3DDFA 1CYGA 2FE0A 1B31A 2JIEA 4TTGA 3WL1A 3QGVA 2BS9A 1UD4A 3WY3A 1V0LA 2X2HA 3VSTA 4H04A 4LYRA 4AD2A 3RIKA 3VIGA 4HP5A 1V0MA 4PUEA 4BF7A 1GUVA 5IFTA 1CNVA 3IANA 1SMAA 3B9DA 3K4DA 1JL8A 1UR4A 1VJSA 1K9EA 1UG6A 3F4VA 4MNKA 1UWTA 2NW0A 3WIJA 4HMDA 3L2MA 1OGBA 1XGZA 3U7VA 3W53A 2DT1A 1JZ5A 2F8QA 3HU7A 4PMYA 3VO0A 3BMWA 3WF0A 4RL3A 1WZKA 4QFUA 1QNQA 1K9DA 3O2LA 4UQCA 2OYMA 1QBBA 1FHDA 1ECEA 1KWGA 3W38A 3GZAA 3TP4A 3CMJA 2BVYA 5M17A 1M03A 2CNCA 1HX0A 5IFPA 1JI1A 3WF3A 1WDPA 1U33A 4ATDA 3ARWA 3AXHA 4HPGA 4D6EA 3WBEA 1GW1A 1FFRA 3AMGA 1QI0A 2OW6A 2ZX7A 1CLXA 2WC3A 4D6CA 5A95A 2HISA 3AIQA 1GZJA 5A1AA 1HTYA 4PTMA 3VD9A 2VZTA 1FHLA 1X6LA 4X9YA 2GUYA 2DDXA 3TTOA 1UKPA 4H8VA 1C7TA 4U2ZA 1CXHA 2X2IA 4AIUA 4UTFA 3U5UA 1IZJA 1V02A 3WNKA 3PZOA 4IM4A 3T09A 1CZ1A 4U5KA 5EMYA 2VRQA 3GM8A 4X0NA 5BXPA 2F7QA 1JZ2A 4WF7A 5A2CA 4B3LA 3J7HA 3WD0A 8A3HA 4OOZA 4D6IA 2VX6A 3IAQA 5E09A 2IXVA 1MQPA 2ZUSA 3VDAA 4J3WA 1HN1A 1VENA 3PZIA 4W8LA 2V3EA 5AYIA 3CZEA 1CXKA 3VMNA 2VC9A 2VZSA 4KRUA 2D3NA 2UY2A 3K8KA 3AJ7A 3S2CA 1JG9A 1GQLA 3D50A 3ZJ8A 1GOIA 4Q7NA 1EH9A 3CUFA 1TQSA 1W9DM 1MXDA 1RH9A 3EDFA 4GZJA 4CU7A 1JD7A 4RE3A 1W2PA 4QCEA 1WDRA 5ABGA 1OGSA 1KXQA 4D6DA 1QHOA 5GQBA 2VVSA 1V02E 3ECQA 3D3AA 2VX5A 3ARQA 2J7GA 5CGMA 2J8FA 1EO7A 1JYXA 3FY1A 3EDEA 3IGUA 1EDTA 2WMKA 4MDPA 4W7UA 1HJQA 3TONA 2DGAA 2J7HA 1PEZA 1V3HA 3CUJA 2V3FA 1JDDA 2VURA 4FNSA 1WZAA 3ZT5A 2C7FA 3UR8A 3WENA 4HZ7A 1R86A 4MJ2A 5D9PA 3ARTA 2XM1A 5LA2A 3OLDA 3FN9A 2G4FA 4AD1A 3UR7A 4QLKA 1V0KA 3CZNA 1W91A 1ZL1A 1GVYA 4HPHA 3IJ9A 4D1JA 1KQZA 4A4AA 3DYOA 5EFDA 4ML4A 3VMPA 1R85A 3EDKA 4PCSA 1G01A 3WUEA 1VF8A 4HOZA 1A47A 5A94A 5HPOA 5CG0A 3AIBA 5I23A 1J0HA 1XH1A 3CHEA 1QX1A 1CIUA 2VRJA 4PYSA 3II1A 4NZCA 1PX8A 3E1F1 2EPOA 1TA3B 3NSMA 1CXIA 5CLTA 4ZE4A 3GYCA 3WD3A 3GXFA 1H3GA 1GPFA 1E6SM 4GQRA 3W37A 4GXPA 3VIIA 2WBGA 4HA3A 1QBAA 4QDMA 1ZJAA 2PWHA 4PMRA 3N12A 4DWSC 1OSEA 5HBFA 1UH3A 4C7FA 3FAWA 1FOBA 2F2HA 2XFFA 4XZBA 1CBGA 1BLIA 2WAGA 1V3JA 3BUQA 2CETA 2J7EA 3G6LA 3MUZ1 4W88A 5FCZA 1R34A 2YOCA 4LXFA 1HJVA 3BAIA 8CGTA 2DSWA 3AI0A 1E71M 2ZWYA 3BUIA 4AMWA 1BHGA 2ZX5A 2J8GA 4FMVA 3A4AA 3LPPA 2AAAA 4JL1A 2WM0A 4PMDA 2PWEA 1DWJM 2XUCA 4IPNB 2J77A 3AOFA 5GPRA 5CXPA 2W67A 2ZUNA 4AZGA 3PN8A 2D22A 2J4GA 3AZSA 1E3XA 4TX6A 3VIHA 1Z32X 3FW6A 1H5VA 2GFTA 1ZBKA 2ZXQA 4AZCA 3AMKA 5IHSA 1OT1A 4UQBA 4OBSA 1UH4A 1J0JA 1DTUA 3L4TA 1WKYA 5A6KA 2V3DA 5C8BB 1OINA 2D23A 4M80A 4DM1A 2Y4SA 1MWOA 3SCVA 3TOPA 3GH5A 1QW9A 4AZ7A 2DIEA 3DX3A 2Q8XA 3AS1A 2QPUA 3AICA 3MV01 4Z2IA 3VGHA 5AC5A 4QLJA 4U31A 4EAMA 1HVQA 3T2OA 1G1YA 3DHUA 2QMKA 4UR9A 3VPLA 1G5AA 4NRSA 1DWIM 2XWDA 3AS0A 4MB4A 2WVSA 1NWSA 3WFZA 3WY2A 1JI2A 3DDGA 5HXMA 2QPSA 3NCOA 2J47A 4XUYA 1UD6A 4AEFA 1QHPA 2WKGA 4PBGA 2CBJA 2J7BA 1F4HA 4OKDA 3ARRA 3ZR6A 1BFNA 4B16A 3N11A 2XN2A 4UOZA 2VZVA 2YKKA 3O6AA 2YDQA 3HZ3A 2WWCA 1BGAA 2WMIA 5E0FA 2WMIB 4BZYA 1H09A 5GNXA 3RM8A 3GH7A 3BSHA 4Z2GA 4F8XA 3LRKA 1HJUA 1YQ2A 4W7VA 1BYAA 2XVPA 3U57A 2G8ZA 4AZBA 1R75A 3AHTA 1OIFA 5A6MA 3VNZA 2TAAA 3SCQA 1LWJA 3LRLA 4U2YA 4NXSA 3WNLA 3PZTA 2W63A 3WQWA 1UR9A 3WUGA 2DSUA 4FLQA 1AQ0A 5FL0A 5CJ5A 1H41A 4JFUA 2D0FA 2PWFA 3B8SA 2JF6A 2XJ7A 3A47A 1FFQA 2GK1A 3PTMA 4V28A 1U30A 4E8DA 3SCNA 3VX0A 4MNLA 1GONA 3WQ4A 2FHFA 3DYPA 4P8VA 3LPFA 1LG2A 2WCSA 3CUGA 3PZ9A 2GK1B 3EDDA 1HWWA 4AD3A 5I5RA 4ZXOA 3WQ6A 3TTYA 3UG4A 2VL4A 3CTTA 4UFMA 1UD3A 1RP8A 3ZMRA 5A8OA 3HJEA 5I3DA 3GNRA 1UASA 2VQUA 2WLZA 1UWIA 2YIHA 1HKMA 4XZWA 2FHCA 1MW1A 1UWSA 3EJQA 2UY4A 1V03A 3POCA 4LQ1A 4WIWA 3O9NA 2BNJA 2GJXA 3VILA 2XN0A 1B30A 1S46A 1E6XM 2A3EA 4WJXA 2EBNA 5CPQA 1PCPA 2E3ZA 3RO8A 4KH2A 4CGTA 3F5JA 3CUIA 1JXKA 1UA7A 2OSYA 4GIAA 3VGDA 3AXXA 1DWHM 1LLOA 4GINA 5DT7A 1TQVA 3CZJA 1XD0A 4TVUA 1JNDA 1NOFA 4PUDA 2UY5A 2O9RA 1NH6A 5LYRA 1HT6A 5BXTA 3ARVA 3BSGA 4FNPA 1PZ3A 1O7DC 1E72M 2WVUA 1HIZA 1SFSA 3A3HA 4R27A 4CN1A 4FNUA 3NSNA 1UH2A 4OGZA 4M24A 1WPCA 2W5FA 2PF0A 3CHFA 4U33A 5JBDA 4FF5A 3WY1A 2C0HA 3D51A 1PBGA 3UETA 3G6MA 1C8YA 4D71A 3CUHA 1EA9C 1E15A 2J75A 2JFEX 4D6FA 1OCQA 3ZIZA 3KL5A
chains in the Genus database with same CATH superfamily
2NY3C 1C5BH 1ASQA 2PETA 5H8MA 3QFJA 2DL2A 5ABFB 7TAAA 2DEXX 3KRUA 4PMQA 1IO4C 4WTXA 4P5MA 1KTBA 2J1KA 4AVIA 3DG3A 2AMGA 1ESWA 2WLLA 5IB3A 5AG9A 3R11A 3U8GA 4ZO9A 4PHXA 4BWUA 5EHFA 5FB8B 3F7YA 4Y4KC 3RAJL 1ZBVA 1QTSA 3EO1B 4Z3HA 1LBMA 5I74C 1ICQA 3VAEA 4B41A 1K4DA 4N0UE 3CFCH 3WUBA 4NQCE 3QEQE 1HE7A 1GCFA 2H90A 2NV2A 3IJEB 4GRSA 1MVUA 3FCGA 4MF4A 2ZCGA 4JFWA 1F3XA 3RPIA 3JVFC 2F9BT 3CFNA 4GRLD 5IQLA 1TG7A 2CNZA 5AYQA 1U9KA 3Q9QA 3QG7L 4M6NH 4JDZB 2QVKA 1IR1A 2OO6A 1F97A 2TSYA 3H4XA 3MCYA 25C8H 4YMPA 5D2LF 5GNZA 1OHQA 4LU5L 4JRYB 1DANU 1TVBA 1N8OE 3HBPA 3ATFA 2OMZB 4HUWB 4XAKE 1T0MA 3QB7C 3WJMA 2YZ8A 4DVBB 4JCLA 4LEXL 2EXOA 1QFUH 1EA0A 1ZHNA 1OVDA 1ZU8A 1E9OB 3QZWG 4E4UA 4FC3E 3N85H 3ZPDA 3WU1A 2XU2A 1HE8A 3MBEA 2LW3A 4XG1A 3U36B 3TW6A 5H4ZA 2DI7A 4I9WE 4NUPA 1FGNL 4OB5H 1IF2A 3PUGA 5HYFA 2NW2A 2ENSA 5EZJB 2XICA 3WLWD 1WCGA 4IFKA 1XGPA 3C60C 2Q3AA 5KSWA 2GTWB 1KIQA 5GRWA 3O2VL 4PJ7F 3V8OA 3WDHA 4UTHA 5EU9A 4UQ2A 2BFVH 1L0YA 2P43B 3TCLB 1V6UA 1TJ0A 2C14A 3R8QA 1TZGH 3CT7A 1OFEA 3LH9A 4E2OA 1C3FA 3GKWH 1UJTA 4GO9A 2FQDA 4AL8C 2VERA 5JYLA 5FWQA 2VIRA 1TYGA 4J4PD 3EUUA 3PDDA 1KM4A 3C6LB 5AW1B 4ICCX 4JIRA 3QIWB 1NWPA 4N3UA 4HU0A 1TKWA 1UP2A 2R29A 3SQOL 4GRWB 3ABGA 2AJVH 2EEXA 5DJYA 4JN6A 4L4PA 3ITXA 1DVFD 4G70B 3TO2B 1RZJL 4X60A 2FPYA 2X0YA 3QCUH 4YQXL 2PI6A 4DF9A 1IV8A 5CIPA 5I28A 6XIAA 4BKLA 2Z35B 5BXRA 2BVWA 3CTLA 1ZANH 1WK0A 4HZLB 1LMKA 3AYRA 4Y2NA 2H0JA 1YYCA 2ICWJ 1NAKL 2O6EA 5FO9A 1KPUA 3QIBD 3UFYA 1GVIA 4PLJC 4J3XA 1GGOA 2QVMA 1KTLA 3NQ6A 1G6RB 2ZCLH 1G1OA 5FV1L 4N2EA 1N26A 1U42A 2JEQA 2ZDRA 5E5MA 4M5PA 2DQJL 4WNQA 5BMWA 1CFTA 2YRPA 3SRHA 1BJ8A 2CEQA 2QCMA 2AEPL 5BVJA 3SCSA 3QHZL 4HKZA 3ZTJH 4LBRA 1P4IH 1AZVA 5FX3A 4BZ2L 3CMOL 5E24E 3PQYE 3WN6A 3ULUD 4IBWA 5D7LB 4HJ0D 5FHAL 2GSGA 3SQRA 4L64A 2GKIA 3SCTA 1W9BM 3ZDZB 1FWAC 3IRCA 2FO1A 5IMKB 5EA0H 4GY1A 3D34A 3PJSB 3BK0A 3TYGH 2A9NL 3VI3E 3TN0D 4ZNEA 1ZA3A 4GFXA 1KJVA 1M2VA 5ETUA 3UEZA 3N6HA 1X5IA 2ZX8A 1MW0A 2DQFB 3QJZA 3SDYH 4GJTB 4GG6A 3Q3GB 1MCOL 3LYRA 1VFBB 1YEEH 4GUOA 3N25A 4RIRB 4L0YA 5BZDA 3W2DL 1JZ6A 4BV1A 2YARA 3MO1A 2CPUA 5C0BE 5TD4A 1UZDA 1VFAA 3DROA 1TVPA 4JDYA 4Y5YA 2GJ6B 3UYOD 2P8PA 3ZVVA 1LP6A 5KZDA 4N0YH 3EZJB 3RM9A 2WXJA 4K94L 2KYIA 1FZJB 1ECYA 4NZUH 1E0TA 5JNYB 3CH1B 2GC4C 4PY8I 1T1WB 3MX0B 2AXFB 4L1SA 4RAVA 4DWDA 1GGCL 3CYJA 2P0OA 1RSCA 4UFJA 2Q87A 2V30A 2FO8A 4KVCL 4MRBA 3D3VA 4NO0A 5BW7C 3PAYA 5E5UB 1F3WA 2CZFA 2PR4H 3YPIA 3QRFM 4HZ6A 1J8HE 5FJRA 2HJKB 5E6IB 3NCBB 1OGAA 4L1TA 4ONHB 5T3ZH 4Q0XH 3QJXA 3SR7A 1YN7B 2DQWA 3Q6FA 2OBGA 1MCCA 2JB5L 4HGKC 4Z78A 4QG9A 3FSAA 4J3SA 5D7LE 3PPCA 1MJ7L 3N1MC 3HR6A 1R0AL 1OGAE 1OCCB 3KP1A 1W1ZA 4N5UA 4N5ED 4XMVA 5EB9A 4F9PC 3OTTA 4L05A 4Q56A 1V3MA 3T6VA 4A67A 5E8NB 1H9DA 1K4HA 2QAPA 4YN5A 1XPYA 1QYGL 2I07A 2QPFA 2QADB 3D39A 1GCYA 5EULV 3TWAA 3QEQA 2WO3B 4GG6F 1YEWA 3LIZH 1PX4A 1VIZA 5FF7A 4MMZB 1SXCA 2DWEB 5IFHL 1J0KA 1AQHA 4AT6B 1LO3L 3KLLA 3PQYA 3ME0A 3SDCB 1PG7X 2XX0A 3BT0A 5IVXF 1OOAA 2OL3A 3LN4A 4ADIA 5DA4A 1GHFL 3DGRA 2Y0SA 5IK3B 1R17A 4HBQA 4TSBL 5F93C 4LSSL 5DI8A 1N6VA 2CK0H 1GWJA 2ZRUA 1QMUA 4M5YL 3VWKA 2Q20A 1V6YA 1SJAA 3LKPB 4FQ2H 3KDNA 2B7OA 4N2MA 1YMYA 5TBOA 3A4JA 2NZIA 3FU0A 3GSXA 1VERA 3AIWA 2J72A 1YYAA 2ICWA 1MLBB 2MCG1 3BW4A 3MZ2A 2ZYSA 4P9HL 2Y24A 2XIDA 3LMYA 1X6NA 3MBXH 4KT2A 3ZLQC 1OP3K 4QLLA 5A8QA 4UCFA 5ALBH 4XAWH 1AW1A 4A7VA 3GHSA 1RCYA 1I9IL 4L5ZA 5LIWX 3G24A 1XR9A 1ZT1B 4F2MA 5GRUL 3AYTA 1ME7A 4AVKA 3W6LA 4EXAA 2WXPA 4ZPTA 4Z7VA 4OZHB 7CGTA 2IJ0C 5HDLA 4X7SL 1JXJA 2YPLE 3GD1C 2A5HA 5LCVH 2E27L 3REVA 2Y06H 1M53A 2FUQA 1JPEA 5E1GA 5D09A 1KJ2A 1NFKA 1JHTA 3MMUA 5GS1C 4PW3A 1CO1A 1O6IA 3UZEA 3HHRB 3OJGA 2RAMA 1TITA 4NQDD 4KK5D 1HEHC 3EH4B 3Q6FB 3GUWA 3F3HA 1PKLA 2J73A 5EG6C 1SSDA 4GISA 1Z3RA 3BPCB 2VDLL 4I87A 2GZXA 1A7RL 4ZMVA 3FO9A 3T0WA 3FBKA 3LRSB 2BNQE 4IKNA 3RZCD 5LBSL 4X6BB 1NZRA 1DORA 4H7CA 4ES4A 2EH8L 1GH7A 2OMVB 5IBXA 4KW2A 3QJTB 3QI9C 4CDHA 2C1PB 4NNCA 3COOA 3LKQA 2Z6JA 4TPRH 3GR4A 4BUGA 4O1CA 4N0UB 4WY0B 4F0KA 1ZPTA 2EDEA 5T3ZL 2IAAC 2IDFA 3VOGA 3O3EB 1E56A 3X12B 4AISA 3EX3A 3KVPA 3HEIB 3VAVA 3ZZLA 2MKWA 4GJ1A 1FYTE 4GYBA 3GVQA 5IVOA 4OZFG 3L3HA 1P7BA 2RFGA 1UT1A 1SVBA 4J3OC 1XISA 3NACH 4JANB 4GXMA 1QBLH 4X6BA 3HPLA 4UTTC 5BQ7B 1DVUA 4XE0A 1WP6A 3FRPG 5DD1L 3WLRA 3V55A 4FQLH 2R51A 4X6FB 3OL2A 4NXKA 4Y5VC 3VFTB 4WENB 2CRMA 2ZBTA 2APBA 4LBUA 1QEWB 2OTUA 1XMEB 3ILQC 5KSBF 1XF2B 1GOOA 5C07A 4EPEC 1TXKA 4OIFA 2FZ8A 2ZG3A 2VSCA 2EG6A 1U92B 1WZLA 3KPRD 4GO6B 4Y4FC 1QFHA 3UWUA 5HQEA 3GC5A 3BKCH 5DHMC 3O3UN 1KEMH 1EAQA 3SD5A 5KSBB 1JZ4A 4U1IA 2XV0A 2W0FB 4LRTA 3TJXA 1D8WA 5IBXC 1R2TA 3FB5B 3BIAX 3T6ZA 2J8UB 4R6UA 2Y8VA 4LPXA 3AALA 3B4NA 4P8UA 4Q74A 3QUXC 3QCVH 2L4OA 1ZVSB 3VU1A 1ETZA 1G0DA 4Y5YC 1J79A 1S7VA 2WQVA 2X0SA 1JNLL 3K13A 4WHDA 3SKMA 4IG2A 4ZB5A 2Z28A 1B2WH 2CRIA 5FR3A 4JHBA 3O3AB 3WG7B 4EVNA 5IB1A 4LY8A 4NO3B 4P2RA 1QABA 5ISZB 2ZRYA 3EYSL 1OWWA 1PBYA 1X3DA 3P4NA 4HJFA 4GAJL 2HMID 2NY2D 3TO2A 4E41D 4XD6A 1L8NA 1SFTA 4GIEA 1G6RL 2CBIA 3GB6A 1UD5A 2ORBL 1W1VA 4LHUA 5AW2B 2YUXA 5GZOC 1FA2A 1MFCH 2CBMA 5JIHA 3S4SB 2P5NA 3JT2A 4LEOA 4IF2A 2N7BA 2DWEA 1RXOB 2E6AA 4LVAA 1XYCA 1MVFA 4GKOA 4P04A 3S5ZA 4MJJA 4PGDA 4N2YA 5ICZB 1E3FA 1KXHA 3VGBA 2ICEA 5EEZA 4PTTB 2P80D 4NQEB 2ADYA 3NK4A 3K1KC 2L7JA 2DYRB 2P5ED 5DS8B 4Z7WB 3APFA 2YLHA 4OCNC 4OJYA 2HFTA 1SGJA 3STBA 3RTLA 1P2CB 2WUCL 1QPRA 3QUKB 3T3ME 1RZJH 1I7RB 1SRDA 2BVTA 2DQUH 1KLUB 4R97B 3S5YA 3J07A 3ZN6A 4MXVF 4AX7A 5D7JA 5T1MA 4JPKL 1ACZA 3U36A 2ZTJA 1D6EB 1KULA 4R9OA 1Y18A 2SEBB 3BYTA 1K85A 1EBHA 3RFZB 4IGBD 1X6UA 3S9DB 2ZUYA 3ZE2B 5DYFA 1XLKA 3F2CA 3ZE0F 3OF6A 3CD4A 3OWRA 4JW3A 3HRZB 1CN4A 3E2HC 4XI5D 3QZNA 4XMZA 3BZEB 3B9OA 2AJUH 4NG3A 3STFA 3L5WA 4LLQA 1EOMA 1VCGA 3VNDA 1X5XA 5ABZA 2R2EB 3KZPA 4X6DE 5C0EB 3QZWB 4L4OA 3LKRB 4XPBL 2GSIA 1KFAH 1TPFA 4JN1L 3WUZA 3NJJA 5H94A 1CEOA 2P8PB 5KZCD 2WMFA 3ARBD 5K59F 4A35A 3HFML 3W0WB 2BP3A 3L95A 3QUHA 3TV8A 3CAFA 5FYJH 3UXFA 4AGOA 1ISZA 1G7IA 1D5RA 3TBTB 2OSXA 2YEQA 32C2B 2R2HA 2CBTA 1CK0L 2ZAIA 2CJUH 3HZKA 3Q2WA 4LJ3A 2OX5A 4KKAD 1IEIA 3RI5F 5C3IA 3CHQA 3NJGA 2BZDA 4LCUB 3WKNA 5JHDB 2EE2A 2JB6A 2OXGB 3QEHB 5C9ZA 4WO4A 4M6PA 1WSST 3A4EA 1T83A 4JN2A 2ODIA 3CZLA 1E8XA 2E6QA 3KDOA 1KM2A 3GBML 2WVVA 3PANA 2VDPL 4E36A 3T08A 5BV7H 2O56A 3W7QA 5HY9B 1MI5B 4PJ9B 1CWYA 4PGBA 4MSWB 3ZE0E 1BSIA 5IREA 1EEXA 2OYPA 5HR6A 3QHMA 3QO1B 1XLCA 4LOUD 4C6IA 4GQQA 5DEFA 3ULVE 4IIGA 4HKZB 5CC6A 5KN5A 4K2SA 2N1KA 4NKMB 1Y1UA 1FLRL 3CE1A 5ABAA 4Q9CA 1QYGH 4N2OA 4N9BA 1F45A 3VRLE 1F6KA 2CR3A 5AOZA 4A63A 2BOFX 2CKSA 2GQ9A 3VI4B 5I3JA 4M3KB 1BQLL 3VXOA 4ZB2A 3BGAA 2B3RA 4E9YA 1UZHA 4HMNA 1W9PA 4QI3A 1NC2D 3AW5A 2IF7A 1A4LA 1HXMA 2GVYA 3MA7B 3KZ8A 5EEWA 3B2VL 3T2LA 3QAQA 3SGZA 4KAQL 4LVOB 3FHQA 4L3AA 4GQGA 3OHIA 4ETYA 4FABL 2AABH 2OJPA 2NSQA 1NWTA 1IBGH 1TTJA 2R1KA 1AG0A 2VEIA 1JCJA 3G3DA 4F2BA 5D7SH 3E8UH 3AZTA 3VD5A 2IBZX 3SZKC 2B7NA 3FHEA 5FEPA 4MA7L 4NWTH 3FB5A 3AG1B 1T80A 3OBAA 5DWUL 2CIIB 2RFXA 1LOLA 1WDQA 2ABAA 3PZQA 4HBCL 4G5DA 4OFPA 3IM1A 4QO1A 5HHPA 5IOKA 2F38A 2FWUA 4PBXA 1A5NC 3EGXB 4M7LH 3G1YA 5KZEA 3EO9L 1ZBCA 2P48B 5FM4A 3EJUA 2Z1PA 2BH0A 1AJZA 5GRVL 4GXVL 1G69A 3MUCA 3OQ8A 2HVBA 5G4HC 6XIMA 4MXVE 1P7TB 1A6PA 1BOGB 2NXIA 4B2DA 5EN2B 3QLLA 1I3GH 4IJ3B 3K6SA 3S35L 1FF5A 3PBVA 3L3OC 4Z2KA 3UCQA 2QAFA 1CFVH 3M5VA 4LUSA 3GB7A 2WBXA 4ONHA 1YE4A 4A8RA 3B3DA 2DM3A 1E4NA 3D2UD 4F0HA 4B9JA 1VACB 2DYPB 2GJNA 3SM0A 1OP3H 1TX0A 3T3MB 3AXLB 4F0LA 2C19A 1Q1JH 2PDMA 3ESNA 1IGIL 4R7DA 2XPZA 1SFLA 5FF6B 1KCZA 2Z0IA 2J62A 4YL2A 2AQSA 5TE6H 4V27A 4BHUI 1D9KB 1RBOB 3HQNA 1BGXH 3M17B 2OA9A 1XQKA 4P5RA 4PJAF 1S9XB 1E70M 2ZG2A 4G6AC 1COBA 5AAMA 5RUBA 2OKOA 1MVYA 4HCHA 2BHZA 2X4RA 1WB0A 3VZYA 5J04A 4M7JH 1AQMA 2ONEA 2APTA 3COTA 2YL8A 2IALB 3H3BC 2WNZA 1U8OB 5IROC 2FIQA 4ADUA 4PWEA 3KXFB 1R8LA 2C16A 2CD0A 4TQEH 1NUFA 2V0TA 5KYUB 4RCAA 2JXMA 2Z8RA 4PJIA 5E03A 5B4MD 2E09A 4WUUE 1GPWA 5F6HJ 1BLNB 1AG1O 3KBVA 4FX6M 3K91A 1IGSA 3FUEA 2FJSA 1GS7A 4C7GA 4HWBL 2J55A 5E2UL 5KSAB 3GR8A 5BW6A 4N8UA 5CJXA 3DXAB 5BWAA 3QUZB 1ITUA 3WLTA 5L6YH 1I1RA 3IMUA 2Q2LA 4R4BA 1EKOA 3PNWB 1JZDC 1ITXA 1JVLA 3MUY1 4HMCA 4O2FA 1I8MB 4GOAA 1BG4A 2WVTA 1XHHA 2YA1A 4A38A 4Q6YA 4DVRL 2GK0B 2UZYB 5KSBE 1T2QH 2VABB 2INFA 4NYYA 2YAOA 2XRAH 3WEZA 3AXMA 4KK6C 3N2OA 4X8JB 2TPSA 4PJGA 1UR8A 3PV7A 2HYMA 4NQXB 3VDCA 5IVXA 3K6DA 4GKZA 1SUXA 2YW3A 4IJCA 4EO5A 2HV5A 4MWAA 3PIQB 5FEZA 1MFMA 1MI3A 3EX1A 3U6XS 2ED6A 5H35A 4KCVA 1MZZA 2EG7A 5ID1B 4EAYA 1G4RA 1EDHA 4OB5L 5B1JA 1A25A 3OKLA 1P4CA 1Z9AA 4NAFA 3L3DA 4IU2B 3GYEA 3SPHA 3EKLA 5CFAA 5DUPL 1P1XA 4XPFH 5I06A 2AJYH 3FH8A 4F5CE 1EAJA 1E9YB 1G9MC 2FWOB 4XPHH 3S96B 2VEMA 4FQJL 4LGXA 4O14A 3MV8D 1P1ZB 5FO8B 1ROCA 3AT9A 3I50H 5D9OA 2EYRB 3I84A 4UIKL 3ULUF 1I8IB 4L18A 1AR1D 3T44A 4R53A 1SEQL 1SMDA 2OLAA 5HGHA 3KPRA 3B03A 1E28A 2HJLB 2WYHA 3C5ZB 4PJBA 2DQHL 3S3DB 3AM8A 1X4YA 3IFLH 5IHHA 2V5KA 5CR8A 4NASA 4ENEC 1OOWA 1LO0H 1JXGA 4NQQA 3UT0A 4AZIA 1OT2A 1ED3B 1T7XA 2PW1A 1EQWA 3W1LA 1TOXA 1F3EA 4BI6A 4R4BB 1ADSA 3VQMA 4IOSD 4KRPD 2DZSA 4LLWA 5EU7E 3EOAB 4N2LA 3ZKXC 4C83B 1X4XA 4GW5A 1E5BA 4KITB 4V11A 2YDRA 4DELA 3S0CA 4JG0H 4Z77B 1LE5A 1W0VB 4XBSA 1UC4A 3GVGA 3TNNA 3CVHA 4WQOA 3THML 1DEDA 3OXRA 4PIRF 3FTUA 3JWNE 1FBAA 4PJXE 3JWDL 1LYXA 1EFXA 2ADIB 3TYUA 3V0SA 3WS6C 2C13A 3RKDD 4PSRA 4Z3EA 1I85A 4DYJA 3II2A 3QDMD 5A16B 4AZCB 3L7FA 4YFDB 5DY3A 3IJYA 1KFEA 4Y4HC 4EI5B 2WMGA 1UADC 4PMXA 1TV5A 2GBTA 3RU8X 3ZT6A 3FB7A 4K5OA 4GNVA 1E4WH 1IWPA 9CGTA 2VDMH 4G8FA 4J4PC 2R8WA 4O50A 4UTWA 1DQLH 2WNKA 1EO8H 3W7RA 2EYRA 1VRSA 1A5LC 2QR6A 4R34A 1ODZA 3V0TA 3STZA 1E0WA 1TMCB 3ARFB 1AGBA 3JTTA 3V7MA 1ILUA 1BZDA 4UQDA 1LTDA 2CIPA 5IVXE 2GLKA 4P7QA 3GFUA 1LF1A 3TSDA 5I76A 1CB2A 4UTAL 1HP4A 3L3DB 4YXKL 1S39A 3BWWA 3MZNA 4G9FB 5FKAA 1M01A 3RK8A 2AI0H 2JIXB 2P5WD 3L1FA 3G5EA 4IZGA 4FNTA 2D7TH 1CZ8L 2OKMA 3RYSA 3FCPA 2N01B 1ZPUA 4RNFA 4M93B 2ZUQC 1L9NA 4M8VA 4BJLA 5I73B 3R5EA 3TVAA 4C4UA 4BR1A 3CBWA 3DDMA 1OYCA 2JTDA 3ZDZF 5H1WA 2ATSA 1B9KA 1NFDA 3TWBA 2WZ0A 4KEZA 4LNYA 1XCXA 1YJDH 3WBYA 4FQHA 2NNFA 5GGQH 1IAMA 1KO0A 1EYEA 1LD9B 2DM2A 1HQ4A 2VN4A 3ARGD 4H13C 5ICZA 3APTA 4MQSB 2E0PA 3TPKA 5J8OA 3KJ4C 1BVNP 2BVPA 3BP4A 3CXHK 3GI9H 5AC7A 3MV8B 1R4XA 1IC4H 1EP2A 4LAOA 4BKLB 4W9EC 3EX6A 4JPWH 2JKEA 1FWSA 1SXZA 2PO6D 2Y2YA 4ATWA 1FVCA 3BAKA 3RKDC 2DUAA 4ADJA 3L4YA 3M0HA 1MZYA 4YBHA 1KIUA 3W7IA 2JKNA 2BO0A 3NL2A 1AXSA 2CHNA 4FG4A 5KAQG 5L4MA 2F54B 1MJ7H 2NZ9D 5IMMB 3RNDA 1EK3A 4U0QB 1G9NH 2XQYG 2J12B 3OHXA 2OCCB 1I7ZB 2FB4L 2X6CA 2JQMA 3CH1A 1NFPA 4NZTH 4OQVA 3HB3C 4J6RH 3RMJA 4G42A 4PJ8C 3D6NA 3LKPA 3ZTDC 3MOBL 3NYDA 1N9PA 4N26A 4O53A 5HYIA 4LVGA 1A5CA 2YZ1A 3ALPA 3TROA 4UXDA 4Q8UA 3HMXA 1F11A 3HS0A 1PYMA 3WD2A 1MCBA 2WPBA 4R8WL 2X8RA 1NLBH 2DWDA 2APVA 5J0BA 5GGTL 3SE9L 1A6WL 2WGXA 1M68A 3UGUA 1ONQA 2J7CA 2GJ6E 2R0KL 5DEZA 1G9MH 5CR1A 1KR0A 3Q01A 2YQBA 2FSDA 3B43A 4NKDA 3KS0J 2ENPA 2FEEL 3VXME 2QKFA 1DKWA 3PZNA 4EI5D 5A5WA 4CJ1A 1J10A 1E9LA 2R4SL 4ACTA 4P8XA 3VNJA 4UTTA 1UOKA 5E23A 4ZENA 4Z2HA 3DPBB 5JHDA 3OG6B 1YEFH 4OT7A 3INUL 1M7DA 3OXSB 3T0DA 1TYJA 5T33H 5JORB 1ECZA 1XWYA 4J5NA 4FALA 5C6MA 4KPHL 1PIGA 4PCFA 5DQDL 2LVEA 4L4VD 1T8XA 4I6KA 3ARDB 2XFXB 1POKA 3ILDA 4JRYD 3FB8A 3VIPA 1IBZA 4S2SB 2ZXGA 3GDRA 3EWUA 2A6JB 4M7LT 1ZEAH 3GMLB 3R0NA 1AP2B 4ORZC 4YXKH 2XM2A 4PTXA 1QFWM 1KTJA 2EO7A 5EPMB 2POZA 4ELMF 4B92A 1SO3A 4NC0B 3L2NA 4JKPH 1AD4A 2X0VA 1ZA6B 3KPLB 3R7RA 3BEVB 3PGCB 4B53A 4DFIA 3AMLA 1T1XA 2QDGA 3IIVA 3O3BB 4PRWA 4Q8WA 1JR1A 2VR5A 4UFHA 3TAKA 3N15A 3U0PB 4UNKA 3NJ3A 4HHMA 3LNPA 4N2BA 4IX2A 1HNFA 1AXSB 4BKTC 5DCBA 1U8OA 1G7HB 2J1YA 5T1KA 1LM1A 4UQIM 2FX7H 3P14A 4LGSB 1NBCA 5DFTA 2AXGB 3CH0A 4N8VA 4GNJA 3VSUA 4I9XA 4FYSA 2P8LA 4XXWA 4ZBJA 2AGJL 2YXVA 1S78D 4JFHD 4OI7A 4WDIB 2QQ6A 4PCNA 4TNWK 2Y23A 1RK1B 4DWSD 3FRUA 2F53E 1B4LA 2ZUUA 4DZBA 3SB3A 3BFOA 5IR1B 5I1LA 2FKPA 3V4BA 4ALDA 1E6JL 4J3BA 5DLMH 1YEHH 1HCVA 2PPFA 2KZKA 3ZDYF 3AADB 4PV8B 4NJAH 4DPCX 4GBXA 2CKRA 1W9VA 2A4CA 2K9UA 1GW0A 1PXGA 3G1FA 3SE8L 5GRJH 2WXQA 3DMMB 4KMTL 1MHCB 4ZRGA 1BECA 1H0DB 2XNAA 2Y5JA 5I66A 2PTTB 3FUMA 5KSVA 3BUYA 3E7JA 2B1AH 4BSWB 4XB3A 1ZHLA 4BQ6A 5LQBL 1F05A 3SQBB 3W9ZA 1QRND 3QEGH 3S48A 4IKJA 1V77A 4XBGB 2P8CA 4PR5A 3LEYL 1WQVT 4NPYA 1FJ1B 2B1OA 2Z2UA 2EIKB 5G5IA 5D8WA 2YEZB 4J4PA 4M03A 4BSVB 5E2VH 4R5XA 1NFDB 1BD2A 2CERA 3QHNA 3RWHA 3MLRL 4WXYA 1FH5L 4NDMB 3RZCC 4XVJL 1Q8AA 2P44B 2ZNXA 2VDOL 4L2YA 1UB3A 4MG4A 3L4WA 1PFCA 1K7EA 4LSVL 4EF3A 2A3BA 3SDYL 1TF4A 5DD5L 1W72L 3NIGF 5F9WB 1FWWA 3QGKC 3UJRA 2W94A 1S9XA 2A3AA 3PBUA 3EOBA 3F00A 3FRPA 3KAAA 1AR2A 4H0GA 4OCXH 4UTCA 4Y5XC 5TDNA 2FEDD 4NUGL 5EBLA 4KHXH 4MQ7A 3T0EE 2HPMA 2PTUA 1JRHH 3MRLA 1C8QA 3DV6B 4K9JA 4RNRA 3KPQB 5I71B 1FCVA 3O3BA 2GVEA 2WBJB 2VP8A 3L68A 1YPFA 4EVNB 2JJWA 3MUIA 3NIYA 5J8LA 3LMJH 5HDOA 1USQA 4PJHB 1XCTB 4DKAA 5C09B 1WFUA 5JA8B 1U5VA 1ND0B 4KI5D 4Y9BA 4PYGA 1F4YL 1MH5B 2OR7A 3JT0A 4ODUA 4WJKB 5E9DD 1UR0A 4IMLB 2WHJA 1G6RH 3CXHJ 4GW5B 1FL3B 4Q33A 1NM9A 5CWSA 3DGBA 2X4TA 4PRHA 3I4KA 2DAVA 4FQJH 1SY6H 3ZTNH 1WDDA 5LA0A 1G7LA 2DPKA 4D8PA 3S2NA 2C9PA 5GGSB 1QQDB 1QUPA 3CZUB 5D7IE 5FGCE 4B3VA 2MJWA 3RFAA 3VFLA 3S6DA 4GI8A 2QFPA 4G6KL 2HRGA 4F57L 4NQEA 4HIJB 4HFUL 1TIUA 3OKYA 2D2GA 1Q72L 4CSPA 1NFBA 4PULA 3MX0A 4OV6F 1QNOA 2XVNA 3DGGB 5EUKB 1DIKA 3OGVA 1B0GA 1ZGLP 3FO2B 1VFLA 5J5DA 2K6WA 1WBHA 4WHTB 3EJJX 8FABA 2WNQA 3VQLA 3LK6A 3CN3A 3C5SB 3F04A 3KBPA 2NSXA 5TGBA 4LVDA 5F71A 3AUVA 5HDWA 2PP0A 4BHUA 1JCNA 3O6CA 1XLGA 3FIGA 2WYZA 3FTWA 4M7JL 2W3ZA 4WWPA 3OKLB 3KBSA 2BW4A 2DH3A 1KLGA 4D1IA 1KNOB 4QTHB 4M5ZH 1A65A 1RD6A 3QPXH 3U7BA 3U7WL 4G9DA 4BZ2H 3MTXA 5GSVB 3I6KB 2ZOXA 4XZHA 1HL9A 3BO8B 4BH8A 4DO6A 1HHJA 4MZ2A 4HWZB 2UZ9A 1P1ZA 2GQHA 1T6VN 4W7WA 3P60A 4PS4H 1K6AA 3TSBA 5D7IB 4YDIL 3O11A 9PCYA 1KPVA 1A9BB 2LLLA 3N41F 1UOVA 3W1UA 1MIEH 3GO2A 3WF4A 3NA9H 3APGA 4Y1AD 1QLRA 4P7NA 3F7PC 1RHCA 3QKZA 2E76C 4OQ1A 1G7LB 4WK0B 4D8PB 1PYWB 4POCA 3CDZB 1L6GA 1KFGA 1IT9L 5LXGL 1BXVA 3GU9A 3EHBC 3DX4A 4AC4A 4ZT1A 1OE3A 5LGJB 4DNMA 2R39A 4PJHE 3BLBA 3KLAB 1AFVL 2X40A 5AKRA 2BIOA 4H9TA 4FFZA 3DO3A 2R15A 2ENQA 1WAAE 2GSMB 3ET9F 3FKUS 3N1QC 4JFZH 5EZOH 5F9JB 4YHNB 3K71A 1XDJA 3P9WB 4NAFB 3TJ4A 2GIYA 2YQGA 2AI0L 4XP4H 3T0EB 3NPSC 3AHYA 4QX4A 3W85A 2GITA 1UWQA 3FU7A 4BZ1A 3Q8EA 4Y4KD 4X4YA 2Y6SD 2D2HA 3UWWA 3NCXA 4P5TB 4FNQA 5D70L 4CQCA 3H9SA 3N42B 4PB9L 2YPLA 5DMGC 2HNEA 2JKSA 3G2GA 4FNLH 4K68A 5CSZA 2VCCA 1JAKA 3VCRA 3PWIA 2PF8A 3MUJA 2BY2A 3QQXA 4QROA 4I2XE 2E9LA 3GAYA 3B2XA 3WH7A 4KS0A 4B3KA 2A0NA 3ZIYA 3MRPB 5EUKA 3HE7C 4BA0A 1MMFA 1PKYA 1UM5H 1ZSDB 4A8LA 1BM3L 1BTCA 4Q32A 1NLBL 5HGGS 3UBHA 2HSAA 1SM9A 4PMNA 3H6OA 4KJWD 5D9SB 2R8SH 3STZB 4GVFA 2QSCH 1M71B 4H1LG 4G2AA 2CLMA 3WO3B 4M6AA 5EBWA 1NDMB 1RZPA 4DGUA 1HILA 4LPTA 5IK3A 5AVHA 3SDCC 5E2TH 4Y2OB 3DX0A 3U9IA 4YUEL 1MQ8A 2QUNA 3GNMH 3OKMB 5I78A 3ABOA 4C56B 4MPKA 3W70A 2IQAA 3FCTA 1VPOL 4S3KA 1TZGL 1W0YT 4MA7H 2VELA 2OV0A 1WAWA 4R5EA 1J88A 1HFUA 4MDJA 5HDQL 3SCOA 4L6HA 2EKJA 3RG6A 5EMMA 4YDLB 3PJWA 2MKLC 3VE0B 4JO2L 3WFEL 1CGSH 3CH8A 4H4IA 4B9YA 3MYJA 1II4E 2UXFA 2ALRA 2X4SA 3UC2A 4Z7OB 5PAZA 1Q94A 2Y7DA 5KANG 3O2VH 3WQ5A 5B80A 4HHWA 3XISA 4A2DA 2QIIA 5C55A 4NFBA 2OMTA 2WXHA 5T1LD 1HXYA 1YLVA 5DUPH 4KQ3H 1AY1L 2CO3A 4JFXA 4S2CA 1DE6A 4OGYH 3SEPA 1MNUH 1OSYA 1T7YA 4IMLA 3RBSA 3AQDA 1VESA 4OFVA 1FVPA 2VLKA 1OZUA 4LY4A 4ZX5A 1DSFL 4KQ3L 1B3IA 4WEMB 5LLIC 1LO4H 1QFUL 3LXUX 1GOQA 2ZPKH 1RERA 1X5KA 2EIZB 1MPAL 1AH3A 4ECNA 2JJVA 4KTDL 1VBRA 2ZXAA 2IH1A 3BVXA 2ZSWA 3GLDA 1SPDA 1UBPC 4YSQA 1E6NA 4F37K 4LLAA 3HHSA 3G1RA 4E38A 1Z2KA 1RHFA 2NQ3A 3O1NA 4BY3A 3KRBA 4PB5A 1R3HA 2AAMA 3EOBB 3T8QA 4GNKB 1Z0NA 1BEYH 3GVWA 4PTVA 2E4FA 3UR2A 1DVXA 3DFPA 4IIDA 1KJ2H 4MYXA 2XN9E 3HI6L 4P48A 2NYKA 1HJBC 3P11L 4LAUA 1KFLA 4WTZA 2SEBA 1OEPA 1FGVH 3CFBB 1IGTB 3DYMA 3MJ6A 1EGVA 2C8NA 4XN4A 1TWSA 2UY6A 3NMEA 1XKYA 3P8IA 1UTDA 4PB4A 4AHQA 5LGZA 4H2CA 4G80A 1G7JB 1CF1A 2OW7A 2I9LA 3PY2A 2HEJA 3PP4H 2OR2A 1RIHL 1W2KT 1RFDL 1Z5YD 4OLZH 1G7MA 2B9BA 3HC3L 3ZT7A 4CCDA 3H55A 4UT7H 1DE5A 3J2PA 4NHUA 4XVUD 3FXYA 4O51A 4Y16A 3BUYB 3FO0L 3V6OC 4S0HA 5AZ2H 2XA8H 1PKNA 3OVUB 5KANI 3IN2A 3FO1A 1C5DA 4GFTB 4HJEA 5TQ2H 1JOIA 4D9RE 5DJXA 1E8WA 1X5ZA 4JHVA 4W9FC 3S98A 1G6CA 3GTXA 1OAJA 4JJHA 3NL5A 5CSRA 4HJUA 4R7NB 3H54A 5MENB 5FECB 3EYFB 5E6UB 3CFIC 1D5BB 4U1GB 2Q8BH 3ZGIA 2XFRA 1CT8A 4Z2JA 2XRAL 2OWWA 3HI5H 1L4IA 3HHSB 1GQKA 3O6KL 1GPOL 3O7UA 5B7YA 4HGWB 4FTVD 1A1OA 1YA5A 1BFVH 2EICA 2VXQA 2WUBL 3FDWA 5F1NB 2RKXA 2FNBA 3GSUA 4LEBA 4Y7OC 3T0VA 2M26A 4AZHA 4KOBA 4H1LH 4TQHA 5I2UA 3P3UA 1G7IB 5EO0A 4DO5A 1UEYA 4HLEA 3HPXA 4B5XA 4HQQL 3CWOX 2P3ZA 4LAMA 4BUHA 5T1MB 4EACA 3LKNB 3GJFH 1XH2A 1S5MA 1OM3L 1DQML 2GBUA 1KCBA 3GQYA 4ZQNA 5TE4H 3F6LA 4LVHC 3MRJA 3BCFA 5CGTA 4BFOA 3DH7A 2DBLH 3QWQB 1JRBA 3CBRA 5EU4B 1Y8BA 4H00A 2BSRB 1ITCA 1A1MA 4HA1A 4J2QA 4KGJA 1ZE3H 5IHZA 2BDQA 1J9TA 3ALGA 2F68X 3MUUA 4MA3B 4AIBA 1P4LA 3CX2A 2P52A 4XNMA 3W11D 35C8L 3M6DA 3DENA 3IFPB 5I6SA 2YR1A 4X5QA 1MDRA 5KW9L 2VXNA 1EEPA 3TQ0A 4QGYA 4Q8PA 3ZYOA 3UGVA 1HNGA 3FXIC 5T1LA 1TCDA 3DI2B 3WSQL 1F73A 1NKRA 1X7SA 2PP9A 4XC3L 4XNUH 3K80A 3X11A 3VFRA 5LGHH 5D4QA 4DVRH 3S3GA 1KFWA 1ML1A 4OLVH 2UYLB 2YWZA 1P2CA 4M56A 5LB1A 2YD3A 4TLSA 2DT2A 5A6KA 4FEMA 1VSCA 1RMFH 3UCRA 3V0HA 3RJOA 1QO2A 4OJAA 3TPUA 3ES7A 1HAWA 2ADJB 4OLXL 5CM1A 2VLRA 2WTOA 3MNVA 1I2OA 3MJWA 4G9PA 2ZZ6A 2X7WA 1TTFA 1H3VA 5BOFA 5JBFA 1BW8A 1H1NA 3UPRA 4JCWA 4LOVA 2BRQA 3LZFH 3Q48A 4PRID 4DEWA 1LDCA 2C0AA 3NJKA 5AOMA 3WNNA 4QS6A 2HS8A 3C2EA 3RFZC 4R7NA 4WY7L 5IBTL 5FECA 1ZUAX 4WD0A 3STEA 3BLIA 1RJRA 4AAJA 4GY4A 1GAFH 4OLZL 2O92A 4L9LB 1SQ2N 3U4KA 5FEBA 1TWDA 4QXTA 3B9EA 2NY1D 3A6BH 4L3EB 1KN4H 1AHKA 3EDJA 3RGVA 2LR4A 3VUAA 4E9VA 3WF1A 1Y6NR 4KO5A 1CC3A 2IOMA 1S2TA 3P0WA 3HA0A 4R0LB 2ZA1A 2E9IA 1IHIA 5I8OL 1E4KC 3IJLA 3S83A 5I1DA 2PP3A 4IIZA 4HBKA 3L65A 2NX3A 3P4MB 1SOSA 3P9LA 3PP3H 3UAJA 5BVPH 5IKCA 4MBRA 5KUMA 4H8UA 1SLUA 1DWAM 3DV4B 4OV5B 1I0DA 1UZ1A 2BCKB 2YK1H 1IM3A 4FCAA 5KJRH 2Q8BL 4O4WA 1NFGA 4F0SA 2QHRH 3IMRA 1CTOA 4KV5E 4JPSA 1T7LA 3KAOA 3VI3F 2X2YA 3FSTA 2VN3A 1WZMA 5DO8A 1Q4NX 5IBUG 1S2UA 3F4CA 4H1ZA 4K3JH 1XF1A 3MRGA 1Z5LB 4PN6A 3VKAA 5D71L 3KPMA 2ADFH 3S1GA 5LDUA 4FQHB 3DFYA 2DMHA 5E5MB 2VLRB 1FH9A 4FI4A 4WI7A 4EP8C 1U58B 2WN2A 4HQQH 1XBYA 4J2PA 2OLHA 1EMTH 3WL0A 2VUNA 1RHHB 5D96C 3U1SH 2IWGA 1HYSD 2P8LB 4GP8B 4OJCA 3IXAB 3TNBA 2CLRB 2MH4A 3OG2A 1DHKA 2W79A 3ARBC 4LSUH 3FS9A 2QUUA 2PLCA 2PODA 2ADGA 1RULL 4JKLA 2X6VA 3GBMH 1R24B 2BIIA 4FRWA 4ZFOB 3VH8A 2VJXA 1Q6QA 5T8IA 3TK7A 2X09A 5CUSL 1ZVNA 3QXAA 4NO2A 2YSTA 4FFWD 3T9WA 2B0SL 5F0MB 2CLHA 1D3GA 2MANA 2UWFA 3QJHB 3H9HA 4Y1AE 3BLFA 3EB2A 3GZOA 4XVTH 4FZIA 5CBBA 1OAQH 4X8JA 3CU2A 2PP7A 5FM5O 3T4YB 2V2CA 4MQXC 3HFTA 3F64A 4X5LA 5FKPB 3WGUB 1IXQA 5IG7A 4N2KA 1K8YA 1F4XH 3IAGC 2CLIA 3U4BL 1U8IB 3IIOA 1OV8A 1CVSC 3OYZA 5DHEA 3T07A 4BEUA 3WFCL 3O63A 4MDJB 2VDRB 3RF9A 3ARDA 1Y7VA 3VFVA 4NX0A 1PIIA 4Z3IA 1XG4A 4UQ9A 2WKOF 1G87A 2Q7AA 3RX9A 4PQXA 4A2GA 2J21A 1QRNA 1KCUL 4NQDE 1KBWA 3SUTA 4MD0A 9XIAA 2IPTL 4FQCH 4WUUB 4Y8DC 4DQOH 5CMAA 4R26L 4GABA 2DEPA 1OEZW 3HLAA 4UNIA 3ZYZA 2WCPA 2WXMA 3RJYA 2YPLD 3FJTA 3LIZL 2PCYA 4KJQC 4PLKC 5AW3B 4EN3D 1CFSB 3KWWB 3T1FB 2HJLA 5IQOA 1QXLA 1AHWB 3CJJA 1MFVA 2Y1ZA 4GCXA 3L3OB 2HJFA 5KZ6A 3MA9H 3DRTB 3PK7A 4HCRH 1KY7A 4JTEA 2XSAA 1BF8A 1XSOA 3IU3B 5D7EA 4GI9A 4D2NA 1J5DA 4FR6A 5ACZA 2CUIA 2P7TA 5ENWB 2IBGA 2H45A 1U21A 4Z17A 4MVBD 2I07B 2ORBH 2V6HA 5D1XB 4TTUA 4DGWC 5MENE 4DAFA 2WZ5A 3IJHB 2A3LA 2IFFL 4IHBA 5E99H 2NXGA 1HEZB 1DUZA 4CJ0A 1R9ZA 1ZBWA 4NQXA 1H7WA 4FQ1H 4Z7VF 3KWVA 2V9QA 2VISA 3GXTA 5I1KH 2BSEA 3EXRA 2C9QA 3KWXA 4ICXA 4ML9A 4DNHA 1CLOH 2XWBA 1XIEA 4A21A 3BUDA 4LSTH 1Q3NA 5G2IA 1O6TA 1NGQH 2BOLA 2IADB 3RWDB 1XZ0A 3L0NA 5A6BD 3HNVL 3I9IA 5DS1A 4LOUC 5KZMA 2AQTA 1HXKA 3H23A 3NQFA 1WUNT 4X99B 5CFHA 2OMBA 4JM4L 1RZFL 3G6JF 1T6WA 2AV7B 3SYQA 1MDLA 1W17A 4EK7A 4S1SL 1KY6A 1TR1A 2OCJA 2DBJA 3GSVA 3DIDA 1JCYA 2DIKA 1BZ7A 1RUPL 5I16B 3ARFA 3QV7A 3GC3A 2HNHA 3DC8A 4BUQA 3EGJA 5EA9A 5JNYA 1Z0MA 1TSRA 4G7EB 4O2FB 3KYKL 4DGIH 3ROLA 3FKRA 2OTDA 2GT9B 3IMWA 5EC1A 2NUWA 2AQOA 5I1DB 3CSYA 2BOEX 1GGTA 4HNTA 4G9DB 1LL7A 5GSVA 5J11B 3CHXA 3B9KA 3WFDH 3G5XA 1DR9A 4AZ8A 3LHUA 2HMCA 3RR1A 1HXYB 3IGSA 3TPUB 4NF7A 3NJVA 1B4RA 3KCJA 1E1CB 1HINH 2G3JA 2KLSA 3SO3C 4AQLA 1A7QH 1ENUA 1D9KA 1J18A 4XNDA 1UCTA 3DBXB 4KGLA 1JGIA 1IT8A 1OYBA 5JBEA 4ZI8A 2HB0A 1MZRA 2O0TA 5FGBC 3GNDA 2NY4B 2GB2A 4JNMA 4GQPH 3ZBMA 1IFHL 3LH2H 1W2VA 1DBAL 2IALA 3CZ8A 1ZSHA 5TK2A 1M7OA 3ZR5A 2VM9A 4P61A 1QKZL 1CFNA 2OZ8A 5HGAA 2A7RA 3IDIA 4JS7A 4IGSA 2WB1A 4WI8A 4WQ6A 5D7LA 5CSBA 3RB7A 3ARZA 2VRKA 4JEGB 5DS2A 4DHLA 4FJZA 2YCEA 3W74A 1KYFA 1QI3A 1CDCA 1CZ8H 3PCYA 4CADA 3KYNB 4K23L 5JIIA 4U5IA 1GKOA 4ODHL 4XOEA 5DGQA 4NI8A 4S3JA 5E8PB 1MEXL 3MP5A 1IRAY 4JFFE 5DJZA 1E6JH 3N2MA 3P5ZA 3TIDB 4QNWA 2RQ8A 5ETUB 2EPNA 3GXMA 3MFFB 1G4PA 4AB4A 5KUKA 4DUOA 3ZL4L 5C09A 4QRRB 3EYVB 4PSPA 1ITQA 5A2BA 1TENA 3T42A 3WK3A 4GP4B 1E55A 3TE9A 2ZFAA 1YX1A 3W1XA 4Z77A 3CHPA 3OWEA 2VMCA 3H85A 4PJ5E 4AWTA 3SZ6A 1R3KA 2CCLA 1JPGB 4LGPB 1I85C 1R3IH 4HIQA 2JIEA 4TTGA 4YHLH 1PWMA 4P2YA 4Z0XA 4C6OA 2Z4QB 1TV8A 5JQ6L 2WJ7A 4GLRH 1YEKL 1YN6B 2M1KA 4P2OA 4WWKC 1R3IL 2GSEA 4XVDA 5GS3A 3B1UA 5C6TH 1RZIB 2LAAA 3MACL 2H1LM 3PIQA 5HHME 5D72L 1Q7MA 2PTYA 5TDOB 2CJSA 1AQFA 1V0MA 4OT1H 4PUEA 4BI7A 4Z6AT 1GIGH 3O9WA 2GT9A 5TTRA 1CNVA 3TW9A 3PM6A 2FNWA 3HOJA 4R7WA 2JJSA 4DNLA 1GK8A 3V3WA 3B9DA 3K4DA 4Y4HB 5AHFA 5IRPA 3EXJA 1A1OB 4JX0A 1UR4A 3N42F 5DANA 3THMH 4AVOA 2QL1A 2FDSA 1F90L 3F4VA 4JGNA 3LHTA 4NPYB 4DW2L 5BMFH 4MNKA 2H32B 3WIJA 3MV7E 4B9GA 1TIWA 3NA8A 25C8L 4YNGA 3N0PB 4NUGH 3RY5A 5HPMB 3W3OA 1D6VL 3QXWA 1A6AB 4JMXA 4Y9CA 1CBVH 3ABMB 1BMWA 4DW2H 4WWNA 3S34L 5BMFL 1M4KA 1ZWIB 1FTXA 4Z7WE 4MSSA 3DOSA 5FUCC 3VO0A 5F9OH 1XCFA 3U6RB 4NQEE 1AYRA 5T1JA 1BREA 3QCTL 4PJIB 2RAGA 2AJXL 4HJ0C 1NEZG 4KK5C 4LC8A 4LCYA 2F58H 1AGFA 2I7SA 5D7IA 3GIPA 4R83A 4GGHA 2C5DC 2QGCA 3L54A 4UI2A 4AVJA 1XLIA 3I4EA 2I9UA 3U0WH 3IJIA 5E9XA 1L9PA 3NN8A 5DEGB 3HE6C 1C8PA 4U1LB 4HJJH 3PAUA 4FMKA 3RPIB 2OYMA 4WU7A 4NAEA 1QBBA 3UTSE 4M7KL 5DQ9B 2AXGA 3W38A 2BTMA 2VJ8A 3B8TA 4MKNA 2BDNH 2YD7A 3U4EA 1SF5A 1A0QH 1KB9J 3RYMA 2QDEA 4XAGA 5TIMA 5IFPA 2UY7B 4IOSA 4H44C 4ATDA 2HSIA 1AD0A 2ID5A 3ARWA 5BJTB 3TNMB 4D6EA 5KVEH 1FWFC 4J1UA 5C2UB 2W9DL 4Z7AA 3LI0A 2ADJA 1F76A 3IK4A 2GTZA 3PGDB 3BPOC 5E00A 3O4OC 3R89A 3S6OA 3T65A 4C6EA 3GNXA 5BMXA 3BMXA 4UDUB 1VPXA 1X44A 2K6ZA 5GS0H 2Y7EA 3D1MC 1INDH 4IBQA 3O45A 3FB8B 3GBNL 4U1JA 1V05A 4KCUA 4TUOA 3DRQA 2W0FA 3RWJB 4MVAA 2V5JA 3SDCD 2RGSA 3DFQA 1KBPA 1J8HD 3N43B 4PJ8B 2KZBA 2GUYA 4JLRB 3LHWA 2R1LA 4JR5A 4DY1A 4H8VA 1HHHA 5GGTA 5HJ3A 5JQHC 1C7TA 1MHEB 1N18A 2R0LH 4FFVD 2X2IA 5TE7H 3U0TA 4AIUA 1JK9A 3PE9A 3QE5A 1S1PA 5DRIA 3PZOA 1AGDB 5F2IA 2NWSA 3EAKA 4BE6A 4U5KA 2VRQA 2VLKD 3GFYA 3OA3A 4L56A 3S46A 2WB7A 4NSKB 4FXGA 5F96H 2P0IA 4FFZL 2X28A 2NW3A 4OKVA 2EF9A 3AABA 1SVZA 2YGPA 3L5IA 2EC8A 4J6RL 5C0AE 3LMZA 4NKOA 3SJNA 1EFXD 3WTYA 3MREB 1IC0A 5TDNB 1RBLA 4OOZA 5EWIH 1QWGA 3IAQA 5ANME 4ZXBB 2NY5L 3R12A 3W84A 4P46D 1P1MA 1T03H 1MNZA 1TKKA 1TJHH 5JLZA 1PSKH 3MA7A 2XG5B 2XTJD 1OZTG 3FTGA 1SFHA 3PWVB 1LORA 1ZSDA 4PGDB 4LCCC 3NN8B 4HWNA 5EU6E 4HYVA 1MJJB 3AY2A 4MCZB 2NY3B 4EF9A 5AYIA 4L1DA 3ITCA 1TV2A 1U58A 1F74A 4C5ZA 4GFSA 3GI8L 3F01A 5F3BB 4F8OA 4EAEA 4NKMA 2VEFA 1V7NL 2FJHA 1L9SA 2D3NA 1I2RA 1OX5A 2YGQA 3N50A 3BRDA 1D3HA 2ZCHH 3S2CA 3TZVC 2TRYA 3KPOA 3GG0A 2WP3T 1GOIA 1D5ZB 1T04A 2C9VA 3V95A 4C6KA 2Q3ZA 4LLVB 3WIIH 4FQ1L 1W9DM 4XKYB 1RH9A 3H3PH 1B2WL 1M6JA 1KLZA 2VR8A 1JD7A 4P7OA 2YPLB 1VGKA 4WI5A 4MD5A 3ULAB 4OZHE 2ZKYA 1FCGA 1UOLA 1KW1A 4TIMA 1KCXA 4P9HH 3T77A 5CJOH 4EMZA 2HK1A 4Z1DA 5IROA 4CNUA 5MF5A 2DY3A 5DZ9A 1YNYA 4D6DA 2QT6A 4QHLB 3TJHD 3MVTA 4FLHA 5GQBA 4YYFA 1ZKAA 1IEBB 1E4WL 1LBFA 4NB7A 1ALDA 4X99A 1EEYB 1WC7A 4RMTA 5C07B 1QT1A 4K7PH 3RHWK 4MYAA 4JY6A 2WJEA 3Q7JA 2JV6A 4OUOA 3PB0A 2IXQB 5CGMA 1EO7A 3OSKA 5ESQA 4JO5A 1YY8B 1WXYA 2ZRWA 3FY1A 3DSNB 4NQCA 1SXSA 3GKWL 4UV4H 4WI4A 4ZTEA 1EDTA 2WMKA 4J9JA 2DJ4A 4MDPA 4W7UA 1XUZA 2WNXA 3RVVD 2DGAA 3KWTA 2YCLA 2HKAA 1HL5A 1LO3H 4YLWA 4C6LA 1WFJA 4B2DD 3NTYA 5BUAA 1L6ZA 2V3FA 3DTUB 1A5FL 2VM8A 2BPBA 2GJ6A 4TQPA 3GMPA 3QWNA 3DBNA 5LHDA 1IILE 1TTIA 3BZGA 3M86A 1IZCA 1BXBA 3R94A 3UMNA 2XKSA 3IU4H 4PMJA 3DTXA 1X7TA 3AFLA 1BQKA 1FWXA 3X3GL 4WFFD 5TDOA 3IARA 4K9EL 2Z4GA 4Q4SA 1QFWL 4HNUA 5A8GA 1IGWA 4HZ7A 3RNKB 2YYTA 1M9SA 1R86A 2AK1L 4JY5L 5CKGA 1QQDA 1KFKA 2V9DA 3ZKMC 5KBMA 2OMNA 5AHEA 3OLDA 3ITYA 3VXGA 7PTDA 3QIWC 4B5WA 1VZGA 5I1JL 1GOFA 4XN1A 1OAQL 1V0KA 4YLBA 2BB0A 4RFNB 1CFNB 4ZPVB 1W5NA 2HWZH 3NM1A 5SWZA 1PY0A 2FL5A 3IJ9A 3OMIB 1YPXA 1Z8AA 2ZKXA 5CJ8A 3OR7A 3QXDB 4OLYL 4OJFH 4P4KB 2QGBA 5CAKA 2Y3AA 3UPAA 4S39A 3RR4A 1WHPA 1R85A 1D6EA 4PCSA 2QVFB 2NX5D 1G01A 2DWDB 2LU3A 1S2VA 3PWPA 2NY2B 5E8PA 1VF8A 3BJTA 1OQFA 4YJ5A 1I1FB 1ZAIA 4K3ZA 5IVNA 3ROOB 5ANHA 3ZKND 4W9KC 2CBOA 5M7QA 4G6CA 4AF0B 5DSCA 3CHEA 1JF1B 1CIUA 1CYXA 2H0FA 4JHMA 4QPEA 5CWSB 2VRJA 1MY5A 2V5MA 3MSPA 3O3AA 5AOIA 4BIKA 1ZALA 4KDWA 5FYLD 2OP4H 3ME3A 1HCYA 2ADAA 4NZCA 4TU1A 2NX1A 1AD1A 2LOEA 3IKKA 5KWYC 1YEEL 5HHPB 3GRWA 1NDMA 4LEXH 3I6TA 5XINA 3I9PA 3FJNA 3BEWB 3ABKB 2HQAA 2A77H 5CLTA 3S4SA 3BSZA 4XC3H 3US1A 5L2KA 1SR9A 3GYCA 5FCSH 1H7RA 3BHBA 4C91A 1RQHA 4XMPL 1H3GA 3C8FA 5F7KC 3KG5A 3NVDA 4DTGL 4AEHH 1JCVA 2EZ0D 4M1DL 1MXSA 4GXPA 3GVRA 3ILPB 3SBWA 1EANA 4YSPA 2PDLA 4ENED 2WZTA 3B0YA 4JO4H 3W1NA 1KB5B 4JM2B 3N12A 2R0KH 2SFPA 1I8KB 4UM9B 1OSEA 3LEYH 5HBFA 4XZUA 5MEPA 3OMAB 1ETZB 4JPVL 1GG0A 4KQNA 3IDXL 3JV6A 4NYLB 2Y1AA 4RGNC 5CEZH 4C7FA 5FFOA 5FM5M 3DVFA 5E4IA 4HOMA 1QOPA 3DG6A 2CLFA 4UTLA 2G9HB 2F2HA 3GSRA 3PQYB 5HHMD 1A5SA 2XFFA 3TCEA 3VE9A 1ZT4A 1AZ2A 1TR9A 2PTDA 4GEJA 2E86A 3TJHC 3MTRA 2WMPB 4DP7X 1TQXA 3UBFA 2FFIA 4I7WA 4APQC 4AMKH 4FP8H 5K1NA 2CETA 1N6QH 3E0IA 3G6LA 1ZTXH 2WXFA 1Z66A 1UZGA 4JFFA 3HC0A 1H3XA 3VRIB 3X3FH 4AQ1B 1FYTD 2OQJB 5FPIA 2YOCA 2EH7H 5KTLA 1UYWH 5GGRY 3WV0A 1ZSXA 3BJSA 3TCSA 3GU2A 3F1QA 4JPGA 3IF1B 4IICA 1B5TA 1BHGA 1QWHA 3DVGB 5IBLC 2J8GA 3W72A 2OZ0A 5G4OA 3S35X 4PP2A 2WM0A 4JL1A 4ZFCA 1FYHB 2BOCA 4XO8A 1O5DT 3S36L 1OTUD 3TBTA 4FZEH 3OZKA 3O16A 1DQTA 2J27A 3I50L 4FYRA 4F7MA 5JLZB 2CLLA 6ENLA 4NO5A 1GC1L 2QADC 3L0GA 4O02H 2NLIA 3T5WA 4P2OB 4HKXB 1QK2A 2DQEH 3LTPA 2IFFH 4MMZC 5E99L 1Z32X 1Y1DA 4HUVA 2FK9A 2K0RA 1CLCA 1WWCA 2WQ8A 5BNXD 4UT9L 4O2CA 4AZCA 2RMNA 3R7QA 3VKBA 4JTDA 4MQXD 4YC2C 3MYJB 1OT1A 4JAMB 3BZEA 2DWTA 5F7LB 3AGVA 4UQBA 1EXGA 2QCNA 3T8MA 4DGVH 3L4TA 1A3QA 5DFVD 2X30A 3MJMA 4K3EL 3G5ZA 1TTQA 3U2EA 4ZDHB