3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
3CLWA 3ARZA 4ZENA 1GOMA 1ZJBA 1US2A 4M82A 3VIHA 4ZE4A 1CECA 4AIOA 3CO4A 4M8UA 1YHTA 2D20A 2E3ZA 4CD8A 2DSKA 2E8YA 1EHAA 4MDOA 4HP5A 4B3KA 3BLBA 1V02A 5A6AA 4URIA 1UR4A 4AXNA 1E9LA 2V3DA 1V3IA 1LQ0A 4D6HA 4TVDA 4W89A 1UH2A 1BFNA 4TUFA 1H11A 5EFFA 4AD3A 1TVPA 2GDVA 2XM2A 3W25A 4P8VA 1W3JA 1V02E 1UD2A 1PAMA 3UG3A 1C7SA 1DEDA 1Q6FA 5E6ZA 1Q4NX 2B31A 4N42A 4UOZA 2YIHA 3OA5A 4DM2A 3BLPX 5A3HA 4P7QA 3AIBA 1CENA 1WZKA 1XGZA 4JL1A 4AD2A 3VX1A 2DH2A 1VEMA 1V0NA 4BZYA 1UASA 1A47A 3TOPA 1HP5A 3QR3A 3WENA 3T08A 2J77A 3AYSA 2X05A 1KGUA 3PZIA 4AW7A 2G41A 2OW7A 2YBUA 3J7HA 1MYRA 5E09A 4AZIA 1Q6DA 2VC9A 3EMQA 1HKMA 1UOKA 3M07A 2YDQA 1TR1A 1VIWA 1R85A 2WHKA 2WLYA 3T2QA 5FOOA 3AZRA 1EXPA 4CVWA 2JEQA 1SFSA 2W5FA 2E9MA 3AIUA 3N1AA 2PWHA 1W3KA 3K8LA 3HG2A 1H49A 3O6AA 3WF2A 3SCTA 1HL8A 3W27A 3BSGA 5JIPA 3GXNA 4CN4A 2DSUA 3EDJA 4JKKA 4RE4A 2XN1A 3AXHA 5D9OA 2Y4SA 4PUDA 2JIWA 1UQZA 4M29A 1C91A 3WUEA 4JFTA 4GI9A 3ARQA 3VSTA 1J18A 1LG1A 5EFDA 5BRQA 4PEEA 4AYSA 1EOMA 2VO5A 1KGXA 4HMCA 2WVVB 3WDQA 1C92A 1GJUA 1J0IA 1YQ2A 3NYDA 3UR8A 3AROA 4W7UA 3W26A 1HI7A 2EPKX 3HMCA 1RP8A 3A22A 1E4NA 1PX3A 3WD1A 3WEOA 1F4AA 3DDFA 1US3A 1TUXA 4WF7A 2J78A 3WDPP 1TMQA 1HJSA 1HL9A 1E4IA 4Z2JA 3BCDA 3RILA 1Y7VA 5CGTA 1WZAA 1AVAA 3AHXA 1GHRA 6CGTA 1GCYA 4KWUA 2J79A 3FAWA 4UQ9A 4DUVA 1NARA 5A8MA 2A3EA 1IV8A 1CGXA 2ZXDA 2WHMA 2PWDA 3LXBA 1GONA 1QNOA 4EKJA 4A4AA 3MV11 5C70A 2XHYA 1FP8A 1MWOA 3IJ9A 2TAAA 1H5VA 2OLHA 1VFOA 3HG4A 4ZXOA 3FAXA 4FNTA 3IGUA 3G6MA 4OBSA 1OIMA 3QOKA 2BNJA 1OSEA 1LWJA 2ZX7A 1B3WA 5E70A 1BYCA 2YLLA 2XFRA 4Q7NA 3WSUA 1VB9A 3N12A 1CLXA 4AZBA 1SMDA 2EBNA 5HPCA 1TE1A 3PZOA 3W53A 1H41A 7A3HA 4UFHA 5DT7A 2E4TA 1E1FA 1MFVA 3KZSA 2D3NA 2W62A 4AEEA 1W32A 4UQEA 4WJXA 3L4YA 2V5CA 4WLCA 2AAAA 2OW6A 4X9YA 3MV01 1GNXA 4P8XA 2FE0A 1FH9A 3AI0A 1H0GA 4ZXLA 1MXDA 3L2MA 1B3XA 1G0CA 2VX7A 1GUVA 4HPHA 4HOXA 1VEPA 1W9VA 2NT1A 2PWGA 4GQRA 4P7NA 2VUYA 1E6ZA 1J0HA 3ARPA 1E3ZA 2C0HA 1CDGA 1XH1A 4DUWA 5I79A 3PTQA 4R5EA 2VZTA 3UETA 1M03A 1UD6A 1E0XA 4S3JA 1G01A 4CVUA 2AMGA 1U30A 3WNNA 1WB0A 3WFZA 2YLAA 2DIJA 2JALA 4UQBA 2WZHA 3N13A 1OM0A 3AXXA 1W1YA 3SUVA 3ZJ6A 1PPIA 3K8KA 5ABFA 1BG9A 4H7VA 1JIBA 1FHLA 1EQPA 2J47A 5D8WA 4AEFA 1FOBA 2VR4A 4C7GA 1GVIA 1OWQA 1XCXA 2WCAA 3ZSSA 4W8BA 3A4WA 4TVCA 3AIWA 4UFMA 3IK2A 3CHCA 3KEHA 2EADA 5CPTA 2JF7A 4RE3A 3NUKA 1VEOA 3SUTA 1R7OA 3ARRA 1IZKA 1P6WA 3BAIA 4WSJA 4ATWA 1W1TA 4Z2LA 3AHZA 5TD4A 1XH0A 2X8RA 2IXVA 1M04A 3E1F1 1PBGA 4M81A 3DHPA 2QLYA 1E3XA 2XVGA 3WD2A 1UZ4A 2GK1B 2WMIA 4AZGA 5AY7A 4LX4A 3HZ3A 4D6DA 1QVBA 2BVYA 3ALFA 1GQJA 1PEZA 2W91A 1QPKA 3II1A 1JFXA 4OZOA 1KTCA 1MXGA 1GOIA 3LPOA 3CV5A 3CUIA 5CPQA 2J7CA 2FH8A 4CD4A 3VDHA 3CUFA 4B9YA 4BQ3A 1MW3A 4ACZA 4IPLA 3PZVA 1JXJA 4DO4A 2XVNA 5E9AA 3EMZA 1NOWA 5IDIA 2ZX5A 2EPNA 1HJUA 1AQHA 1ISYA 2OSYA 5C71A 2OWCA 3K4AA 5A8OA 1AQ0A 3VINA 3VD7A 4L4PA 1BLIA 1OINA 5AC5A 1GHSA 4J28A 2EPLX 3SCUA 5AYIA 1VENA 2UY4A 1EA9C 3PZGA 4CU8A 4JKLA 1CGWA 3WNLA 3DHUA 1V6WA 2YL8A 2XWEA 1KR1A 4NRRA 2ZUNA 3MUIA 2CKSA 1UR0A 3U7BA 4MB1A 2X2JA 1VJZA 4P8WA 4JZ5A 5CG0A 1SR0A 1RP9A 4DWSD 4MNKA 1UR1A 2CETA 3FHQA 3EMCA 5KEZA 2BXZA 2GDUA 1VBUA 2WMFA 4OKDA 5A6JA 3GM8A 4MJ2A 2WHLA 4MJ4A 3GH4A 1JYWA 5HXMA 3W6MA 2F7PA 3QOMA 2F18A 3WELA 1E73M 1V6YA 3WD3A 2VX5A 4AIUA 4LQ1A 2XWDA 4OJYA 1W91A 2VCAA 2ZICA 1VJSA 1E40A 4F9DA 1QX1A 2F7RA 3VVGA 1KBBA 2XVPA 3MMUA 4GI8A 2WM0A 4FF5A 5GNXA 1NP2A 1H09A 2VJXA 5HBFA 4DWSC 3OZPA 4JHOA 3DDGA 4B3LA 5KZ6A 1JDDA 3SIMA 4ATLA 1UR2A 4AZ6A 3THDA 7TAAA 2WMKA 2JIEA 1GOQA 4DUXA 3W28A 2ZIDA 5I77A 1B31A 1LL4A 3BVXA 1NM9A 3PZUA 4PTXA 2QMJA 2QPSA 3PZ9A 5D4YA 5I2UA 3CZSA 3CMJA 4W7VA 4BS0A 2WC7A 4UQCA 3WDHA 5BXPA 2DSVA 2XN0A 4JIEA 3EJQA 1VBRA 1MW1A 1TQWA 4RL3A 2CERA 3WH7A 1NP0A 1BVNP 3WBEA 1W1PA 2WANA 4ACYA 5A95A 4U2ZA 3AISA 1JNDA 3SUWA 1PIFA 3T0AA 3NCOA 1W3HA 3WY3A 2YJQA 1QWNA 2V3FA 1B90A 1UWQA 2BVDA 4M24A 1C8XA 4MB4A 2WW5A 3AHTA 4DO6A 1Q6CA 2J7EA 2WVUA 3UG5A 3WMCA 1W9PA 1V3KA 4Z2IA 1WDRA 1JF6A 4PUEA 1DWJM 1B3YA 1BF2A 4Q22A 5M5DA 4EE9A 3DC0A 3GYCA 5DMYA 1VFFA 3AIEA 1UKSA 4KGLA 3WDRA 4YPJA 2WMGA 2YDSA 3ARSA 1E1EA 4F66A 1XD0A 3ARWA 2YBTA 1WCGA 4H8VA 3POCA 1XRVA 4NF7A 1JAKA 3GXDA 1OGGA 4M1RA 3A47A 1TQSA 1CPUA 2WMHA 4ML4A 4BCEA 2WXDM 4M56A 3ZT5A 2CBUA 1TFVA 4KRTA 3WIJA 1S46A 2E0PA 2FHBA 2VVSA 2VX4A 3F4VA 3MUZ1 3SCSA 1HF6A 3GBEA 2GK1A 5EBAA 4ATDA 5D9NA 2EABA 2F1BA 3FW6A 3VIIA 1JZ6A 3OGSA 4QP0A 3CZKA 2J62A 1TQVA 3DX3A 1JZ5A 1KCKA 4CCCA 2XPKA 3VSVA 2YL5A 2J8GA 1KR0A 2EXOA 2NT0A 5I24A 3U57A 3ZM8A 1CYGA 1V0LA 1MQRA 2XYLA 4GKLA 2WPGA 1PJ9A 2WKLA 5A8QA 1XSJA 3CHEA 1G5AA 4A3HA 3DX0A 3W38A 1LG2A 4K68A 3VGBA 3DYOA 4J7RA 2G3MA 1GW1A 1NOUA 3MO4A 3NIYA 1WZMA 2EQDA 1SZNA 1HTYA 1XYZA 3WH8A 4HZ6A 2VZVA 1M53A 2FDMA 1E71M 4D6IA 4D72A 2BY2A 3ZSTA 1ITXA 2ZWZA 1HVQA 4RE2A 3VTRA 3HJEA 4MAZA 4AMXA 3BGAA 3H55A 3FHAA 1JZ7A 4JFUA 4AMWA 4GPNA 2VURA 3VMOA 2UY3A 4J27A 1JZ2A 4QLKA 4J3TA 1XSIA 4GIAA 5ABHA 2F61A 2XGBA 2RGMA 1NWTA 3AHYA 1V08A 3OLEA 5I3DA 2O9RA 3A4XA 2CBIA 5CGMA 4TX6A 1E6SM 3BAWA 1OD0A 2J7HA 3BCFA 3VGFA 1DHKA 2WWCA 3VILA 6A3HA 2GJXA 4W93A 3D51A 4AD0A 2QV4A 1XV8A 1J12A 2J7GA 4FNRA 2QHAA 4PBGA 4U31A 3CC1A 2WBKA 3VKKA 3GXMA 3VIKA 2A3BA 4PCTA 3BVVA 5FL1A 3WMBA 4LYPA 1GJWA 4X0VA 1V3HA 3GXFA 2E9LA 1HJXA 2BVTA 3W0KA 4XZWA 1PS2A 3WH6A 3VGDA 3VPLA 3CZJA 2GJPA 3W37A 3FN9A 3MUAA 4W84A 3UG4A 4QAWA 2C8NA 3M46A 2WYSA 2YFNA 5LYRA 4PMYA 3O9NA 4W5UA 3BAJA 1CGYA 1OT2A 2JFEX 4PMOA 5BYWA 2ZX6A 1UKQA 3RJXA 2VCBA 1VFUA 4ZFMA 2D0FA 3CBWA 3GH5A 2G3JA 1CGUA 3WKZA 5CLWA 5E0CA 2UY2A 3LRKA 4PSRA 1KXQA 4J3SA 5LA0A 3ECQA 2CHOA 1NH6A 4UFLA 1QNSA 4HA3A 1JYVA 2ALWA 3VD4A 3VX0A 3F5LA 4NZJA 5DFAA 2XSBA 4OGZA 3H54A 2VT0A 4D1JA 3K4DA 2BHUA 2ZE0A 3ZIZA 2FH6A 2VQUA 3L4VA 2J7BA 4H04A 3N18A 4W5ZA 3OLIA 3ZQ9A 1HKJA 2VL4A 2GFTA 4QDMA 5ECUA 3RM4A 4KGJA 1E4LA 2EPOA 1K9FA 1O7DC 1XC6A 2J74A 3EJSA 4HOWA 1ESWA 1V6XA 1W9DM 4WKHA 1HWWA 3B9EA 1RH9A 3WY1A 4JCMA 4HPGA 2PBGA 2WB5A 1PX8A 1CXHA 1WZLA 1GQKA 1QI0A 1UWUA 3WD4A 1JYXA 2X09A 1CXLA 2DH3A 4X0NA 1DWFM 4QLLA 3W4RA 3AFBA 4V28A 2VRJA 4ZEPA 1Q6GA 2W67A 3OIHA 1B3VA 3AHVA 3WF1A 1PZ2A 1TCMA 3GBDA 5IXEA 5A8PA 3AS2A 1H1NA 3WEZA 1B9ZA 1JZ4A 1U33A 3ARVA 1J9YA 3AS1A 4OBRA 2PB1A 2ZOXA 2F7OA 5JBEA 1JF5A 2FHFA 2OWXA 4PMNA 3CTTA 3ZT6A 1KFWA 4PRWA 3BXWA 2FGZA 2A3CA 1C7TA 1VF8A 2ZUTA 5I5RA 3EJPA 1UD3A 1W3LA 3IAPA 5M17A 1KXTA 3ZT7A 1D3CA 3CPUA 3WL0A 3L4UA 1UD5A 2XN2A 4LPCA 4NRSA 1KTBA 3WEMA 1CLVA 1WAWA 3KL3A 3RDKA 4PMZA 4W88A 1ECEA 4HZ7A 2VRQA 5BCAA 4OIFA 5LA2A 4AD5A 5ABGA 2D22A 3AYRA 1HKIA 2RGLA 1GOWA 4R27A 3NDYA 3ALGA 2E40A 4TX8A 3K1DA 3MANA 4AZ7A 1C3FA 2BY1A 4E2OA 1GORA 3WL1A 3ZOAA 5JIWA 4QFUA 1MVYA 4HOZA 3BMWA 2E9BA 2Z1KA 2UWFA 2XTKA 1ZBKA 1UHVA 4D6GA 3AMCA 2D73A 1GZJA 3NDZA 3VDBA 4AZHA 4PTVA 1Q6EA 1CBGA 5BROA 5GNYA 3SCWA 2D1ZA 2X1IA 1UWTA 3SCRA 2ZUWA 1XYFA 4HA1A 2WMIB 1JFHA 4JKMA 3D50A 2X0YA 2PC8A 4MADA 3TONA 1LJYA 4TVUA 2Y24A 2D0HA 3RM9A 1E15A 3DX2A 3BAYA 2VQTA 3CUGA 2EPMX 1C93A 2WSKA 4FMVA 4P7RA 3BUDA 4D1IA 1JZ3A 1J10A 3GH7A 1UKOA 3N15A 3BC9A 1LWHA 1PCPA 2G3NA 1V6UA 1W2VA 1OCQA 1E55A 5CSYA 1SMAA 3UCQA 3ZJ7A 4E8CA 2VX6A 1E9TA 2ZUSA 2WBGA 4ACZB 1PSPA 3ARXA 3VDAA 2CKRA 1H4PA 1KB3A 3BSHA 5HNNA 5FKYA 3TTOA 1B2YA 1GQIA 1D7FA 1EQCA 1UR8A 3A4AA 2O9PA 1WO2A 3KLKA 3AS0A 3WNMA 4EANA 3OB8A 4E8DA 3WFLA 5BRPA 3BH4A 2VCCA 4UCFA 1FA2A 3GNRA 1J0JA 4AISA 3AIVA 4GXPA 1KBKA 3GXTA 1MQPA 3NSNA 1A3HA 1TZ7A 4KMQA 2EEXA 4FNPA 5D8ZA 3CH9A 2E8ZA 4D6EA 4HMEA 3PBGA 2NSXA 5A8NA 1B0IA 4JAWA 1TA3A 3FNDA 1JD7A 3N9KA 3WNKA 3MS8A 2VOTA 3EJTA 4PYSA 2CEQA 1L0PA 1I1WA 2VZUA 1E6NA 1Z32X 1BTCA 4IUGA 4L4OA 4GI6A 5EB8A 3WQ5A 1T0OA 1XH2A 5HDRA 2ZXBA 3TV8A 3VIOA 1G1YA 3SURA 2PBOA 1HXJA 5EMYA 1HJWA 1ODZA 4U5IA 4D6FA 2HVMA 1QWUA 3ZR5A 3VGEA 3VGHA 3A24A 4XV0A 2WVTA 2D24A 2WZEA 4AIEA 1BPLB 3GXPA 3L2LA 3B9DA 3GZAA 2IXUA 1OIFA 4FNUA 3WD0A 1E0WA 1FH7A 3VSUA 1EO5A 3OGRA 4BQ5A 1BYDA 3QHMA 3WNPA 1EDQA 2W92A 4PMVA 3WQVA 4GQQA 3A21A 3T2OA 3WMSA 5M03A 3CHDA 1E6PA 2Y8VA 3CMGA 2C7FA 1UA3A 1BHGA 5A94A 1JNEA 9CGTA 1FH8A 4GO8A 3KL0A 4GZIA 2F1AA 3WNOA 3AIRA 5E0FA 1ZS2A 2OYLA 1HKKA 1E43A 2DGAA 2Y2WA 2VMFA 3BAXA 3AMLA 1ZB5A 3EDKA 1HXKA 4FLQA 4XUYA 4PMUA 1EGZA 1SYTA 1QBBA 1KCLA 4UFKA 2CPUA 2WVSA 2DSWA 3WH9A 2VVNA 2VI0A 3D4YA 3U7VA 2WMJA 1RPKA 4OUEA 4AMCA 4CU6A 4MAVA 8CGTA 2J25A 2DIEA 3S6TA 1FP9A 3NJ3A 3KLLA 2IGTA 4JHZA 3ZJ8A 4EK7A 4TTUA 3QGVA 2J8FA 2EO7A 2YA1A 1CZ1A 2XIIA 5BXRA 4W7WA 5I78A 1TQTA 1DWGM 1HVXA 3M6DA 4GO9A 1R46A 3RPMA 5E6YA 4YN5A 2XVKA 4BQ2A 1EDGA 1OGBA 3NSMA 3LPPA 3AZSA 4UQDA 2AOSA 3WUFA 3LXCA 1JI1A 3QHOA 4AD1A 4KH2A 4BA0A 3EYPA 4UR9A 1V0KA 2CBJA 2DSZA 3CGTA 3EJUA 1NWUA 4J3VA 4NSBA 4P7LA 4Y7EA 2EACA 4HU8A 3MI6A 2F7QA 2F8QA 1HX0A 1MW2A 4MNJA 4U3AA 4MB3A 3F5JA 2CNCA 3VD3A 4P8UA 1UWRA 3A5VA 3IJ8A 3LXAA 2D0GA 2ESCA 1DP0A 1HN1A 3SCOA 4AZCB 1K6AA 1OBAA 4OOUA 1AQMA 1PZ3A 1WE5A 1BGAA 1XHGA 3AZTA 4V2XA 4WKAA 3KL5A 1QHZA 4AWEA 1JDAA 2XVLA 4TTGA 1V3JA 5BWFA 4M80A 1OB0A 2G4FA 3GTNA 3RCNA 4CD6A 1CXKA 2OYMA 1R47A 1B1YA 4MNLA 2GSJA 1JZ8A 4DO5A 3MSGA 5CQ1A 4XX6A 3RMEA 4B15A 3IAQA 3WY4A 3HU7A 2VRKA 2BHZA 4H8UA 3WQ8A 5CZKA 4GINA 3VMNA 3A6OA 4IISA 3APGA 3MU7A 4F79A 3AS3A 3VNZA 2W4XA 1WPCA 2WLZA 4P7OA 2GJRA 1QNPA 2W61A 3TTSA 3PHAA 5FD0A 3HN3A 2BV9A 2ZXAA 1L8NA 3D3AA 3WQ6A 1TQUA 4JFWA 3QHNA 1X6LA 2WK2A 5A2CA 4HMDA 3MMWA 1O7AA 5BXSA 3IJ7A 4XB3A 3AMDA 1KGWA 3RO8A 2O9OA 2EAEA 2JF6A 5I6SA 2YL9A 3ZMRA 2VZSA 2CXGA 4F9JA 3PTKA 2MANA 3EBVA 1HT6A 1MFUA 1BSIA 4S3KA 2QMKA 1BYBA 4YHEA 3WDIA 2W66A 2JE8A 1QI3A 1V03A 3VMPA 4UFIA 3WY2A 3FY1A 4CU7A 3VIMA 1ZBVA 1WDPA 5GNZA 1E6RA 3BVUA 1EIBA 3SEPA 1DWHM 1PIGA 3EDEA 3LX9A 4WIWA 2WCSA 4PTMA 1W2PA 1CGTA 1G9HA 3AICA 2YFOA 1R86A 1CGVA 3ZR6A 2YL6A 3TTQA 4W87A 3K8MA 3SUSA 3ARTA 4H8HA 1QBAA 4QCEA 3JUGA 2XG9A 2CBVA 1UQYA 1R34A 5A6MA 3T0DA 5DT5A 4AD4A 4MB5A 3VIFA 3BUIA 1E72M 3UEQA 4UQAA 5A6LA 1FHDA 2O92A 4NX0A 3W81A 4CD7A 5F7UA 5LA1A 1QI4A 1N82A 4FK9A 3L4TA 5A6BD 5IHRA 3CZGA 5A6BA 2NW0A 2X0HA 1J01A 4NZCA 1UWIA 4PMRA 1BGGA 2CHNA 3BUPA 4WSKA 1ISXA 1LLOA 3A23A 5A6SA 4C7FA 3VUPA 1QW8A 2J75A 3GDBA 4FNSA 4U3CA 1W9UA 3EDFA 5A1AA 3THCA 1WKYA 3H53A 5IFTA 4A3YA 2XSAA 2D3LA 1GVYA 3F5KA 3PZNA 4CKQA 4TXEA 1WDSA 4CCDA 1BAGA 5AC4A 4MTVA 4F8XA 2XIBA 1TG7A 2PSPA 1HJVA 3MSDA 1WP6A 1OGSA 3A3HA 1VRXA 2D2OA 4MDPA 3ARYA 4PCSA 3PN8A 2V5DA 3CHFA 2PWEA 1G94A 3I3DA 2X2HA 1FFRA 2ZUVA 2YKKA 4AY1A 3O2LA 1I1XA 3OLGA 5CPSA 2OWWA 3NSXA 3W24A 1CNVA 2OYKA 2DDXA 4Z2HA 4PSPA 4CN1A 4XZBA 3TTYA 2BHYA 1H2JA 4CUCA 1CXEA 3PZMA 4W85A 1ISVA 1KWKA 4D71A 4GZJA 1HJQA 4JCLA 2QPUA 1ZBCA 4HA4A 2DT3A 3FXYA 1VAHA 4U33A 5D9MA 1HP4A 5JUVA 3AMKA 3PZTA 5A2AA 3D4ZA 2ZX8A 4MPKA 3UERA 3AIQA 3SCQA 1V0MA 2QF8A 2GVYA 1ODUA 3LRMA 1QHOA 1HNYA 1JXKA 5I23A 4QLJA 5CLTA 1UH4A 3CIVA 2Z1SA 2WKGA 3N17A 4LYRA 3WF4A 4LYQA 2ZUMA 1E70M 2UY5A 3IANA 1XCWA 1JL8A 5JBFA 4UZSA 1UUQA 5IHSA 1JGIA 5DO8A 1M7XA 1HIZA 3G6LA 1IZJA 3MKKA 1BVZA 2F2HA 2BFGA 3T2PA 4Z2KA 3EDDA 3CZNA 1UD4A 5HPOA 3AJ7A 3S5YA 5CXPA 1E6XM 3OG2A 1D2KA 5A69A 1QHPA 1CXFA 2HISA 3WF3A 1EO7A 3MMDA 1M01A 2G8ZA 1V3MA 2D23A 2V3EA 3VNYA 1VFMA 2FYVA 1RD6A 5C8BB 3DYMA 4D6CA 3CUHA 5ABFB 2WAGA 3T09A 4J3WA 3POHA 4WKFA 1W1VA 3TP4A 4HZ8A 1JYNA 1EDTA 2J7FA 4DWSB 1R87A 4PMQA 1NWSA 2VNCA 1F4HA 2V3GA 4AC1X 3I3EA 4JFVA 3WQWA 3MUY1 1K9DA 3HG3A 3SCPA 1UH3A 3AXIA 3W29A 2WC4A 1UR9A 4FLOA 3SCVA 1EH9A 3OBAA 3K46A 1UA7A 2GJXB 4DM1A 3WF0A 5AYBA 3VGGA 2OSWA 4IM4A 1AMYA 3VM7A 4HTYA 1H3GA 4D6JA 3L4ZA 2YDRA 4J3XA 4LXFA 1XSKA 1KXVA 1R33A 2PWFA 2ZWYA 1O6IA 3T0BA 4U5KA 1V6VA 1KQYA 4WK9A 3UESA 1CTNA 1JAEA 1PS3A 4NXKA 5I0DA 1WDQA 1K9TA 6TAAA 3VIJA 2WVVA 1E6QM 1QOXA 5DEZA 3OLDA 1B3ZA 3U5UA 1C8QA 1B30A 1NWRA 1QNRA 2WHJA 5JBDA 4GZEA 1PE31 2Q8XA 4H2CA 4UOQA 3B8SA 1E0VA 2G3IA 2O9TA 2YA0A 4UNIA 1ISZA 5CJ5A 1JI2A 1R8LA 3VU2A 2JEPA 1JD9A 1GOKA 5BXTA 4UFJA 4YHGA 3BUQA 1FFQA 3U5YA 3GXIA 1ITCA 4JL2A 1IT0A 4AYGA 3DX1A 1OT1A 3BUBA 3D52A 1DWAM 1LL7A 2BS9A 1ZBWA 4EAMA 3PZQA 4TOQA 3VD5A 5FCZA 3N04A 1ZJAA 1KXHA 3S2CA 2YA2A 2Y5EA 1NQ6A 2YOCA 1GQLA 2CYGA 3ZO9A 1LF1A 1C90A 4CD5A 1JDCA 3BVWA 1UKPA 4C7DA 4AZCA 4NZFA 3CZ8A 2GUYA 4BF7A 4N0RA 3M7SA 2DT2A 4E4PA 1W9BM 1E5NA 3DECA 4NI3A 2W63A 3WUGA 2EJ1A 3LMYA 1OD8A 1J0YA 1MW0A 3W82A 5M3WA 5CSUA 2CIPA 8A3HA 1UG6A 3L4XA 3HG5A 1KQZA 1BQCA 4PN2A 3CUJA 1GPFA 2CESA 2DT1A 3B9AA 4B9ZA 3UR7A 1PX4A 1TVNA 7CGTA 3WDJA 3GNPA 3VD9A 3WUBA 1BG4A 3VO0A 1QI5A 1DWIM 4HU0A 1TA3B 4UTFA 2VZOA 3AQUA 1C8YA 2XM1A 1E4MM 1K9EA 2DPEA 2WCGA 1UWSA 3OZOA 1LL6A 3TA9A 3BLKA 3EJRA 3W6LA 4BQ4A 3BVTA 2X2YA 1J0KA 3KWXA 2BXYA 3VM5A 2WNWA 3PTMA 3VIPA 4IPNB 1ZL1A 4FNQA 1JG9A 3VOCA 1EHNA 4QCFA 1I75A 5DF0A 2FGLA 1E56A 2WZIA 4CGTA 4H41A 1MQQA 1J0ZA 3AOFA 1ISWA 3LPFA 2IUZA 3DYPA 1UKTA 4UZUA 1R75A 3CZEA 5A6KA 2OSXA 5GPRA 2BY3A 3WN6A 3LPGA 1V3LA 4W86A 5FL0A 1CWYA 3SUUA 1EOKA 2ZX9A 5IFPA 1J11A 2CITA 3SCNA 2FHCA 2VR5A 1UYQA 3KE0A 4JFSA 1UD8A 2DQXA 4NXSA 5HOSA 1ZU8A 4J3UA 2XFYA 3VIGA 3RIKA 4PMXA 1GOOA 4U2YA 3BAKA 3WQ4A 4FLSA 1QNQA 2BY0A 3AMGA 2V38A 1X1NA 1QI2A 5ABEA 2A3HA 1R7AA 3RM8A 2XFFA 3GNOA 2WC3A 3I3BA 2WSPA 5A2BA 4OOZA 4ZE5A 4Z2GA 4DWSA 4MNMA 4PTWA 2XJ7A 3LRLA 2XGIA 1XD1A 3ARUA 1BYAA 1U2YA 3N11A 1WNOA 4FLRA 4CN6A 3WH5A 2A3AA 3WBAA 1E5JA 1NOFA 1X6NA 4KRUA 4B16A 1H0IA 2PF0A 2PI6A 2XUCA 3CZLA 1CXIA 3OGVA 4PMDA 4AZ5A 5D9PA 3ZJKA 3S5ZA 2X2IA 2CCRA 2J7DA 4W8LA 4CCEA 5GQBA 2ZUUA 2DEPA 2Y8KA 2J4GA 1CIUA 3DX4A 4V27A 1QW9A 3L4WA 1DTUA 2VTFA 2ZXQA 2WWDA 1W9XA 2DT0A 4W8AA 5E1QA 3BMVA 5FIPA 4LGXA 3D5HA 3RJYA 1KWGA 4UOJA 1UZ1A 3VDCA 1CEOA
chains in the Genus database with same CATH superfamily
1UMYA 3H2NA 3X3FL 5A2IH 1KT2B 2MSPA 5J7CC 1FXQA 4DXXA 3QI9D 5BS0E 4APQB 1JULA 1ZJBA 1J05B 5D2LA 2WINB 3HBQA 1ZAHA 1DIDA 3OB0H 1INQA 4E5XA 2H41A 4B0MM 2TYSA 3FO2B 4YLBA 1SHSA 4ZE4A 3NTCH 4K8RC 5C07D 1SHWA 3RJOA 5MENE 3ITLA 3WQPA 2H32A 3CO4A 4KK8C 2ODHA 4M8UA 5GJTH 3W39B 4EZJA 4XZMX 3RIFK 4Z0SA 4RNHA 1JGDB 4FL4B 1IGIL 2B7DT 1NCAH 2OJEB 4XMVA 3HPSA 4FX7A 3O6ML 4FFZA 4PRID 2E3ZA 2DSKA 4A6GA 2I07A 4IK6A 3QISA 5FKAA 3O16A 1A3LH 4BYHA 3V2AR 5EEZA 2CK0L 4ZW8A 4G43A 4XMKL 4HP5A 4DERA 4B3KA 1HNGA 2NQ5A 4MDIA 1K7EA 2W3ZA 3PP3H 4ZOBA 1E9PA 2HRWA 25C8H 3ELQA 3EBIA 3GIZL 4GY7A 4K8EA 4BJLA 4TUJB 3P54A 2FNBA 3EH4B 4Q97A 4URIA 3V0VB 1I1FB 1OEZW 4XMTA 4NYLA 5FO9B 2OZTA 1C5DB 2D9QB 1YPXA 4XPBL 3RWIA 3EX1A 3FN0L 3MDUA 1LQ0A 4BFAA 4LASH 1EP3A 1YYLH 3ULSB 1TZOA 1BXXA 3CMFA 1YNTB 1K8DB 4Y4KA 1H11A 5KS9E 4TUFA 2PPCA 2WKOF 2B7NA 4XO7A 3S42A 3IPBA 5D1ZC 2GDVA 4RLIA 1CTMA 4AW4A 4CQBA 5I9QB 5I73B 2CRZA 3GHEH 1P4LA 3Q0HA 4FMKA 4L4TA 4CEXC 1UD2A 2W81C 3NL2A 2IH9A 4QE5A 2OK0H 1AZNA 3UG3A 2PW2B 3QCTL 4P3WA 3GIPA 4UIKH 5EOCH 1XGPB 4URKA 3BW2A 5AYQA 3TAOA 4LESA 1Q6FA 1A5UA 1XBZA 3IJ6A 4UOZA 5FDWA 5GS2H 3JTTB 1KT2A 3D0LA 4FQQB 3RK8A 3R06B 4N26A 4EUPB 5K9JH 3K5XA 3G5WA 5KSAB 4MMZA 3IDYC 2PCPB 3ZKND 4P7QA 1QLRA 4NUPA 3W11C 5FI8A 5BUPA 3W7HA 2ZYFA 4NUGL 3PHOA 4AY8A 3VX1A 1PIIA 1NIBA 1UWEL 2NNRA 4WI5A 5KVDE 4PUBL 5GISL 4BZYA 1A5SA 1HHHA 2AL2B 4KCWA 2D3VA 5HHNA 4N2YA 1VFAA 1MUMA 2OU4A 4YVNA 3TOPA 2DQEH 3SBPA 3U82B 4JVPA 3WENA 1XB6A 2I7OA 5DWUH 3WXWL 5CLYA 5CZVH 4L9YA 4YAQB 1ZE3C 3WSQL 1VPQA 4NM4H 5ECGA 3VFLA 3S3GA 2YSSA 4Z5RB 1NM4A 3BICA 3CBJB 2AQ2A 2J73A 2YBUA 2CKBL 1I9IL 5EH1A 3PNWB 4HPJA 1BCIA 3O3RA 4N02A 3SECA 3NFNA 4FKKA 4A6YL 5FA3A 3B2DC 4NNBA 3GNDA 4CCZA 2J1WA 3BXNB 2W94A 4QT5A 5E8PA 2VC9A 3EOBB 5F2FA 4NZRL 1HKMA 2VMDA 3LJ3A 1KTRL 1BD2A 1SOSA 3MU3A 3TN0D 5T1KA 2ADGB 4KVPA 3M6YA 1UWGH 3CDZA 3VXNB 4WOQA 3RAOA 3A4EA 4JRFA 1REQA 1O12A 5TDNB 4YDIH 3I50H 2WHKA 2PP7A 2EJAA 3T2QA 3KTXA 2V2TA 1T6BX 4NUJA 4L1GA 3PJLA 3LS5H 2WIIB 2P5PA 3QWQB 1MVFA 4G72B 3QXWA 4L3EE 4Y4HB 4YBQC 4CVWA 1ZJHA 3R13A 2AAVA 3OO2A 3A3XA 1MFCH 2W0PA 3A9BA 3DRQA 3CFNA 3IFPA 1FXPA 3PS6A 4FG4A 1G9MH 1VIZA 1W3KA 4J1OA 3UTZB 4LNRA 4LF2A 3SQOH 4FLHA 2ACRA 3O6AA 4LCIH 3WF2A 5L9DH 1A6PA 3RY6C 1U8JA 3ZY7A 3BSGA 3DGGA 3FF8A 4LAJH 1XBXA 5JIPA 4R5EA 4X61A 3DBXB 1U9KA 4ZUVA 4JKKA 3CSGA 2QDVA 3AXHA 1AXTL 4R96A 2Y4SA 1WBZB 2Z7ZA 4IIGA 5FGSA 4UWMA 3MWAA 1H9DA 4NC0B 3RR4A 1UQZA 1KPRB 3MUGA 5C0CD 3TN0A 1ACZA 1HFUA 4HUWB 1CLCA 3WUEA 2BP8B 2D7OA 2ZG2A 4JFTA 1IQDA 1HHJB 3WOVA 2XIQA 1FC1A 3I6GB 2PDYA 1XT5A 1F8IA 5BRQA 4AK2A 4FFYL 1ZIAA 5LNSA 3CXOA 3N0AA 1QEWA 1YRRA 1MJUL 2VO5A 5LLIC 3V5DB 3MODH 2LLLA 2PP9A 4LPYA 2G2RA 4YHOL 1TMLA 2DS4A 3QZPA 5T3XD 4PJDB 2XGBA 3MBWA 4YIQB 2FEDD 3S35H 4C4BA 4IU3B 2L8AA 1J0IA 3RX7A 4Z8FH 5J5RA 3M7WA 5IHUH 3MUXA 5EO1A 4OV5B 3G5VB 2BRQA 2FQGA 2ZOKA 3IU4L 4I0PB 3VWJD 3OJVC 4LE8A 2JKEA 1G7MB 3QUKA 3IE9A 2PC4A 1X5JA 4AWTA 1I3GL 3NIDB 3NA9H 5CEZD 3QF0A 3SO7A 5KS9F 1WQVT 4G59C 4E9WA 2E27H 4JS3A 3WEOA 1OG6A 1ROWA 1UM6H 3WD1A 2ZF8A 3GSWA 4PRPE 1TV4A 3QUKB 3TBSB 4LLWA 2J78A 1ZGLP 1E4IA 4Z2JA 4GX8A 3FCTA 4ILSA 1N8WA 5CGTA 2FAUA 4PV8B 3ME0B 1IXPA 1JPHA 1I3VA 5EMKA 2DVXA 5IJKC 3AHXA 5C08D 4M02A 1RZJH 4YHZL 1ZLUK 4KWUA 6CGTA 3SI9A 2YZ8A 4IDLA 3LI1A 3R12A 3QIWB 5TPWL 3WLTA 4DUVA 3BRDA 4TSCH 3HHMA 1BFTA 4YK4C 3WE1A 4LP8A 2ICWI 4QGTA 3GR7A 4KIRA 1CGXA 2YPKB 2ZXDA 4NKMA 3QQDB 5HYJE 1L0QA 3FVMA 1EMTH 3NCBB 4OLEA 5IUCA 4QTGA 2V2HA 4U10A 2HH0H 1S9XB 4EKJA 1ZENA 3GC4A 5LXVA 4HEMA 4A4AA 3V0EA 3MV11 5D70H 1YMMD 1H5BC 3T8QA 4I48B 1EUNA 2GGIA 3ALWA 1M2VA 2LLNA 2X7VA 5EBMB 3P11L 4S1DD 4LUSB 1NPUA 2AJSL 2OMVA 2ZCKH 1VFOA 1CFMA 5FUOH 2VLKA 4W9TA 3MC0A 1C5CH 3BD4A 1TPB1 3UXKA 3HLAB 2V33A 3QOKA 3T05A 4YLQT 5D7JC 5CBEB 4MCZB 2BNJA 4BWWA 3O15A 4LEOA 2ZX7A 3OKOA 1B3WA 2YLLA 2BP8A 4Q7NA 4GC3A 4XVEA 5CH9A 1JCKA 4L3CB 4AZBA 1NCIA 2ZTJA 4RMRA 4NZ1A 2DMHA 1DQLL 1QRNA 1ICPA 4PJEA 4ZO8A 4P2OD 3D33A 1M7PA 1KM2A 5U7SA 4HGXA 1G7IB 2WBJB 3DJSA 3KGUA 5CD3B 3PWPD 5E2VL 3DZ1A 3GUTA 5FHBL 4EBQL 1NDMA 4EF8A 1YEHL 3T65B 5F96H 3B05A 2NY5L 3WXVH 1IJNA 1W1A1 1NKRA 2PRLA 2Q86B 3NQ6A 4L1BA 2W62A 3F00A 1XGRB 3L3IB 2PXYD 5FGCB 2GJ6E 1KJ2H 4OD3L 1W32A 2TSYA 4UQEA 3G0SA 2ZSWA 2PU0A 1E5UI 3QH3A 2Y7EA 4G8GA 1M71B 3LV3B 3FB5A 3L2IA 1A6WL 2Q1EA 2AAAA 3ZDZE 3ZDYF 4Q6IA 2C16A 3TN6A 1BZ7B 5IB1A 1RERA 4WHDA 5B4MC 1ZUAX 3EO1B 5T3ZH 4DBSA 1E90A 3GEFA 5JHDA 4N8PA 3F4NA 4Q7BA 4YHPA 2AP2A 1YDVA 3R7MA 1H0GA 1RK5A 4ZXLA 5LXXA 1U92A 1BD2B 1XMEB 1TREA 1UXWB 5JOFA 5H8MA 3AY2A 1L7TL 1MAJA 5KBKA 3WLMA 3Q48A 1KBPA 4KZCA 8XIAA 3BAEL 4L1LA 3TNNA 3FSAA 1NQKA 1OTSC 3BDYL 2ZSVA 3GC3A 3LLFA 4EWJA 3KYOB 4HPHA 4HOXA 4MASA 5GGTL 3H9HA 1W9VA 4QE1A 3RZCD 1Q38A 3GSOA 4AYID 2FX7H 2YAHA 2V5BA 2FX7L 4GQRA 4HKJA 4E9LA 3TLRA 1MIEL 3ARPA 5K9OA 1E3ZA 3JV5A 3I6KB 1CDGA 4V11A 5DS1A 1XH1A 3VXRD 2NQHA 2NXZB 5IFHL 3W1RA 4EXBA 1M57B 2VZTA 3UETA 2QYGA 3R43A 5E5MB 3TFKD 1OAJA 2D03L 4J3OF 1QW7A 3DVNB 1TE6A 4XD6A 1EFXA 1OP5K 4BQ9A 4ZMVA 4AWUA 5AYTA 3AQDA 4OLWH 4G83A 2FEDC 3WNNA 4TV3A 3QHFH 5KVFH 1N6QL 2Q6WB 3MZGB 1GGBH 4WKZB 1M71A 3LV3A 2YLAA 5EMUA 3OAZK 4UQBA 3DIPA 4ZJ9A 4GQZA 3TCSA 2B9AA 2Y69B 4Z77A 4X60A 2BP0A 4TUOA 3EYQC 4ZS7L 3LQMA 3A4FA 1L4IA 3FOLB 3ZZ1A 1L2QA 2IWGA 1PPIA 4R4ND 3T0EA 2F8VA 4LP4A 4WHTB 2F6AA 3AITA 5KG9A 4FQHA 2VUKA 4O1AA 1CL7I 4O02B 1N6QH 4TVPD 1MRAA 2QKFA 5HMSA 1UOWA 4KKPA 4X6FA 1WQ5A 1OHLA 1IC1A 1HHGB 1RK0A 1RAMA 2WMKA 2AQPA 4DF2A 1KDIA 3M9YA 4K7FB 1CR9H 1DUYA 2JIEA 2UXFA 2X89A 3RWDA 1AD9B 3EJYC 3RTLA 4TVCA 1OOAA 3CZUB 2X88A 4HT1H 2JKNA 1NFAA 4RAUB 3C2EA 3VXGA 3IK2A 3BSZA 1F41A 2EADA 1T5XA 2WOQA 1CD0A 3VI4B 3WUWA 4Q7DA 1YEIL 2IH8A 4ZW7A 5FKAB 3KBSA 2WLKA 3BPLB 4RQQA 3PM6A 4G7EB 3NUKA 4ORMA 4RE3A 5G1MA 3L66A 2DU2A 2EYSA 4K3ZA 5D1QB 1X9QA 1IZKA 1UXSB 2E7MA 3VI4A 3BAIA 3ABXA 4NNAA 5GGQL 4QOKB 1S9VB 1QJWA 3IGLA 1VS1A 1HWHB 5DGQA 4XTDA 4QRUA 5CGBA 4E3TA 5F70A 3H7BB 1XH0A 4DOHB 5D2LB 1OF2A 1A3ZA 3UFIA 2OR2A 4R2GD 1KUMA 4N5ED 3NFPA 1RBOB 3C52A 3BZFB 1T80A 3DHPA 5CEZE 4IPPA 3S9ZA 1I1AC 2XVGA 4O02A 2YLHA 4L4VB 1XEUA 1UZ4A 8TIMA 3M7OA 4WI7A 3MPGA 2WMIA 2K4WA 5DRXB 4YXKL 5AY7A 1MHEB 4RW3A 3VKAA 4G1EA 4IOFD 2FX8H 4FHJA 4PJ7B 1QVBA 2FZ8A 2PLJA 3PWVA 3ALFA 1FIGH 3QUYC 1FIGL 2W91A 3S2AA 3II1A 2ZVRA 3LAFA 4LW7A 4YHZH 5CJNA 4OSUH 4ZOCA 2NUYA 4YVXA 3GHUA 5E8PB 1SJHA 3B8VA 4O28A 4P04A 2J27A 4JTHA 1YKWA 3LPOA 3V4LA 4R9XA 3AU2A 5C1MB 1MI3A 1YNLH 2MWCA 4NJGA 4RK8A 5FEBA 4JQ1A 4UUJB 3HC4H 2VFGA 1GHFL 5LIUX 1E1CA 4IPLA 1XUUA 4IFOA 1I3GH 2F8IA 1NMBL 2HLFD 3GS7A 4M48H 5D7LE 4LVBA 5JPMB 4RXGA 3FN3A 1B6UA 3RWGA 2ZKWA 3D85A 3EMZA 5EORL 1S5VA 4HDIA 2DJXA 4Z9KB 1Q1PA 1KN2L 2X6BA 1HJUA 2P42B 4UIMA 4V15A 3OF6D 1OAXL 4DKFH 2XBTA 1ZGLB 4Y2LA 3ZE0B 1NOAA 3EAUA 5EMLA 3LN5A 2J8UB 1I2QA 3Q6FB 4P2VA 4KUZH 4PTUB 2OWCA 4ZQMA 1NCNA 4EUPH 3RLHA 3SRHA 1AQ0A 2HX9A 3NXLA 2VLJE 1LOQA 1FVEA 1F2XK 3N2OA 1BLIA 3UXAA 3KMDA 2WBWB 2I27N 1TZHB 1NANH 5JDSA 1GHSA 3SGDH 3TT1L 4J28A 3V4VA 4GQGA 1RQBA 1ALDA 5AYIA 1VENA 5HJDA 4FYQA 4POUB 2IDFA 1JRHI 4J39A 2VQ1B 3PZGA 1KPRA 2Z8WC 3MUGB 5FYJE 1KMGA 2WXIA 3OHXB 2DVUA 5C8JA 1PG7X 4PJEE 2XPZA 4XVDA 2FKPA 4XNMA 3DHUA 1V6WA 4G71B 1KXVC 2A74C 2VC7A 2E74C 4GD0A 3STGA 1OSZB 2JK2A 1EZVX 2MIZA 2X9YA 3V0GA 5BVJA 2ZRUA 4AVNA 2ZUNA 3MUIA 1QNVA 4JM4H 2BH0A 5CJQH 1MLCB 4ACPA 3FXGA 1VJZA 3MO7A 4JZ5A 3CLFL 2WUBH 3P4NB 1RSCA 3QULB 2C7UB 3QHZL 3BLFA 5IWLA 2WV8A 3W2JA 1ZXKA 1OCCB 1Q8JA 3DRQB 3DUHA 4MNKA 2VDRH 1UR1A 4Z7OB 4GI4A 4Q4KA 2CETA 3ABRA 3BOXA 3G1DA 2WZTA 5MERB 1I8AA 2GDUA 3UU0A 4DWHA 3WO3B 5T3ZD 2XZ7A 4MJ4A 1J9RA 3HRPA 1Y18A 2DIBA 4LLUA 5D71L 2Y5TA 2BOEX 2WXOA 4E42B 4LYKA 4K8RD 3QRLA 4WY0A 3W6MA 4DPBX 1VERA 3QOMA 1MRCL 3WELA 1J8HE 1E73M 4YYCA 3O0LA 3OBKA 1ZVSA 4M1CC 5G4WA 2VX5A 4LQ1A 2XWDA 4KJQC 2RDWA 3E2RA 1CE1H 1XQKA 3ANVA 4R4BB 3ATYA 1IM3B 3T6ZA 1IT7A 1FI8C 1G4PA 4XD3A 5DMIL 5AHNA 3II2A 4EPDC 1P48A 3IDXH 2NXYC 4PJHE 3IIOA 2VCAA 2Z64C 3W7JA 2ZICA 4MZRA 2IFFH 5GS1A 2QZQA 1EBPA 5DFVC 4CMMB 3ELAT 3SGEI 1QX1A 3HJ0A 3NA4A 3H4HA 1YYCA 4EVNA 2WNNA 3CAWA 4UTTC 1BM7A 4XMXA 4JR9L 5JO5A 1KBBA 4JK0D 1L5GA 1TYJA 3I9IA 1N59A 5DVOA 5B1JC 5I5IA 2DZWA 2XVPA 2WM0A 4XNQB 3ZHKA 1TVHA 1AK5A 5CGYC 3TAKA 4XTRC 2F54A 3B2VH 3U30B 3HOJA 3H3BC 1TJ0A 2JI3A 1UWAA 3MYJA 4H26B 3SIMA 1QLFA 1OAYL 3LZRA 1OGAE 4FQ1L 4PI0A 5HTSA 3RX9A 1UR2A 4FS9A 3T8MA 2HXTA 4POZD 2XISA 4GP8B 3TXZA 1JZDC 4FTDA 4JY6A 5GSVA 4HIBA 5F6HJ 1TETL 3W1AA 4H8PA 3W28A 5SWSB 1G6CA 1HDMA 1M7IB 1WCBB 2OMWA 2YPLA 4WUUD 5AW2B 4AK1A 4YX2H 4TU1A 4AQLA 5I77A 1QKZH 1YMMB 3BN9C 4OLZL 1B31A 1QTWA 4DYJA 2C1OA 4OAWA 2VQ4A 3BVXA 4QNPF 4QXUL 3RFRA 4PTXA 3L4CA 1G7HA 1ADSA 3PZ9A 1X5AA 4H2HA 1FSKC 5D4YA 4MQTB 3WBYA 4DY1A 4ZB5A 1QOQA 5AOJA 5EBLB 5BXPA 2VIRA 2Y1YA 4ZZKA 2Z1WA 4NP9A 2CUIA 3QULA 4H8WC 1HZHL 3GHTA 2XN0A 1FFPB 1KRAC 3O3BB 1GY2A 1JP5A 4HWZB 3RJQB 4JIEA 3LHPL 2ZA2A 3SDCB 3KBNA 1URZA 5C07A 3PULA 1QZNA 3WIFB 5MERA 1FWHC 2C13A 1GGCL 2GJZA 4RL3A 1BVNP 2DY2A 5IBUG 1F3JA 2DPKA 2WANA 4K5LA 1BVWA 1GT8A 5A95A 3ITTA 9RUBA 4U2ZA 3AISA 4LAMA 2VQ1A 1KG0A 5CAYB 1OCZB 2IADB 5CEYB 3PJTA 1DQDL 1E7UA 3JWDH 3MRDA 3UTSD 1JOIA 2G30A 2YJQA 1A21A 2PE4A 2YLKA 4Z3TA 5LQBH 4ROQA 1CD1A 3PG2A 1U8KA 4UTUA 5EY5A 1NCHA 4H7ZA 4WI8A 3MLXH 4XAWL 4OTXH 1FG2A 5DRZA 1GVEA 3EPMA 4PB3A 4IBVA 4ZTEA 2J7EA 3LCLA 5HULA 3WMCA 4IGBD 4XXWA 3NFUA 4U6YB 1WDRA 1YDOA 4Z2IA 3AG2B 3SOBL 3T3PE 5DK2B 2X1OA 2FJKA 1W6LA 1TZ8A 2OMBA 1DWJM 2KC0A 5HJLA 3UP1A 3KD4A 5L2JB 2VLMD 4LOVA 4BEUA 2E3VA 1GRWA 5IGXH 1X4XA 3NJMA 2HROA 6REQA 3IDYB 2OZ3A 3U3HA 2BIQA 3KDPB 1AZ1A 4Q9RH 1COBA 4X6CF 3KCWA 4TNGA 4BIKA 3QNFA 5EO9A 5CJBA 1KCUH 1E1EA 1O6VA 4MNGB 1NCTA 2Y06H 3MR9B 3PREA 5B7FA 4RWHA 5REQA 2VDRL 3ARWA 4L37B 3AAZB 4RIRA 4YNYB 1GSMA 2TSAA 5F6IC 4UB0L 1GKEA 3WKML 1UGKA 2IWFA 2ZXEB 3FQNB 2QGDA 3D25B 3DXAB 5REQB 1AKJA 1TQSA 4JTTA 5EG6C 4ML4A 1SEBB 2EIJB 3N85H 4OLUL 4XVUC 4BCEA 4M56A 3ZT5A 5LZLA 1LEGA 4D0CB 2QJIA 3RUBL 2X5PA 3L8QA 4AY0A 4KRTA 5KVDH 4MCYB 3GRWA 1F6AA 3ZQXA 2MPAL 1S46A 2E0PA 2VSDA 3CQKA 4NKQB 2FHBA 2O5XL 4X2RA 2VX4A 1U8PA 3R06A 4EUPA 3OOQA 2CIKA 4RGOL 4K15A 3VVVA 5JYMA 5KYUB 4JTLA 3CMOH 3MUZ1 4MMWA 1MCCA 3TJXA 5AQ0A 4G6JH 4OKVB 2R69A 5HGBA 4EMZA 4YSRA 2DF3A 4RH4A 1IWPA 3SCSA 1LJMA 4HKXB 2DTMH 4FX8A 3U9PH 1YJDC 2H6RA 2ESVB 3BLLA 2NXYD 3BO8A 5I74C 3I85A 2UY7A 5KBPA 3VI3E 5DHVA 4BFFA 2N3JA 4I1RA 3VIIA 1WBXB 3PWAA 4RISL 3PN8A 1IIHA 1WTLA 4HBQA 4PZVA 4U6VH 4QCIB 4N20A 3F1QA 1TQVA 3PUCA 4FJYA 4PGCA 4PS7A 1JZ5A 4TXVB 1RV6X 1OADA 4CCCA 1S9VA 2FPTA 3STBA 4L8CA 2PDJA 5I82A 1PF3A 2UYLA 3H9ZA 3EA2A 3X14A 3KCOA 4ODVL 5SV3A 1HSBA 4YZFF 2EXOA 2ZYRA 4W9KC 3U36B 1GC1L 3AHYA 3IIPA 4CQDA 4GQ0A 1CGSH 5LAXB 1XCTB 4AX3A 2ZONA 5ELIA 5KSUB 3EF7A 1HHKB 1KYDA 4YDJB 4ZUSA 1IVLA 3CQQA 4POZC 4RA3A 3SPVB 1OJXA 2XYLA 4FSAA 5DLLA 2QCHA 3GSVB 3T4AA 3RP1A 1PJ9A 1H8SA 4FZ8L 2VUOA 5HDBF 2CHWA 3RWDB 2QSVA 3B1TA 4FRWA 3OG6B 2EE0A 1UM4H 3CIAA 4QJ3B 1EEPA 2PDNA 4B5UA 4EBQH 2CKBH 2NXYB 2R9RA 2O7QA 4GSUA 3VGBA 5FM5O 4DGYH 3DFOA 4J7RA 1BIIB 2Z35B 2TRYA 2WQ8A 3EFDH 5GJPA 4DQOH 3NABH 1KFKA 3QAQA 5DS8A 1PO9A 1XYZA 1GC1H 3WH8A 3TF7C 4X2UA 1AS8A 1H3VA 3BE1H 4YDZA 4H6RA 1I7UA 2XU2A 2JV6A 4D72A 3FOLA 2CO2A 1A4JA 1HVQA 4D9QE 4JPVL 5BOPA 3QIBB 1ACCA 4Y1AE 1JVOA 3ECWA 3L5IA 3ECUA 4G6AC 2XPGB 3BGAA 5E00B 1LRQA 2Q3AA 3H55A 1K70A 3GAYA 2AGJL 4OF5A 1TV7A 4GPNA 3P1VA 5BMWA 2X28A 5BZDB 2RUSA 3O6FA 4FXTA 1WICA 2EO9A 1QSEE 4P3CH 3VACA 4DETA 1OTSD 1NFDE 5EEXA 1HG3A 1YDPB 5HVHC 4J27A 1FCUA 3QNZB 2X0UA 3GHPA 3FO0H 3TNNB 3IK4A 4QLKA 4N0UB 5FEZA 5D05A 4L5FL 2J20A 5EPMA 3RWHA 2B4CL 2YEZB 1WAAA 3FTGA 4FI6A 1R30A 3SGGA 1DZ0A 2W07B 2AKRB 2C9XA 3MRQB 4IHOA 5HYQB 1HYSC 1ZHLB 1IUZA 2PYED 2BOCA 3QZLA 5F7YC 4ZW3A 4M6NH 4LALA 3N9GL 1S7QB 2YPLE 3MRCB 3BARA 3KPLA 4QR7A 5I15L 1XKYA 3KVPA 5HGDB 4GKZA 2CO7B 4LPTA 3EB4A 5H6HA 1JGMA 1ZLVH 4JQIH 4OCRH 4OR1A 5KVGE 1WTGT 3D6NA 3RRAA 3CXDL 3MLWH 1HKWA 4X9FA 2CBIA 5CGMA 4EF3A 1HO4A 3T1FB 3A4XA 3FT4A 3BAWA 4PRIB 3RQ3A 5BW7A 1TWWA 1SPDA 4TLKA 3VGFA 1DHKA 2J7HA 2VLJB 3U2SB 4MY1A 1CQYA 4S1DC 2E68A 4I2XB 2KI6A 3VILA 2YCIX 3OKMA 1QVOB 4X5WA 1KIRA 1RQ5A 5A2FA 3D51A 1HHIA 3W2DL 3IWPA 2A77L 1U8CA 3NA9L 4OJAA 2GEEA 3AAMA 1YEYA 2C4XA 2NLJA 2WBKA 1BFSA 4IMCA 2C15A 1N4XH 3OG4B 4IX2A 1E6JH 2A3BA 1NBVL 4W81A 1AS7A 3JV4A 4HSQA 1USQA 5FWRA 3RVTC 4ZX3A 3BJFA 1T7YA 3LQLA 5FF3A 1KFGA 5HDBE 3UROR 4UDUA 4PRAA 1WAAE 4XCCL 1SU5A 1IBGH 3L67A 2MCPH 2JKXA 1I85C 4XBKA 1OABA 2E9IA 5F7EH 1FKXA 2DZVA 4XZWA 3D12B 2H3NB 3JTBA 5ANME 1HKLL 3E38A 5F7AA 5AW7B 3M4HA 3LIZL 3UG4A 1IC7H 1E51A 3LHUA 4QAWA 3B3IA 4D3CL 5DCBA 3VJ6B 3IIZA 4MSSA 2UWEE 2VXQH 3KLAB 2V8MA 2WWKO 4DJFA 4K07A 3S3CB 2LAGB 4JIHA 1M2VB 4LS2A 2YFNA 4NBZB 3W7CA 3WCZA 3X3FH 4XWGH 3BLIA 1WGOA 1LL1A 1TEFA 2VW6A 4GIRA 2KZ1B 3BAJA 5I76A 4TSAL 5IMLB 4ZUTA 2XKNA 4KW2A 2JFEX 1H3XA 1P2CA 3AADB 5HD8D 5FYJU 5IW1B 4HD9A 1E28B 5SWSD 3SZ8A 3W1TA 1OPGH 5BOFA 2ZX6A 5ETUB 1NTDA 4X4YB 2XRAL 4JKNA 5HY9B 4PWFA 3RJXA 1CZ8H 1X39A 4MA8L 4J3BA 1GPOL 2A9NL 5SX4I 1FZOB 1LMKA 2VIRB 2VL5B 4NJKA 1F4YH 3IV8A 5JMUA 4BV1A 3CBWA 1OARL 3NK4A 4TSBH 1ZVNA 2VR3A 5FW7A 2G3JA 5AVNA 4I18A 2OEKA 4JPKH 3KBHE 4X7EC 1F4WH 5CUSH 3B9KC 5EPMB 5C9UA 3WKZA 1W2KT 4N86A 2R51A 1NMAL 5E0CA 5JA8B 2I69A 3O3DA 3U46B 5I17B 2OX1A 2UY2A 3D06A 1TKWB 3FT3A 1SM3L 1PL9A 5E2VH 4GJ1A 2R23A 3RIAF 5LA0A 3C60D 3NPWA 3MUCA 3MRHB 3ECQA 3ZJAA 3OW1A 2QKSA 1E67A 7FABH 1HH6A 1NH6A 4LLVA 2KZBA 3VG9B 2LV4A 1RSYA 2DQDL 4ADGA 2P44B 4Y19E 1QNSA 3WK0A 3OKNB 2ALWA 4J6RH 4PJAF 4YDIL 1ZA6A 1FDLH 4PJ6A 5DFAA 1E9IA 3QUMA 3VZZA 3RLVA 3FJ6A 4Q9QH 1V5XA 4JG1H 2VT0A 2ZWKA 2R1MA 3K6DA 3W1PA 4PGJA 4K9EH 1NC2A 3HMXA 1XGTB 3TIEB 4OZHB 4P46D 3GG0A 4L4LA 2JB5L 1GG0A 3OLIA 2A83B 3LZQA 3P11H 1I2PA 1P1VA 1HESA 1TPDA 4F7EA 5ENLA 5AAWC 3HR5A 4PLKC 1RUAH 3NIDF 1EP1A 3TWBA 5I30H 2GFTA 4FIQA 1NGYB 1PLAA 2K1MA 5T8IA 2O93L 1CJYA 4F37K 1PY9A 3X17A 4PMFA 4HXAL 3NQGA 1S7SB 2G2RB 1K9FA 3MOBH 3QIUA 4HIEA 1XC6A 3CYVA 4K5NA 5TQ2L 1W9DM 1XXXA 1OM3L 2QDEA 1J8KA 1A1MB 1CCZA 1IGYB 1N8ZA 4LQFL 1X8FA 4H6QA 4NQQA 4WY0B 4XN8A 4MLIA 1AZZC 1FWEC 3BMXA 1RLCL 4G6ML 1S1PA 3QR1A 2IG2L 4QJ1A 4AF0A 1WZLA 4ZMZA 3NM3A 4YDMA 1JHLL 4HJSA 5DC2A 4ERAA 1UWUA 5JH1A 2Y0FA 3S8GB 1AH1A 2YHGA 4AVJA 1K1DA 3CEUA 3UJTH 1CXLA 3CHOA 4Y6GA 1Y6NR 2Z31A 3KRBA 4YJ5A 1H3PL 5D96B 3HGJA 2JK5B 5J89A 1EWDA 4ICCX 3UY7A 4UANA 3W4RA 4A22A 5DMKA 3TN4A 1ICSA 2VAAA 4HKXA 5FJJA 1RL1A 3F58H 4WU7B 2X6MA 1Q6GA 2W67A 1GOFA 1PZ2A 3GBDA 1ZTXH 4N2IA 3OKLB 2L0DA 4L6OA 3WLQA 1OC6A 5A8PA 3AS2A 3HIZA 2XWJB 1RZGA 3FZUC 4LEBA 1B9ZA 4LKXB 2COVD 4WI0B 4WNSA 4XBMA 3U30C 1JZ4A 2JJSC 3VXOB 2OO6A 3KPLB 1IE4A 5T5FH 4UWQB 3AREC 3UBFA 1S1RA 1OAQH 1SEBA 1MHCB 4Z7OF 1TPXC 4OJDH 1NINA 1TZHA 5JDSB 1RZ8B 2EXTA 2FSEB 3QFDA 5DHXB 1A9EB 4XMKH 4GRLB 5CO1A 3T1FA 5I2IA 1SBBA 2JNZA 1OGAB 1J9YA 1W8NA 2VDNH 4H13C 5KYXA 3EO9L 4X6CB 4I8DA 3ECBB 2OWXA 3QLDA 4IF2A 4A3RA 5IVXB 1IGIH 4JPIA 4LCVA 4OUUB 3TE9A 3D34A 5EC1B 2B14A 3S36L 3C09C 3ZT6A 3DCPA 5J6SA 1FBIL 3KH3A 4G5ZL 2YCLB 1FPTL 4UZGA 2P9RA 1YC8A 4GFXA 5CC3A 3VWKD 3UBXI 1CDUA 2RA1A 5F4XA 3EADA 5I1HH 1UD3A 1RZ7L 3HN5A 2WBJC 2VSCA 2GOUA 5CGYD 3MCOA 1ZHNB 4Z1CA 5I1LB 3KAOA 4D7BA 5EC2B 2BJMH 1I60A 2CLEA 3L4UA 5HYSA 1EFQA 1X44A 2H8XA 4IJTA 4ZYKA 4A8IA 4N0UE 2VN7A 3TN0C 2V2WA 3DX8B 4LPCA 2OMZA 4LSSL 3WEMA 4IMDA 4JX5A 4NRSA 4RW5A 3KL3A 1MQKH 2FK9A 3IDJB 3MJ7B 2E76C 5L0QB 4ERIA 3IJEB 3C75A 4YWGH 2MKWA 1DVJA 4OIFA 3L16A 5IROC 5T3XH 3ZLHA 1XYCA 3QO1B 4J8QA 5BVPH 4JGDA 2D22A 1RUPH 3AYRA 4PG2A 3C60C 1DVXA 4H7CA 2OMNA 2YRLA 4XBPB 3GW3A 4WDWA 1TJ2A 2HVJB 4GP4B 4B9KC 4Z7NB 2Y5JA 4FN0A 3A0OA 4DW2L 4R27A 4WCJA 2BNRD 3U0PA 1MJ8H 2GTZB 3BZFA 1OP5H 1IGSA 1XLKA 4RRPM 2ZOTA 1JXFA 1Q9OA 3F2BA 5I0YA 1BVLB 1CX9A 3M0XA 5I5MA 2WQVA 2XIDA 4DJMA 4X50A 4GVIA 4QRRB 3HKZA 1HEZB 5JXAH 3U6RA 4KWWA 3BHBB 4OLVL 4AL8C 3FTXA 1C3FA 3E0LA 4JTAA 5B8CC 4JEGB 3UJ2A 2E5BA 2HKAA 1XDJA 1MUWA 2ZTKA 3C61A 3JR2A 4RUBA 4FQIH 4PLKD 2FECL 2FL5B 3JYBA 2QVTA 1PMYA 3BHBA 1D2OA 3LQAC 5T33L 4XRCA 1UC4A 4EX4A 1YEKH 4U6HA 3CZFB 4NNXB 1R9FA 1UT2A 3TZFA 1KYAA 2Z1KA 1EANA 1DV7A 2UWFA 3S5LA 2YKLH 1OHZA 1OTUC 1Y6KR 3HG1D 1JGEA 1RUKH 2ITCA 2ARJB 2W59A 3MBXH 3MMEA 4XBGA 3ZTJH 3AMCA 2D73A 4Z1YA 2WMPB 5DRCA 1TV8A 4X6FB 5IVXE 5KBMA 1A4CA 3P0YH 1CBGA 4JTUA 3DV4A 4PJXE 4MCYA 5A40E 5GNYA 3SCWA 4EI5C 2DQJL 2B2XH 1CDCA 2GUOB 2WNXA 1UACH 3AWFA 3QZWA 2X1IA 1CFNA 2PDXA 3UWUA 4LNCA 3SCRA 1XYFA 4ZX4A 1VZGA 3EAKA 3IMVA 2HS6A 1RY7B 4OKVA 4JX4A 3IJEA 2K6WA 2KLTA 2RTTA 3SKUD 3MGAA 2F6KA 2APFA 3FUIA 1PU0A 4XVOA 3VFNA 3S88L 2Y22A 4KQ0A 3TONA 3R8GA 1U0QA 4TVUA 4GRLC 2UZXA 5ERWB 1S5HB 5I00A 4MBRA 2DKUA 3G1VA 4LHUG 3GMOA 1E15A 3CUZA 4I7WA 2FQFA 3DX2A 4F3FA 4XZNX 4H0HB 3Q8BA 1XZWA 1QFWH 5CPOA 1BD2D 4RPPA 3CUGA 3PWNA 3HLKA 3GMPA 4S10A 2TODA 4EI0A 1C93A 1PZBA 2G50A 2C9SA 4JIPA 4P7RA 4XZIA 2HNEA 4B50A 1X38A 3W00A 2GC7C 1LOSA 2QAFA 1GYLA 1Q6RA 1U93B 1ZVYA 4MHHG 1WAUA 1PCPA 4MXVF 4JTFA 1KCBA 3TU6A 2V17L 3TBBA 3V9FA 1TTPA 2JKAA 2QTEA 1OCQA 4DXKA 3BG5A 4S2SA 5I16B 4YWSA 2NQCA 5B7YA 1SMAA 5EU3A 2VR7A 3UCQA 4AXWA 2X7WA 1ED3A 2B1HL 3ZJ7A 2VX6A 1XP3A 3LHAA 2EEBA 2ZUSA 4Y5YB 4QHMA 5GS2D 5IEHA 4E0RA 3BXWA 1PSPA 1NUGA 3IPEA 4KTDH 3PJSA 2CKRA 1H4PA 1O4UA 2HVNA 2YQBA 5FKYA 1EGVA 2P80A 4PJBB 4EI5D 4I9XA 2Q71A 1HSAA 2X4TB 3PWPB 3A4AA 2JXMA 5EA0L 1EEXA 2FBOJ 2IBBA 3HBZA 3JBG7 1L7TH 3P4NA 4L3ED 4M43L 3W1ZA 5D7LA 3WTVA 4MJIE 2YXOA 4M8QA 3JZEA 2QHRH 1IGML 3BH4A 2DP3A 1MREL 3WFLA 3C60B 5IQLA 2EKJA 1UWXH 3K71B 1VC4A 3IXTA 2NY6B 5AAPA 4L8BA 1Z9SA 3T0EC 2FMNA 4HHMA 1KM4A 2BZ7A 2H3NA 3QJZA 4Z7UA 2XWZA 4XNMB 3PFRA 3HM7A 5KYWB 4LSVL 4AISA 5L4JA 4MBOA 4JDYA 3HI5L 5HWJA 1ZLPA 3FKKA 3L3DB 1N19A 3BSZH 2NY7H 4HPYH 2RHGA 1TZ7A 5D55A 1DEEA 4Y2DC 3LEYH 4G6FB 5KAQF 1XYLA 3PNZA 5D7KE 4RX0A 1NCCH 1FL3A 1NJJA 4HMEA 2E46A 4XCFL 2VB5A 1Z9MA 2IO5A 3O0RH 4Y4HA 1G1CA 2NSXA 1VFHA 1PVHA 4JAWA 3S47A 1E6JL 1K7FA 1N4XL 3B1UA 3D2TA 3CFBB 4ZO9A 3FNDA 3FA3A 1JD7A 4JQIA 1PLGL 1JK8B 1NF0A 4IP4A 4WEVX 3UYIA 4LVDA 1UBSA 1SZEA 3MOAH 5DYOB 4F24A 3BX7C 2F84A 2PDWA 3MS8A 5K2ZA 1YXYA 1E4KA 2X7LA 4PYSA 1F00I 4CGUB 1PZ1A 3QXAB 4NQEE 1Z32X 4PJXF 4IUGA 3D4CA 1TKKA 3MBEA 3V5KA 4JTSA 3QIWD 4PFHA 1KCVH 2FGBA 3P3RA 3B4UA 4F7PB 1EX0A 3FQXA 3HZVA 1DBKL 5I1IL 4PS4L 5IBLD 2CJSA 4G9DA 3GMOB 4JY6B 4OCRL 3NZHH 4Z7QB 1HXJA 3SGJC 4Q9CA 1P0KA 1HJWA 3FDWA 1FRGL 3KRSA 4FQJL 4O5LL 4PRIA 4TRPH 3PQYB 4HHWA 2ZZ7A 5E8EB 2CIIA 4DIAA 3RE0A 3QJAA 4MIMA 3VGEA 1IGTA 1MCHA 1EB3A 3VGHA 2GBTA 3ZKMD 1VFAB 2B4CH 3IT8D 1P7TB 3BGGA 1WAPA 1TUPA 3WEBA 1C9WA 4P46A 3VRJB 2FTPA 2K45A 3QZWG 1LTDA 1MEXL 4PJXB 3GXPA 1RUKL 1EJ8A 1SSDA 1QRND 4GB9A 3VXUE 2MTPA 1KENL 2H90A 3PWLB 4FYTA 1E0WA 3HE7A 4WU5B 2RAGA 3OGRA 3N0PB 1HC1A 4GMEA 1K3IA 4JRXE 3ENEA 2EDLA 3C5QA 4JQAA 4X5RA 2PDIA 2K6YA 3WQVA 5GSRB 4GQQA 3AUWB 3APNA 3HRZB 1AO7E 3A21A 4HXBL 1SDAB 2WQXA 2WXMA 3EYVB 5I74B 4OLVH 3X11B 1DXEA 1WBJA 3BV4A 3BOFA 4IL0A 2XN9A 2NDGA 5F3FA 3I6EA 1QSFA 2A6IB 2IGLA 3FRPA 2Y8VA 4KBPA 1I7ZB 2NPLX 1N7KA 5A94A 2B0MA 3D05A 5IHZB 4JM2B 3MCKB 4AYMC 3R10A 2IALA 1KPVB 2CNZA 4G9FA 4GZIA 3E0VA 3JVGA 4LSDA 1JE6A 4KXDA 1MEHA 2BZDA 3QJOA 4X6EA 2CLRA 4Z1DA 2W88A 3PY2A 4BI5A 4S3AA 1RZFH 2BGSA 1IEIA 1TFHA 2DGAA 15C8L 2VMFA 1W72H 3VFWB 2YGPA 4ENEC 3AMLA 3O11B 4G6CA 4WJG3 4X6BB 4RFOL 2ZP0T 3LS4L 4OZGF 4FLQA 4X8JA 4GUFA 2DQFB 3AG3B 3AALA 1YJDH 3I4EA 3OHXA 1EGZA 3W7QA 1BKSA 3LH2L 5B3SB 4DJFC 1HW6A 1QFWI 3H2EA 1GGUA 2PXYA 2RIKA 3QG6B 2VI0A 2VVNA 4PLOB 3FCGA 4Y2NA 2GIYA 3EOLA 4AMCA 4OCWL 3I7SA 3V1PA 3PV6B 2OEJA 4AD5A 1HQRA 3HPLB 4UQ2A 5KMYA 3CV2A 1KGCD 1KPUB 1M2OA 5E08L 4XPTH 4OCXH 3UCRA 5T1MB 1IZCA 4X8CA 3ELFA 4JHZA 3KP0A 3N44B 3LKOA 3FFSA 1OL0A 3JUZA 4KXAA 3QXUA 1TSIA 4HH9B 5CR8A 3NQAA 3QGVA 5IMKA 1J5TA 1QPQA 1FCGA 2UV8G 1Y0LA 4ELME 5FACA 3CX2A 1CZ1A 2AC0A 4KRMB 4KJPD 1EQWA 1Q72H 1POJA 2H9AA 1T6MA 5I78A 1DWGM 3R18A 4BRVA 5C6PB 2AJZB 2X4QB 1XIHA 2E6PA 4EN3A 4G6JL 5E08H 1M1BA 1UP2A 2YGOA 2PF8A 4IIFA 5EU4A 3S7GA 3BDKA 5E6YA 5IQ7L 4S2SB 5I16A 4FALA 4TLUA 4GBXD 4GJJA 1IFRA 3NSMA 2VLME 3PDOB 4NNPH 2ZJSL 1DUZB 5AVQB 4FF9A 4YR6B 2ZC8A 2GL5A 1JI1A 2AJVH 3FRUA 2R0ZH 3L81A 5DJZA 5DUPL 2H1XA 2XACC 4KH2A 5AAMA 3UTOA 2GLKA 3EYPA 4UR9A 4EPEC 2PDPA 2BWIA 1JF1B 3O6LH 4MZIA 4XMPL 5LN4A 4NN5B 3CGTA 3TVAA 4G1EB 1TVDA 1D5MA 4JW3A 4NM8L 4NT6B 1FZMB 2J1KA 5JQIB 3B8DA 4HU8A 2R29H 3VG0H 3WNIA 5FB8B 1A0CA 3NL5A 4L6DA 3D2UB 4YDLB 5CG7A 1MFNA 4OZHF 4C6DA 4MSWB 2F8QA 1SJHB 1HX0A 1M6OB 1W0VA 2AQSA 4JHBA 1MW2A 1SOQA 1OSPH 2OBGA 4UDTA 4WO4D 5F2LA 3TIMA 2XXFA 4MB3A 3W88A 4OGAD 4P46C 2QV5A 1HYRC 1OO2A 1Y0LB 1AO7B 2WKJA 1BEXA 3A5VA 4QRUB 2EH7L 3IJ8A 2QVHA 3QORA 4H5SA 5JIQA 1OFDA 2D0GA 2F9RA 3TT3H 3BJTA 2IG2H 1HN1A 3SCOA 5CZXC 4GBXA 2R2EA 5MP6L 4U1JB 4F8NA 3FXIC 5D1QA 3D18B 2FIKA 4GXUM 4KUCD 1J5SA 1N0LB 2QJGA 1GZPB 3BGMB 3F2LA 3GZKA 5ITBH 1DBBL 4FEIA 4HCDA 4XKYA 5I1JH 4M1DH 4ECNA 5I1JL 2DD8H 2X1XR 3C2FA 1WA2X 4JM2D 1ZD6A 1U5VA 4HK6A 2XVLA 3ULVC 4MD5B 2PPEA 4JCWA 2Q10A 2FJGB 3A67L 4FCAA 5AZUA 3G1SA 1N8ZB 3CK0L 2G4FA 2ENJA 4KK5C 4UQ2B 4LK4A 4MDRA 3RCNA 2HBVA 2OR9L 5BW6A 5LBSA 2D7NA 1CXKA 1XF2A 1R47A 2ZE3A 1JZ8A 1KFEA 1EGJA 4OM1H 4U1HA 3UA4A 4DO5A 1W5MA 3B0YA 3ZDXE 5BO1H 1H8NA 1B4LA 4FG6C 2DJMA 4QTHB 3UC0H 3IAQA 4CSSA 2ARJQ 2FB2A 4GBDA 4UIOA 2WYIA 2VRKA 5KSUA 3W9EB 5IW6B 2BZNA 1PY4A 2QCCA 1L2UA 4C6OA 4K37A 2NV1A 5CZKA 2PA6A 3A6OA 3DSNB 3WFDL 1LVEA 4NFDA 1X4ZA 4K6AA 5AZEL 5F88B 5KYYB 2HFTA 3MYZA 3T5WA 3SJNA 3TVMB 4Z76B 1ZE3H 1QR1A 3AS3A 4OM1L 1JCNA 1U8IA 1YYAA 4P05A 2W4XA 4XR8C 5IV2A 4LCSA 3KXFB 4LC6A 5FAGA 5E9DE 4EF9A 1XF3A 3IRSA 3W9ZA 1QNPA 3K4WA 1WKDA 1A0QL 1BQHB 1NAMA 4XOEA 4O0KA 5H8DA 1XL4A 3VFRB 5DXWA 3M44A 4ZI8A 4TVPH 3KPNB 3NJLA 1I1AB 1TQCC 3LCIA 1I3RB 1L9OA 2YMXL 2YUXA 4WDUA 1LP9F 3BKJL 1C29A 1WXZA 1MF2L 1L8NA 5IFJA 2AQVA 1I4FB 1OARH 2EDKA 4IW4C 1KCZA 4NC2B 3QHNA 4JFWA 3WTXA 3H1ZA 3TA4D 2FLIA 3ZDXF 1RK6A 4MY9A 1CZ8L 3RF9A 2ZA3A 2YB4A 3FSWA 1B0WA 3FB6A 4LCWD 2WK2A 3QG7H 5IMOB 3OZKA 3EEGA 5C9RA 3G7TA 4F0SA 4GW1B 4JDTH 4KKCC 5A2CA 2WUCL 1NKGA 3ESNA 2FWOA 3AM8C 1A6AB 5I03A 1KBGL 3EPNA 2CBOA 5D4JA 4JJ5A 2I25N 1W17A 3IJ7A 3SD2A 3V18A 2ISVA 1KGWA 5L88L 3C9NB 4KKLD 4G6FD 4LOUC 3RL1A 3C86A 4D8PB 4Y9EA 1KEMH 1U42A 3BFWA 1W5NA 4ESKA 2VDQL 4RGNE 2DV6A 2KBGA 5C0EA 1E9YB 2E67A 2YL9A 2VZSA 4LARL 1MXSA 4G9DB 4LEQA 1L9MA 1TCRA 1ZPLA 1BD2E 2YCJA 2MANA 1JCTA 3G0XA 1IBGL 3GB7A 3UTTA 3FV9A 3FB5B 4LKXA 3IACA 5D7SL 1FQ9C 5KUKA 3LD8B 3K13A 5D71H 1ERNA 1B4TA 3EBVA 1MFUA 1DIOA 4M7LL 5SWZB 3FYYA 2AF2A 3WN5B 3WUWG 5J1AB 1D6VH 1AIZA 4S1SL 5DELA 3ITOA 4EI5B 1T8QA 1BYBA 3MCG1 4H40A 4AZ8B 2WAHA 2QULA 3QAZB 1JK8A 1NZRA 2W0LA 3KNBB 5AG8A 5CBEA 4I5BB 4MDJA 1D8CA 2UZ9A 1I45A 2Q8BL 1S7RB 2I16A 3BURA 4JTKA 1C08A 4R90L 3LSOB 2CLFA 2D7TL 3TR9A 1NGPL 3VWKC 1TU2B 2H0PA 2XG4A 2DZSA 3A4JA 3OR7A 1KDJA 3GMMA 3V6OE 1BKHA 2GOKA 3VIMA 3WL9B 1JRCA 5MEOA 4FI8A 1CT8B 4KNUA 2DM3A 4P23B 2CALA 4R97B 1AL8A 3TX4A 4F27A 3C2AL 4I2XA 1J9QA 1A22B 1EIBA 3SEPA 4GSRA 3I6TA 1G43A 5DMGC 3TJEL 4FAAB 1KCWA 3EXJA 5I8CA 2NY2C 4APQC 5EEUA 4ZQOA 4YHMH 4A2DA 2JQAA 2WCSA 4F8QA 4PTMA 1VBHA 4MNQA 1W2PA 1CGTA 4WIWA 5GHWL 3TYGL 2IF7A 3PBYA 3LNEA 2CLPA 4ANVA 3CM4A 2X42A 3QXBA 4FKHA 5KSVA 2Q8AH 3KGRA 3GIYA 3LERA 1LO4L 3GS6A 5HAOA 4E9QA 2VLRE 4DJED 5AC6A 4B41A 3KJ6L 1S9XA 2OZ0A 3UTPD 1MFBL 2PPGA 2VISB 1IWBA 3HR5B 3MLSL 3D3VB 4XZUB 1E1CB 3GU1A 5AVVB 1Y5XA 3SO3C 3GYRA 4D94A 3F7JA 4J4PA 2CLZB 3JWOC 5D4QA 2E9GA 2GPTA 4TS6A 2CDGB 2OTUA 2XG9A 5D2YA 2GFBB 1R34A 3BPLC 2PGWA 3E2QA 1AD1A 1G69A 2FEEL 2J88L 2O6DA 2R4SH 4TM9A 5C3TA 2A79A 4TX9A 4PS3A 4AGMA 3EXRA 3KOWA 3V4UH 3VFNB 1IQWL 2BSBA 3IARA 3VXQA 2DQWA 3VIFA 1GYCA 1K02A 3D7PA 1FY6A 4DO7A 3B8YA 1E72M 1A4AA 2DN7A 1MFMA 1MCKA 1YEFH 2BFVH 3OTTA 4PJ7A 3ULAB 3UGEA 4WWKA 3MROA 4DP5X 3LHVA 1FHDA 4Y2WA 1Q9WA 4UT9A 4CD7A 2YD4A 1NIFA 3NXFA 1QZ1A 5TE6H 5F7UA 4DI9A 3U83A 3NGFA 1G6RL 4LCCA 5D7JB 1H6UA 5C0BE 4NM8H 5K9QG 1K3ZA 2D31B 3BSZL 3JT0A 3IUIA 4I18B 4NJIA 4NQDD 2HLAA 1LUCB 4AC4A 2E6AA 1NUFA 4CSZA 2PLMA 3B8TA 1SZRA 4M7TA 3HUJB 4G9PA 2X3BA 3FU9A 1LEIA 4CVZA 5GZOD 1QPRA 3G5ZA 5JIDA 3HGRA 4R33A 3NPVA 3J27A 1OFAA 2CLIA 3HGOA 3BLEA 3NO3A 1UWIA 4QHUA 2P8MA 3AZUA 2ACSA 1IGMH 2O72A 4JTGA 2BNRB 1AKPA 1QEWB 4WSKA 1ISXA 4ZX6A 3W57A 4PJDE 2RJGA 3SOTA 5A6SA 1QW8A 4NRXA 4P5TA 2Z93A 4UM8B 5I6PA 1W1B1 4ZQTA 4HIIA 1DZBA 1WXJA 2E1DA 5I1HL 4OUIA 1E42A 3GUGA 1ZMYA 2H1PL 4GBUA 3NPSB 2H8ZA 3KW3A 1QOKA 2MQCA 2HJLA 3RHWK 2I07B 4RMTA 4LB3A 4HS6A 5E4EB 1N0LA 2CH8A 5E9DD 3O3AA 2IWKA 5E4OA 3ZKSD 3HPFA 4TMCA 2BSLA 4NIKB 4OVXA 4WGKA 4PJBF 3LY0A 2VDNL 3OZ9L 3PZNA 3PUGA 2J66A 4G7EA 3HNTH 4RPQA 1AGBA 1BAGA 2Y6SD 1TZAA 5C0JA 1ZPUA 3IPWA 3J8F7 3O0RL 5KAQG 2Z6IA 2HLAB 1LUCA 3SY8A 5EU7E 1OGSA 1O94A 2HPOA 3GJFH 4PJCE 3A3HA 2YAMA 2D2OA 4A55A 3ARYA 3JYCA 3L9BA 1BZQK 2IDCA 4PI2A 4IQHA 1JPSH 2VCOA 4V1DA 5DK3A 6PAZA 1M5WA 3CQ0A 2ISFA 3NN8A 4FFTA 3ZUCA 4NP7A 2V9RA 2Q6WA 4M3KB 2PWEA 3WIAA 1LK3H 4JFEB 3AB0C 3I3DA 2X2HA 4DGUA 1FFRA 1BF5A 2YKKA 3VOIA 4GX9A 4P5MB 4I0KA 4AL8H 3KXQA 1MCFA 3OLGA 1IGJA 5IG7A 2OWWA 4JTIA 1AHKA 32C2A 4RGNB 2MQ0A 4YE4H 4GRLD 4Z2HA 2DL2A 1H62A 2GBVA 3LQAH 3TTYA 1JCMP 4RE0A 4RZKA 5B1CA 5CJOH 2JCCF 5IFHH 3LRGA 3SE9L 4WGXA 3ECBA 1I8IA 4AQEA 3KOZA 1HYSD 3CDGB 4MMZB 1ZBCA 4HA4A 4J4PC 4AHQA 5DMGD 1UATA 1XRTA 3P4MA 2YKLL 2WXJA 2VDQB 4NLAA 3BDYH 3RTQD 1A5BA 1EKOA 1SFTA 5DD1H 3INPA 5JUVA 3S37X 1IU1A 2OP4L 3MVIA 5A2AA 3PZTA 4BFGA 4FTVE 5TQ2H 3EO1A 3VW3L 5IFJB 3WLJA 4OUUA 4AE1A 3QARA 4ONOA 3SR7A 4DJEC 5DCEA 1HQ4B 3PV7A 4JO5A 4XE5B 5K9QI 3NN8B 5E5CA 3AIQA 1CU4L 1Z5LA 3F7YB 3GI8H 1P7QA 5A8GA 3VI3A 4JYFA 4UTIA 3ORJA 2CHDA 1JXKA 5CHNA 1J86A 2IANE 1YNKH 1YTDA 3OZMA 4K2SA 4E3VA 1XU6A 3GHBL 5FGBA 1UVQA 4LYQA 4JMNA 3PG8A 4KKAD 1SFDA 4R7LA 2QJHA 1ETZA 1ITQA 4DYKA 2EC9T 3IJHA 3KXFE 5JIHA 2GVJA 5C0ND 2ADFH 4LVOB 2P76A 3KVMA 3MHUA 2YWZA 2F6UA 3O3AB 4XBJA 5GGRA 3OPZH 2QR6A 2ZZ6A 1UACL 1DJQA 3DSNA 5IHSA 5HNUA 1BGXL 3CQPA 2IBGA 2YO3A 2WZ0A 3IVKB 5G1TA 4HJJL 1I9JL 1NDMB 4HEPA 3GSXB 3WGVB 4MMXC 2HRPL 1EHLH 1ZLVK 2A2QT 4EIVA 1A1MA 1IGYA 2NY6C 2VDPB 3Q4DA 5HPOA 2WZ5A 2V0AA 3S5YA 2A2IA 3C2VA 4KZDH 2OFQA 4JHAH 4JFDE 4HSOA 1MDTA 5A69A 3SIZA 3O4LE 4M1DL 4MD5A 2P28B 3GC5A 3H2MA 2XWXA 1VLWA 2HISA 2JGYA 4FR1A 5AYYA 1IGCH 4NAQA 3ARFA 1XR8B 1SDYA 2AVGA 1FCBA 3GHSA 1A14L 4F9LA 4P9HH 1KFAH 1M01A 3IJIA 2QT6A 1GKOA 1ZHBA 2EDWA 1V3MA 2WJZA 2EVFA 5LCVL 2GQ9A 4LFYA 4UYQA 1WBXA 3O9WD 4LF3B 2OMVB 4U7KA 2FYVA 5F97E 4Y8FA 3DYMA 4P2RB 4JFPB 3RVVC 3CUHA 1Q9WB 2R56H 3K80A 4F2EA 4QSHA 4LPWA 4KKAC 1PG7W 4XCEA 5HYSG 4Z1PA 1AZ2A 2WAGA 2GITA 2J4WH 2VDPH 3STLA 3PNUA 2QHLA 1GTHA 1JWMA 1NKOA 5DJDB 3ISRA 4XNDA 1TEGA 4WKFA 4CQAA 3EWXA 3UCCA 4P2AA 3MLUL 2XIOA 1U8PB 4BCZA 4GJIA 1BECA 1JRHL 3WJSA 4Z3JA 1DCEA 4MA7H 5GS1B 2TRSA