3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
1S46A 2DT2A 1WZKA 3ALFA 1HVQA 5BYWA 3SCUA 1GNXA 1WE5A 1ODUA 4GZIA 4D71A 2XG9A 3AICA 4AWEA 4QFUA 3QGVA 2ZUVA 4LGXA 4P8UA 1E6NA 5HXMA 3ZIZA 4QAWA 1ISYA 5EBAA 4CCCA 3QOMA 2ZX8A 1BYDA 5IHRA 5AC5A 2CKRA 3WUGA 1CGUA 5AYIA 3VDHA 1A3HA 1UH4A 3W0KA 2BY2A 4OZOA 3N17A 1CEOA 3WH6A 4MB3A 4GO9A 4OGZA 1GW1A 3CIVA 5I5RA 2EPMX 1HNYA 1EOMA 1IV8A 1BVZA 3CZJA 3VD5A 1QOXA 4RL3A 3EJQA 3EJUA 2UY3A 2YL8A 4PUEA 4EKJA 3NSXA 2AOSA 3SCOA 2V3FA 3EDJA 3D5HA 2XVNA 4BQ2A 2UY5A 4GQQA 2DSWA 2CIPA 1MW3A 1XH2A 2D0HA 1GQJA 1W1TA 4NF7A 3MI6A 3WMSA 1XCXA 4MDPA 2BVTA 1H1NA 2ESCA 4UQDA 2ALWA 2DH3A 4MAZA 1W2VA 4P7NA 2ZX5A 4WJXA 1RD6A 2XVGA 3CHCA 3RPMA 2XTKA 5A95A 4D6CA 5A8QA 1KXVA 3QHOA 4ZEPA 4WKFA 3BXWA 3GYCA 1TVPA 3VGBA 3FAWA 3CV5A 3VILA 1PCPA 4NRSA 2PWDA 4CU7A 5KZ6A 3KLLA 4L4OA 1EDGA 1HJWA 5C71A 1JFHA 1JD7A 2EADA 3BUPA 3VVGA 4UZSA 1O7AA 4JFUA 1JNDA 3KWXA 3L4VA 2VRQA 4PMVA 4DM2A 3WD3A 1UKSA 2VZOA 2VMFA 4EAMA 3L2MA 4PMXA 2J7DA 4U2YA 1J0YA 3DYMA 2XN0A 4U5KA 4JFVA 1DHKA 1DWGM 5EMYA 4MTVA 3VINA 2WC3A 1JDAA 1H49A 2XIBA 3UESA 3RO8A 1JYVA 3IANA 2XM1A 3GDBA 3WUEA 1E43A 1UD3A 3EJPA 3WF2A 1MVYA 5M17A 7CGTA 4URIA 3FHQA 1QI0A 4HOZA 1J0JA 2VR5A 1U30A 2X0YA 4D1JA 3WQ5A 1M01A 3ALGA 3ARZA 3N18A 1B9ZA 1CXEA 4JZ5A 2YFNA 5I0DA 4TVCA 1D7FA 2CYGA 4J7RA 3WL1A 3NDYA 1E0WA 3CHFA 1R86A 1Q6EA 5LA0A 2OYMA 2XSAA 1TQTA 4JKMA 2EAEA 3KEHA 3SCVA 3S6TA 2EO7A 2PF0A 4JL1A 3ECQA 3VSUA 2ZUNA 1FH9A 3K4DA 2XFRA 2OSWA 3T2PA 4JFSA 2AMGA 3GXTA 3UR7A 1AVAA 2J62A 1ISXA 1XH1A 3BVVA 3W37A 1C8XA 4NX0A 5D8WA 1Z32X 3AOFA 3POHA 3H54A 4BS0A 3N1AA 4W89A 1J0ZA 3BC9A 1G5AA 3IK2A 1M04A 4H8VA 1EQPA 4UQ9A 4CD5A 2PWFA 4GI9A 4E2OA 1ITXA 1KTCA 1FFQA 4NXKA 4DWSD 4ML4A 1KGUA 1KXHA 3ARXA 3VIIA 4W84A 1E5NA 2OW6A 1B1YA 4ZXLA 5GPRA 3WDHA 3DHPA 5GNYA 2XVKA 1NP0A 5EB8A 2QMJA 2OSXA 4M8UA 2BHYA 3WNNA 1UKPA 2XM2A 4CD8A 1E6PA 3MUIA 3PBGA 4H8UA 4DUVA 2GUYA 1C7SA 2E40A 3ARSA 2V3DA 1UHVA 5A2BA 2VZUA 3WF0A 2WHKA 3D51A 5BRQA 1J10A 1OGBA 1TUXA 4F8XA 2ZX7A 3LPPA 2G8ZA 3ZT5A 1JAEA 1U2YA 3LXAA 2VRJA 2CITA 1GCYA 2Y24A 1LL6A 4KH2A 4W7WA 1B3XA 4OUEA 1DWIM 3TTSA 2X8RA 2G41A 2QPSA 1UASA 1MQPA 3D3AA 2Y4SA 2CBUA 1LL4A 3GH4A 1MFVA 3GBEA 3PHAA 3LPFA 1BLIA 2PWGA 1E3ZA 4P7RA 2B31A 1NWSA 2DIJA 8CGTA 1R47A 1WZLA 1BG4A 5CPQA 1EHNA 4H7VA 1E9LA 2ZOXA 1CENA 1E4NA 2YFOA 2FGZA 4E4PA 1KGXA 4PSRA 2ZX9A 2GJXA 3N12A 4CN1A 2DT0A 4GKLA 1E4IA 5D8ZA 2D3LA 5AYBA 4KWUA 4MB5A 3T0AA 3CUJA 1UR8A 2VNCA 5GQBA 1N82A 3KZSA 1E6SM 3D50A 2FHBA 2BVDA 3ZR5A 2VX6A 3N13A 2VZVA 1H4PA 4FNPA 1CBGA 2DEPA 3ZSTA 2X09A 4IPLA 1JZ5A 3OIHA 3BLPX 4WKAA 2F1BA 3WNPA 1JXKA 3PZUA 4NI3A 1B3VA 3CBWA 1GVIA 3VIPA 3AI0A 1HT6A 2ZXBA 3EJTA 7A3HA 3VPLA 1B30A 1L8NA 3BMWA 3I3EA 4OBRA 5HDRA 2NT1A 2EPNA 1AQMA 2WZIA 2J7GA 1JZ4A 1NQ6A 3VIOA 5BXTA 2NT0A 3K8LA 5CLWA 2V3EA 5DT5A 4U5IA 2Y8VA 4ATDA 3JUGA 4J3WA 3HZ3A 5ABFB 4Z2HA 1MQRA 4J3SA 1NM9A 2BVYA 3EJRA 4AZCB 1VAHA 5FIPA 1XV8A 1XCWA 2WBGA 5ABEA 5BXRA 5D9NA 2V38A 1OCQA 5E09A 1CGXA 3S2CA 1FP9A 3GNOA 1UD8A 3EDKA 3MMWA 3EBVA 1UR0A 2Y2WA 3AHTA 3A6OA 4ZFMA 3ARQA 1VFFA 3NSNA 3UEQA 2A3AA 4FLQA 2VQUA 1UWRA 3A4AA 1PEZA 4D6DA 1BSIA 1J11A 1TE1A 2BY1A 2F1AA 4XZBA 2J78A 4D6EA 1JYWA 3BAKA 2WMFA 2YL6A 1M03A 3VGDA 1HKMA 1B2YA 1H41A 3W82A 1E55A 4U33A 1US2A 3H53A 3B9DA 3VO0A 2GVYA 3SUWA 3K46A 1VIWA 1WB0A 1UKQA 1H2JA 4MADA 2WZEA 1DWFM 2WNWA 3WENA 1TCMA 4UFLA 1W9DM 3AMDA 3OA5A 1D3CA 4FLOA 1NH6A 2G3IA 3NCOA 1JIBA 3G6MA 3WQWA 1GUVA 4PMNA 5CG0A 5BROA 3S5YA 1Q4NX 2BY3A 2VX7A 3UG4A 2YDRA 4PMUA 2X05A 1QWUA 4NZJA 5A6JA 1W1PA 2WWCA 1WAWA 1TMQA 5E0FA 1GORA 2JIEA 2J7CA 1HP5A 1VEMA 1MXGA 2Y8KA 1KTBA 2OYLA 1W9UA 3VD7A 1W91A 1QNQA 3VSTA 2VURA 4CVWA 1UQYA 5A6SA 3CGTA 1PJ9A 3MV11 3BCDA 3L4UA 4PEEA 4ACZB 3ZT6A 1JF6A 3TOPA 1KGWA 1B3ZA 1NARA 3BUQA 3U7VA 1M7XA 5CQ1A 4J3XA 1Q6GA 1JXJA 1OGSA 1GJUA 1V6YA 1MWOA 3PZTA 4GO8A 1ZBKA 3MUAA 3POCA 1HJQA 4XV0A 3TA9A 4HZ8A 3VD9A 4B9ZA 3LPGA 3WEOA 1GOMA 3WBEA 4C7FA 5HOSA 2CCRA 4DO4A 3MMUA 3DX2A 5EFDA 1OWQA 4E8CA 2XJ7A 2XPKA 1PS2A 2YA1A 3IJ9A 1VFUA 2D3NA 1B0IA 4CU6A 5E0CA 2O9PA 2BFGA 3CTTA 1CXKA 3UG5A 1JZ7A 2OWCA 6TAAA 1J12A 4NXSA 3I3BA 4UFIA 1WDQA 1IZJA 4PBGA 2ZUWA 2F7PA 1E5JA 3BH4A 3BVUA 3UERA 1XSJA 2YBUA 1CGVA 2C7FA 2VVNA 2V5CA 1WP6A 1XGZA 2X1IA 5E1QA 5I3DA 3CUFA 1E15A 1E4MM 2J74A 2VX5A 3NDZA 1JYNA 1VJSA 4X0NA 4UFJA 3FN9A 3N04A 2FHFA 1EO7A 1KBBA 1LG2A 2RGLA 5AY7A 4BCEA 2CETA 3T2QA 3U5UA 5F7UA 3WBAA 1E0XA 1UH2A 2JALA 1IZKA 2XN2A 2W92A 2WLZA 1CYGA 5C70A 4AD0A 1SFSA 3AMKA 1E73M 2XN1A 2YA0A 3KL3A 5LA2A 1UWTA 2VCCA 4TTUA 3GH7A 4U3CA 1H5VA 5M3WA 2BV9A 3CZ8A 1PIFA 4AZ6A 1VFMA 1XSIA 2PBOA 2VC9A 4UNIA 2WCGA 4P8VA 3DYPA 5A6MA 4QLLA 1O7DC 2D2OA 1OT2A 1W1YA 4CGTA 3TTQA 1EOKA 4PRWA 3VIHA 1XRVA 3ZQ9A 2O9OA 1V3HA 1LLOA 1E9TA 3NJ3A 1JZ6A 4XB3A 3NYDA 4R27A 2WLYA 5CGMA 3ARVA 1NP2A 3HJEA 2F7RA 1G0CA 1GOIA 3ZJKA 4JKKA 1JI1A 1H0GA 4AZHA 1R33A 3LRLA 2GSJA 4FLRA 2VL4A 2EPOA 2PWEA 4PTVA 3HG5A 5CGTA 2Q8XA 3CH9A 4DM1A 4DUWA 2WW5A 2VR4A 3AHZA 5DMYA 5D9MA 3DHUA 4ZE4A 3AYRA 2PB1A 4H04A 4J3UA 4F9JA 3BAYA 1JZ2A 1ZL1A 1LF1A 3O2LA 2O92A 5I6SA 7TAAA 4HA3A 4WF7A 2ZUUA 3T0BA 2XSBA 5CJ5A 4UR9A 4M82A 3MUY1 2D22A 1HJXA 2XIIA 3NUKA 4D6IA 2WMJA 1C91A 4TVDA 1G01A 4QLKA 1I75A 2OWXA 1HTYA 1LG1A 3N9KA 2ZUTA 2WYSA 1QPKA 2JIWA 4CCDA 1HKJA 1CXLA 1UA3A 2QHAA 2WB5A 1QBBA 1UKOA 4BQ5A 1E4LA 1XD0A 4TX8A 3PZVA 4KMQA 3WD0A 4PMOA 2VZSA 4CKQA 4HA1A 1AQ0A 1E56A 1TQSA 2X2HA 1UG6A 1B31A 1UKTA 3AQUA 4Z2LA 4PYSA 3VKKA 2C8NA 5I77A 3OG2A 2WVTA 5JBDA 2UWFA 3MV01 1VEPA 1V0LA 1TA3A 1PX3A 4MDOA 2UY4A 2WANA 4TOQA 4M56A 4DWSB 1HKIA 2WHMA 3L4ZA 4H41A 5JIPA 1SMAA 2YJQA 4FNSA 3KL5A 4PN2A 4PSPA 4DO6A 1OGGA 4WKHA 5M03A 4PMYA 2DSKA 4PCTA 2WSPA 4XX6A 3AS1A 3DYOA 1NWUA 3WY4A 1MW2A 1R46A 1EA9C 3K8MA 5IHSA 1CNVA 2W63A 3VU2A 4KGLA 3AFBA 4DWSC 3TP4A 3L4WA 2OW7A 2VTFA 3VD4A 4QCFA 3AXIA 2PWHA 3B8SA 3RM9A 1JNEA 1BVNP 3CZEA 4IUGA 4RE4A 4L4PA 3CZGA 1GOOA 3WFLA 2BHUA 3WSUA 2EEXA 2W5FA 3ZR6A 2ZE0A 5HPOA 5FL1A 1Q6CA 1E1FA 1XHGA 5A2AA 3SEPA 3ARYA 1EHAA 2XFYA 3M7SA 1KQYA 3WQ6A 4HU8A 2E9MA 4JHOA 3VNYA 1GQIA 4UQBA 1CZ1A 5BWFA 5BCAA 2CNCA 4GXPA 1E72M 4W88A 2X2IA 5FOOA 1E6RA 1GHRA 3AHVA 4JCMA 1JI2A 3AZRA 4GZEA 1W9XA 1TZ7A 3FAXA 3AROA 2WMIA 1BYCA 4UTFA 3ARWA 4JCLA 1CLXA 4HMCA 4AMCA 3ZJ6A 2EBNA 1EDTA 3WQ8A 2VOTA 4HU0A 4AZIA 2ZWYA 1GONA 3SUUA 3VIKA 1J9YA 1E3XA 4PCSA 1V6WA 1PS3A 4AD2A 3W38A 3BGAA 3WF4A 3GXDA 2WWDA 3VUPA 5A2CA 2WSKA 1V6VA 4MB4A 4B15A 3BAXA 3WDQA 4M29A 2EACA 4LYPA 3GBDA 1VRXA 4F79A 1ISWA 1XD1A 1W2PA 3AIVA 1HWWA 3O9NA 1WO2A 1CECA 4D6FA 2CBJA 5CXPA 2G3JA 4UCFA 3VGGA 2FE0A 2GK1B 3WNMA 3DECA 4YN5A 2BHZA 3SCNA 3AMCA 3NIYA 4Q22A 4UQAA 3RILA 4W86A 5BXPA 4W5ZA 3RMEA 1ECEA 3KL0A 1JZ3A 2W4XA 1B90A 2WKLA 4FNUA 3AXXA 1UD5A 1GPFA 1AMYA 3WUFA 2J75A 3CMGA 2JF6A 3BVXA 1VBUA 2WVVB 1EIBA 1ZJBA 3OLIA 2W91A 2FDMA 3A23A 4PMQA 3OBAA 1PPIA 3WUBA 4CN6A 1PX8A 3MU7A 2WCAA 1TQWA 2WK2A 1FH7A 3W81A 1TG7A 2D0GA 1QBAA 3D52A 1SR0A 3T08A 3KLKA 4M1RA 3O6AA 2GDUA 1ZS2A 3VSVA 3WMCA 3VMNA 1Q6DA 5E6ZA 5CZKA 4WIWA 5A6BA 1HJVA 3CPUA 1LWHA 2YOCA 2D24A 1OBAA 3ZSSA 3VX1A 3B9AA 3L4TA 5A8OA 2ZXDA 4M80A 4WSKA 1QNPA 3A21A 3FXYA 4CN4A 3SCRA 1OD0A 1VENA 4KRTA 3VNZA 3VIMA 4V28A 8A3HA 3WDRA 4D6HA 3ZO9A 3A4XA 2YDQA 2NW0A 3SCSA 1BYBA 1H09A 1V08A 1UWSA 5CPSA 4CVUA 4AZ7A 2WCSA 5ABGA 3NSMA 4GZJA 3ARTA 1I1WA 2YIHA 3GZAA 5IFPA 1HXKA 3OZPA 1H11A 4JAWA 1R85A 4ZENA 4HA4A 3BSGA 4H2CA 4QCEA 5DFAA 4HMEA 3GM8A 5KEZA 4UOZA 4HP5A 4EANA 2YLAA 1LQ0A 3PN8A 1UD4A 4W8LA 1ZBWA 2QPUA 1UZ4A 4EE9A 3KE0A 3CUGA 3EMQA 3GH5A 5LYRA 3LRKA 3BMVA 1F4AA 2VCBA 3TONA 5A6KA 3AIWA 1EH9A 4PTXA 4AIUA 3W26A 1V3KA 5GNZA 4H8HA 2GDVA 1PSPA 2IGTA 4PMDA 1J18A 1DEDA 1WDPA 2CESA 4GPNA 3LRMA 2DIEA 3WEZA 2EQDA 1CWYA 1FHLA 1GQKA 2E3ZA 2FGLA 3RJXA 1U33A 2CHNA 1G9HA 4QDMA 4D6JA 4Z2JA 3WNKA 2VVSA 1EO5A 4MAVA 3GTNA 1KR1A 1QI2A 3CZSA 4CD7A 1VBRA 4AYGA 3IJ7A 1C90A 1CTNA 3WKZA 4NZFA 4JHZA 1KWKA 4YHEA 5A3HA 3VM7A 3FNDA 2WC7A 3CHDA 3THCA 1QX1A 2A3BA 1UYQA 1HKKA 4CU8A 1G94A 2F18A 5FD0A 1HXJA 1UD6A 3WH8A 1R7OA 3PZMA 1MQQA 1JGIA 1QHOA 4AD1A 3THDA 4W5UA 2J7BA 4P7QA 4N0RA 4FNQA 3WD4A 3ZT7A 1LL7A 3ZJ8A 1TA3B 2E0PA 4P8XA 1QW8A 3RCNA 1P6WA 1CXHA 1UR9A 2GFTA 1KQZA 2XFFA 3VDAA 3VIFA 3BCFA 1QW9A 2J79A 1PE31 1HVXA 1OINA 1SZNA 1X6NA 1ISZA 4MNLA 1VF8A 4N42A 1WDSA 1BGAA 2WZHA 2Z1KA 1QI4A 2WAGA 3D4YA 3WELA 1PBGA 3CO4A 2YDSA 3AIUA 4D1IA 4QP0A 4HPHA 2CERA 3BUIA 4YHGA 1H0IA 1XC6A 1SMDA 3SCQA 2YL9A 4J3VA 1V3MA 4W7UA 3SUTA 1WDRA 3I3DA 3AMGA 2WHJA 4NSBA 1ESWA 3ZM8A 2VQTA 4P7LA 1F4HA 2E9BA 2V3GA 2OSYA 2JEPA 4Y7EA 3AIBA 4AIEA 4AEFA 1WKYA 1CDGA 3FY1A 1FOBA 1ITCA 2G3NA 1W9PA 1T0OA 3PTMA 3VDBA 1FA2A 4TXEA 1B3YA 1R7AA 3W28A 4IISA 1QI3A 3LXBA 4HZ6A 4AD5A 4MPKA 4OIFA 4OOZA 5D9PA 3WL0A 5JUVA 1JG9A 1QNOA 1TQVA 2ZUMA 4F66A 5BXSA 2IUZA 1PX4A 2YLLA 4BZYA 3OB8A 4J28A 1R87A 2QLYA 4Q7NA 3AZTA 4LPCA 5I78A 4AXNA 3AS0A 2AAAA 3CZNA 2TAAA 2QF8A 2UY2A 4MNKA 3VOCA 3ZOAA 4UQEA 2O9TA 3PZQA 4RE3A 5DT7A 2J25A 1UOKA 2HISA 5A8PA 3DX3A 4BQ4A 4K68A 1E40A 2F7OA 1DWJM 3WIJA 3F5JA 3UETA 3IAQA 1HX0A 1FFRA 2CPUA 1UWQA 1JL8A 4UOQA 2F8QA 5A6AA 2XWDA 2ZWZA 3CHEA 4CCEA 1V0NA 1BPLB 1BTCA 4M81A 3VTRA 3RM8A 1UD2A 3MS8A 1W3HA 1FHDA 1OB0A 1MW1A 1BYAA 1HF6A 3WY1A 3OLEA 2J7EA 1UQZA 3K4AA 5ABFA 4FK9A 5A8MA 4MJ4A 3II1A 5DEZA 3W25A 4AZCA 2G3MA 4W8AA 3GXMA 3WN6A 3BVWA 3QHMA 1C7TA 3GXFA 1JF5A 1PAMA 1UWUA 1BAGA 2O9RA 1CGTA 3VGEA 1R34A 4W8BA 4AMXA 1YHTA 1ZJAA 2X2YA 3T2OA 2ZX6A 1C8QA 3SUVA 1JYXA 1KB3A 4TUFA 4WLCA 1HI7A 2VX4A 3F4VA 1Y7VA 2GJXB 2W62A 1RP9A 1UR2A 3B9EA 2CBIA 4XUYA 2YKKA 3BAJA 2BS9A 1KCKA 2VZTA 3OGVA 2OLHA 2A3HA 1BG9A 1DTUA 3VDCA 2XHYA 5HPCA 3U57A 1QWNA 2W66A 1OD8A 1HP4A 1TQUA 3W29A 4ACYA 4J27A 5E9AA 1RH9A 3HN3A 3OLGA 4ZE5A 1C8YA 1E0VA 4FF5A 1BFNA 4UFMA 4A4AA 3PZ9A 1B3WA 4S3KA 1ZU8A 4AISA 4FMVA 6A3HA 1YQ2A 3VMPA 5LA1A 3ZMRA 3EMCA 1OSEA 3S5ZA 3CLWA 1UWIA 5FL0A 4PTMA 1NWRA 2J8FA 1SYTA 2YBTA 3BSHA 4MNMA 4LYRA 2C0HA 3VIGA 2IXUA 3MSGA 4AZGA 2EXOA 3CZKA 4AY1A 3WH5A 4GINA 1ODZA 4KGJA 1VEOA 3UCQA 3N15A 4R5EA 1GVYA 3WMBA 3DDFA 3HG4A 4DUXA 3AHYA 4CUCA 4A3HA 3A24A 1MW0A 1E6ZA 3ARPA 5ABHA 2D1ZA 5IXEA 4F9DA 1KCLA 4ACZA 2WMHA 1UR4A 3PZIA 4V2XA 3UR8A 4LQ1A 4W85A 5FKYA 1HL8A 1K6AA 2GJRA 2Z1SA 2PI6A 2ZXQA 1QHZA 3DX0A 2Y5EA 2DQXA 1GQLA 2PSPA 4B16A 3GXPA 2GJPA 3CUHA 3QHNA 2ZIDA 4UOJA 4BA0A 1CXFA 4UZUA 1V3IA 2D73A 3AHXA 2WVUA 5A6BD 2YL5A 3AYSA 4U3AA 3APGA 3A4WA 1A47A 4UQCA 4ATWA 2WVSA 4EK7A 1JAKA 4AYSA 2E4TA 2FHCA 2QMKA 4JFTA 1D2KA 3L4YA 5BRPA 2J4GA 2WMGA 2WM0A 4V27A 3W6LA 4B3KA 2XYLA 1WCGA 2DSUA 1XH0A 3PTQA 4JIEA 1E6XM 3AJ7A 3K1DA 3WY3A 2WMKA 2FH8A 3T09A 1O6IA 3EDDA 4HOXA 4C7GA 1V3JA 3AIRA 4XZWA 1G1YA 3EDFA 3WH7A 3H55A 1X6LA 3BUBA 5D9OA 2DH2A 4LYQA 1DWHM 3K8KA 6CGTA 3DDGA 4TX6A 1J0KA 4BF7A 3EJSA 4W7VA 1NWTA 3EYPA 1UR1A 2D20A 2X2JA 1K9TA 1PZ2A 2A3EA 3G6LA 1WZAA 4HZ7A 3WDIA 3A22A 3M6DA 3MMDA 5A94A 1V3LA 3ARUA 4TTGA 1UH3A 2F7QA 5A6LA 2IXVA 2W67A 1KR0A 1RP8A 1K9EA 3EDEA 3W27A 2BXYA 3SUSA 3VIJA 1QNRA 3WDPP 2G4FA 5IFTA 1PZ3A 3CMJA 4MJ2A 2ZICA 2D23A 3QOKA 4PMRA 2XUCA 4JKLA 2JFEX 3OGSA 1LWJA 2X0HA 4AW7A 2JEQA 1QI5A 1W1VA 1OIMA 5EFFA 1W9BM 4Z2KA 2XWEA 1VB9A 4RE2A 3RDKA 1JDDA 1JD9A 4X9YA 1QNSA 4GIAA 1XYZA 1VFOA 4U2ZA 3D4ZA 4OKDA 1E1EA 1EXPA 4A3YA 1J01A 3RJYA 1EDQA 1JFXA 3GXIA 1OM0A 1HL9A 3ARRA 2DT3A 3DX4A 1M53A 5CLTA 2DSZA 1US3A 4GI8A 1XSKA 1C3FA 3IAPA 2W61A 4E8DA 3PZOA 4B3LA 1KWGA 3GNPA 3L4XA 3WNOA 1E71M 4X0VA 3CC1A 3WNLA 1TR1A 4HPGA 3VGHA 2WHLA 3TTOA 3SCPA 3MKKA 1UA7A 1MXDA 1AQHA 3PZGA 3WF1A 5ECUA 1TVNA 3CUIA 5TD4A 1ISVA 4QLJA 1GZJA 1J0IA 3J7HA 2BXZA 5A1AA 4D6GA 4AMWA 5HNNA 1OT1A 4WSJA 3BVTA 1NOWA 4AC1X 3WY2A 3DC0A 2FYVA 5GNXA 1MYRA 1JZ8A 4U31A 1WZMA 2VRKA 1QVBA 1K9DA 1HIZA 4MB1A 3WEMA 2CBVA 3UG3A 1IT0A 3HG3A 5I24A 3OGRA 3OZOA 2CKSA 2DPEA 2DGAA 1KFWA 4OJYA 2ZXAA 3W53A 3OLDA 4DWSA 4AZ5A 1GOQA 4J3TA 4GI6A 3HG2A 3RM4A 3BAIA 2VO5A 1V0MA 1R75A 5I79A 3WD1A 4D72A 4P7OA 3PZNA 3BAWA 1V6XA 2WC4A 1KXQA 1GOKA 1BF2A 4FNRA 2WXDM 4CD4A 4LXFA 3W4RA 1K9FA 4AIOA 1GJWA 2CXGA 3WQVA 3IJ8A 4ATLA 1E70M 3WD2A 3RIKA 2V5DA 4KRUA 2VCAA 1R8LA 3AISA 4BQ3A 5FCZA 3WFZA 4AEEA 4YPJA 1FH8A 4MNJA 1HJSA 4HMDA 1V6UA 1VJZA 2HVMA 2DT1A 3SURA 1EGZA 4M24A 1DWAM 3LXCA 3SIMA 4AZBA 5AC4A 3N11A 3L2LA 4Z2IA 3AZSA 1WPCA 1E6QM 4GQRA 3HU7A 1W3JA 2J7FA 1NOFA 3PTKA 4HOWA 4ZXOA 3AMLA 3T0DA 3SCWA 3HMCA 2VT0A 1BGGA 2WKGA 4PMZA 4W87A 1FP8A 4OBSA 1W3KA 9CGTA 5CSUA 3VMOA 2CHOA 3CZLA 1J0HA 1JDCA 1CXIA 2FH6A 5CPTA 4P8WA 3TV8A 4NRRA 1CGWA 1DP0A 4B9YA 3VD3A 3WH9A 3BLKA 4PTWA 2OYKA 1C93A 1OIFA 1V02E 5IDIA 3MSDA 4NZCA 3AS3A 2E8YA 5C8BB 3F5LA 2XVLA 3TTYA 3A5VA 1BHGA 3GNRA 2VI0A 1X1NA 2ZUSA 2XGIA 3EMZA 3ZJ7A 1CIUA 1W9VA 2PBGA 4OOUA 2J77A 2EJ1A 1TFVA 3MANA 3WDJA 1UZ1A 5DO8A 3FW6A 4W93A 2DDXA 3GXNA 4JFWA 4UFHA 1MFUA 4PUDA 5I2UA 4AD4A 1CGYA 3AIEA 1WNOA 1L0PA 1EQCA 2WBKA 2EABA 5M5DA 4C7DA 3AS2A 1RPKA 2MANA 2GK1A 2YA2A 1ZBVA 5D4YA 1I1XA 1XYFA 1NOUA 3VX0A 3IGUA 1V03A 1CPUA 4TVUA 4LX4A 1LJYA 2E8ZA 1Q6FA 3DX1A 2J7HA 1ZBCA 1V0KA 1UUQA 1ZB5A 4AD3A 1CLVA 2NSXA 2F2HA 4IM4A 1KBKA 5HBFA 2E9LA 5JBEA 3VM5A 2BNJA 2J47A 5A69A 2JF7A 1KXTA 4CD6A 5A8NA 2WVVA 5JIWA 2XVPA 2F61A 2WPGA 4S3JA 3A47A 3MUZ1 3F5KA 3WQ4A 2WMIB 3E1F1 3WF3A 3LX9A 3QR3A 2QV4A 3AIQA 1GHSA 3A3HA 1PIGA 3MO4A 5CSYA 3BLBA 2VUYA 2VJXA 2CEQA 4WK9A 5JBFA 3M46A 2JE8A 4UFKA 1HN1A 1V02A 3U5YA 2J8GA 4DO5A 4FNTA 4IPNB 1W32A 3W6MA 1H3GA 4FLSA 3LPOA 1BQCA 1HJUA 2EPLX 3W24A 4HTYA 5I23A 1W3LA 2RGMA 1C92A 3AXHA 2DSVA 2OWWA 2EPKX 3VGFA 5E6YA 3LMYA 4Z2GA 4JL2A 2A3CA 1GOWA 3FHAA 2XGBA 2PC8A 1QHPA 5E70A 3M07A 2BY0A 3U7BA 3BUDA 5DF0A 3SCTA 2D0FA
chains in the Genus database with same CATH superfamily
1HQRB 1LK2A 4WI5A 4QRTB 3L95B 3ETTA 2GK0A 2H6UA 5EULV 1WE5A 2AQSA 4GKSB 3MRQB 3ES6A 1OEPA 3QGVA 1TIMA 4R26L 1NJ9A 4CNSA 4LVOC 2GUOA 4ZODA 1DORA 4NQDB 5AC5A 2X4TA 5T3ZH 4OKVA 1T99A 1UH4A 2PTUA 1CEOA 3PGFH 5B1KA 3CIVA 2YD4A 3K6DA 3QHFL 2OX5A 3NDOA 3KS6A 1G0XA 3P61A 2KAUC 4RMUA 4NKDB 5D7IF 5F1OB 2J72A 1D5ZB 2WOQA 2ITDA 1SXSA 3ARBC 3BZ4A 1IQ8A 3HC0A 2P76A 4E3TA 3MRKB 2DLFH 2ZX5A 4XMLL 4XPHH 4Y8FA 3CHCA 3RPMA 1MF2H 3S97C 4A2SA 4IGNA 4ZOAA 3EJYC 3QQ1A 2DZTA 1LILA 4NQUA 3QHOA 4U1NA 2BNUB 3QW3A 2PW2B 4O19A 2A38A 2VN6A 1CTOA 1THAA 4QRUA 4NQ1A 2BWIA 3E9UA 5D7JA 4JFUA 3RL2B 5IB4B 3OSKA 5ETUA 4DFHA 4JBRA 4FCHA 5AVNA 3DJRA 3DH7A 3N4EA 5EUOB 4PJ7E 4N9BA 5IY5B 3DUUB 1H49A 4WJG3 2Z8VC 3VFSB 1WBJA 4NIYE 1OKEA 5DJCB 3RU8L 3UBFA 4LCQA 1U30A 2GEQA 4NERA 4EACA 3QUYA 4TVCA 2AHIA 2PDIA 3SSJA 2LU7A 2K6YA 5FYJD 1R86A 5LA0A 1TQTA 2YW4A 3KEHA 4QXUL 4QRRE 3OKDA 1HE8A 2RCSH 4YHYC 3CV1A 3K2IA 1WZ1H 2OTUB 4QT5B 3G3LA 3QXVA 1A7NH 3GMNB 4GAGH 5GJTH 1ISXA 1M3JA 1C8XA 3QT2A 4KNSA 3GVRA 4J4KA 1CURA 4CDHA 3PYCA 4KOCA 4UQ9A 2PWFA 3MBEC 4NXKA 2ZSVB 1IGIL 5BXFB 3SFKA 1E9OB 3HE6C 3L3GB 5GPRA 4HHAB 2E7FA 2XVKA 4HGWA 3IU4H 3QYSA 1W3NA 4JTCA 4B6ZA 4H8UA 4YVNA 3QKEA 4DUVA 2E40A 1UHVA 3LCYA 2G50A 2WHKA 3CB8A 1U8CA 1TUXA 4F8XA 3ZT5A 4IOFD 4IBZA 1NLBL 5HHXL 5I1KH 3W1NA 1PQZA 3OWEA 4KH2A 4OUEA 1ERNA 3CX2A 1G9NL 3PJXA 3ABXA 1YNKH 1UASA 1ZLSH 3A9IA 1PYMA 5JXQA 1JNLH 4MKMA 2UUDH 1U8KA 3FQRA 1LEGB 2R0WL 1JCTA 1L2QA 2PC4A 1CENA 4E4PA 2FCBA 4QJ5B 4LIQE 1W1A1 4N0UB 4PLKD 1AW2A 5DMGC 1C16A 1CICD 3O81A 3V52H 4FTDA 1MEHA 2AQWA 4FN0A 4HPOL 1KTKE 2NX5A 4S1QH 1ZHAA 1I1CA 2QFRA 2BHFA 3GBNL 4E68A 3BE1L 2PAJA 7A3HA 3CSTA 1I31A 3HE7D 1JV2B 1HAWA 5F1NB 1Q9LB 3ESNA 4K3EH 3A3WA 1F07A 1QSZA 4EPDC 3PFQA 1VA9A 2BVYA 5AW2B 2UVEA 1U8PA 1DFBH 5JQHC 1QRNA 5J13B 3EWDA 3S36L 3ZJAA 1X4YA 3IJYA 3LN4B 4EAYA 3W11D 4WHBA 5BJTA 1P69B 1PBYA 3LQGA 3H2EA 3A6OA 5FYLD 4MD5B 4YL4A 1QG3A 1VFFA 1XIMA 4TLUA 1SUXA 3FT4B 1LXMA 3ZTNL 3QJRB 1WUZA 3BZEA 1XF5A 1B2YA 1H41A 3W7MA 1D5XB 1C1EL 5EUKB 4E42A 1VIWA 1RUAH 3KAOA 4E9VA 3WENA 1TVHB 4RPQA 4JDTH 3LTPA 4XCNA 3VFPB 2DQIH 3UJRA 4JD4A 3SDAB 4PJCB 1JIBA 1TB3A 3TN0B 4X5LA 3MUCA 3WO4B 3U1QA 1ULVA 1N26A 2PXYA 5EU6D 2BY3A 4IMDA 2WHVA 2BPBA 4Y4FC 1S5MA 4HCFA 4ONGH 4HBQA 2KZHA 4XZUA 2JIEA 2J7CA 1V27A 4OQ1A 4YO0A 4XPFH 2OYLA 1F3JB 1EGVA 2I9UA 1ICQA 1GMIA 1VADA 1UT1A 3P30L 2HG5A 3U7VA 3ITOA 5E4OA 4C6OA 3FBKA 2JI3A 3FQWB 3DG7A 1HJQA 1S8DB 3DX2A 3D09A 2CBOA 4X83A 4OD1H 2OWCA 5C08E 1J12A 2QSVA 1JGUL 3RPDA 1BA9A 4K3JL 4E38A 2F53A 5DA0B 2FJFB 1NC2A 1X4ZA 2VVNA 1A5KC 1NF7A 1TE6A 2C1GA 3V0UA 2GUUA 3GLEA 5C0NC 2A73A 2VX5A 4LMQE 4JN2A 3UZQA 1MJUL 3VKAA 3AMKA 2VABB 5E9XA 1PZ0A 5I0VA 3G24A 4X5RA 2QVIA 4K23L 1ZTXH 3VWKA 5JNYA 4FOUA 2FFCA 3IFLH 1GIGL 1I9IL 3GJEA 1KCVL 4JYDA 5CEWA 3PDDA 1W1YA 2LTQC 3TTQA 1PU0A 2B77A 5LBSL 2AJZB 4DVOA 1GOGA 4UNTA 4WWNA 5FEWA 4R27A 1OGAE 5CGMA 4YGVB 5LIWX 4L4TE 4HJWA 1OF0A 1FZKB 5AVZB 3X3GH 5D2LF 3TYEA 4DQOL 4QRRB 2EEDA 3UADA 3WTUA 4LCCC 3ILEA 3EH2A 4XP6H 5L9DH 2XWCA 2LW3A 3SN0A 5ES4B 5AEAA 3B4UA 1H3UA 2WMJA 1NFIB 5C2CA 1QQDA 4OZGB 1OAUH 1ZGLA 3CFEB 2TRSA 3DIVA 1ZALA 3BQUD 2YQBA 4GP5B 2GAZA 1U1JA 4G7RB 3MACL 1MWAH 4PRRA 2W0FA 3ARDA 1E56A 3KBHE 1O95A 1GYVA 5EGRA 4ZMPA 3EO1B 1FWFC 3ZWSA 3CV7A 5DDHB 4M56A 5DZPA 4HB7A 3UJ2A 4PY7B 4GBXB 2VAAA 3AUOA 4FR1A 2XIOA 3VABA 1MFCL 2AXWA 3EX2A 1OB1A 2XI9A 4OCLC 4HAFA 3HRZB 4KGLA 2EDBA 5HI5D 3ICJA 1KENH 1SDDB 2YAQA 3GR7A 3AXIA 3VFMB 4GOAA 1JNEA 1YNQA 3TQPA 4R2GB 4C6NA 4KAQL 2ISDA 1HKFA 4EIUA 4DJDC 2QDWA 4LHUB 3D48R 2IPGA 4AQZA 3M7SA 2C3VB 3GIZH 4KI5D 5F1VA 3PR2A 4P9HH 4XP9L 3ZE2E 3EFDH 3PU7A 2WMIA 4AB4A 3NQKA 2HFFB 2PDWA 1XB6A 5GISL 2EBNA 1T5KA 3MR9A 3WQ8A 4NC0B 5D4JA 3L0NA 3HPZA 3IMRA 5AHFA 3FH8A 3TJHC 4GC4A 2QUVA 1Z0NA 4PJ9C 1HH6A 3ME0A 4ZMGA 1U1HA 1EX0A 3F2BA 5CAKA 5KUKA 1MMFA 1XLBA 2GTZA 2C9PA 2AI0L 2H1LM 2V2DA 3DCPA 1S7RB 2GJ6A 1URIA 1KCWA 2VXTL 2HX9A 3BVXA 3TPUB 1ZJBA 3ITYA 4UUJA 4CQBA 3A23A 1S1PA 1MCWW 3WFBH 4I18C 4LE8A 2D9CA 2VQ4A 4XTRC 2WINA 1JHTA 5GGVL 2VSKB 3OM3B 3IFOA 5ANMA 5C55A 4QHNA 4N22A 4X4ZA 1HHGA 4OQTL 3AC0A 1GKOA 3SDDC 3FXYA 4L4LA 2A9DA 4NZTH 4MNGB 5L4IA 4LASL 1U8QB 1Q7QA 3A4XA 3B2MA 3ONCA 2X4QB 1IBFA 1XU6A 1KW1A 5IFPA 2AL2B 3VXRD 4TOYH 1LQ0A 4NIKB 5HYIA 4RRPG 5AVSB 3FYYA 5C08B 3VH8A 4KI5F 2V5JA 4TUOA 2FLBT 5JIHA 2ZAIA 5EKYA 3O9WD 1MN4A 4G8GA 4JG1L 5DD3L 3OP2A 1RZGA 2Z1WA 4JN1L 4Z2JA 4IIDA 4PMEA 1MFAL 4YK4B 1NEYA 3LGGA 2FZ9A 3TBCA 1KFCA 2R27A 5BV7H 3SGEI 1QX1A 4HNVA 3MZ2A 2ZAGA 3NDZE 2Z27A 1IAIH 5XINA 5CZTA 5ELIA 1I7RB 1TZIA 1HXJA 3N0PB 4QTIL 1KXVC 3OKLB 3FS9A 4DGUA 4AYMC 3AG2B 4WAFA 3GJFK 3B0PA 1UR9A 4DI9A 6ENLA 2QQ6A 3TFXA 4LSUH 4ZMWA 2YPLA 2OMNA 4N0YL 1XBVA 3FS2A 1MNSA 4Y1AE 5C7ZA 4N42A 3DX9A 4OFYA 1PLCA 5JIKA 1XF3A 2XN9E 1XYBA 4Y1TA 3BDKA 4XZIA 3UTTD 4JO2H 3BUIA 3SCQA 1SMDA 4YOKA 1WDWA 2EDYA 5IJKC 3UBXI 3NJMA 2VQTA 2PCPA 2DZXA 1RZ7H 1NKRA 4H00A 4ADIA 3ZRSA 4OZ4B 3WXWH 3QDJB 1USZA 1ZJIA 3BVDB 7FABL 3H70A 1QI3A 4ODBD 1EEZA 3WL0A 1YE4A 4FG6C 4I2XA 2YLLA 3OB8A 3TA3B 4AXNA 2AAAA 1WXYA 1A1MB 4GIYA 3BYYA 5DT7A 5IFHL 4D7BA 3ATBA 1MPAL 1VFSA 1E27A 1SDYA 4LEBA 4MYWB 5AYUH 1TCRA 3TLLA 2F8QA 3WQFA 1P7QD 2WJEA 3CIQA 4M81A 2FD6L 2I69A 1U42A 2W94A 4AJYV 4N90E 5I19L 5FJOA 5K2ZA 3BGFB 3SDCA 4MJ4A 3CMOL 3EXLA 4O15A 3L5WB 1EZVY 4HF5L 3HRPA 1HTIA 5KMYA 2RUSA 2DI8A 1F0LA 3IMTA 1I2RA 5I1HH 1XGYH 3OHXB 3W76A 3MKCA 1KB3A 4HIBA 2YAHA 5KG9B 3FT3A 3S98A 4FZ8H 4DP2X 2J13A 1DVUA 1SOQA 3KTSA 4NQED 5C0RL 5A3ID 3BAJA 3HPJA 5F8RC 1ONWA 4IYKA 3VI3F 1KGJA 3NFNA 5KW9L 1EJ8A 3I6TA 5HJXA 1BIIB 4GSUA 5JPMB 4UQ3B 4G6FD 4A4AA 3MRBB 1VYSX 3LNHA 3JV6A 4NCC1 4UWQB 1AD9A 2KX9A 3M64A 4KJYA 2FLRT 1K72A 1X9RA 1UWIA 3GAKA 5DK0A 3ROLA 4HWZA 4LVBA 3UJSA 3ZYJA 3QPZA 2QCDB 4EN3D 3RWHA 5AVRB 2PPEA 1QT1A 2KT6A 3C2YA 3EAKA 2Y5EA 4JDZB 1YUHA 5I6PA 3VK5A 5FO7A 2EDHA 4MA7H 3AY4C 2O0TA 4U3AA 3G0XA 5HYSG 1YX1A 1L7IL 3A4WA 4UM9B 4LUTA 2CO6A 4EK7A 3F4DA 4L4VD 1AO7E 1WCGA 1SHWA 4E5XG 1DCLA 3MP4A 2ZXGA 4Z7VF 1RZIA 4MCZA 1TRDA 4LYQA 2QPDB 5HDQH 1FWIC 4DKDC 3QXDA 4R7NB 1XGRB 3LZFH 4TQEH 4KHTH 3TFCA 2X9YA 3G6LA 2JBMA 1ME9A 5A94A 2XSKA 5DVNA 1KMGA 2BASA 2REQB 4YDVA 1AW1A 3QN3A 2V5LA 1ONXA 3GFXA 2F19H 3H42L 2X12A 1P9MC 2E6AA 2NY2C 1QNRA 4FQ1H 4RX4D 2QJHA 4PMRA 1KBGH 2WLIA 3UPRB 4H1LB 3LYEA 2BZDA 4LEQA 4IU2A 2BXVA 3UFIA 4GS7C 4X9YA 1E1EA 4ADSA 2B2XL 3L5AA 3ARRA 4ZMLA 1G43A 2HJLA 5CLTA 2X70B 5AKVA 4HUKB 4E8DA 1NIBA 2GUBA 4BUGA 4C6FA 5F96L 1YJDH 5C6TL 3Q5OA 3NXFA 2WMPA 2DPKA 5ECUA 4EIVA 1PJWA 1KJ2H 4EI0A 3FOMB 4BV1A 4FZEL 5IWLC 3D12B 1KPRB 4WUKH 1G1CA 1RY0A 3QI9B 4QNEA 3GXUB 4WTQA 1EUAA 3M17A 4AV5A 4CJ1A 1T1XB 5F3BB 3B3IB 4GW4B 4LZKA 5FOBB 2JKTM 2XN9B 1DUZA 1RHCA 3WJWA 3CEPA 5DN1A 1E9YB 2YC1B 5JPNB 2WXDM 1OVZA 5LNVA 4HCGA 2EIZB 2O93L 1NA8A 3WN5A 4KRUA 3B8WA 2CJ3A 5FCZA 3WFZA 1ZMYA 2TODA 5BQ7B 1V6UA 5E94A 3NQ2A 1EGZA 2Y06L 3FQTB 5AC4A 4DJFD 3AZSA 3V0HA 4YLWA 1G9ML 3U4EB 1UQSA 4F8NA 1EO8L 4MX7B 1YDPB 2VXUL 4PMZA 5F6HJ 3SSZA 2QQNH 5LO7A 1JPGB 1RJLB 1OP5K 1T8XA 4P8WA 4GD0A 4WZHA 2QPXA 5I6LA 5IDIA 4NZCA 2BINA 2K8QA 3M88A 3RIAF 3P81A 4AQ1C 2C1PB 4DEFA 3LOTA 3K2GA 4YS1A 3MRNB 4AGLA 3KBVA 3KPMA 2VC2L 2EJ1A 1HXYA 1CLZH 5HY9B 4W93A 2FRGP 4LCWA 1WNOA 3S5LA 1JRBA 4KNQA 3F64A 3O3DA 2GK1A 1GG1A 2V2TA 1H61A 4G1MA 4XO3A 3CYJA 1ZB5A 1AHWA 3SKNB 3BPCA 2XKUA 1R19A 4B4FA 2BNJA 4F24A 4JTQA 2VW4A 1XICA 3GMRB 3IPFA 5L6YL 4NKMB 2Z35A 1MG2C 1NDTA 1ITQA 1WAAE 4RISH 4ZW6A 1V02A 5DMNA 5I1AB 3NN8B 3WIIH 3WJSA 1VFAB 3LPOA 2R29H 2A3TA 3I65A 3NPXA 1WFNA 4F58L 3TBTA 5IESL 1GOWA 3M43A 3RGBA 4FMKA 1RK1B 1J8HE 3MCG1 4PJGF 3VFCA 4HISA 3K2MC 3G6JA 1LD9B 5BYWA 5CWSA 4JM4H 2UZIL 5D7LD 2YW3A 3SDYL 2WLJA 1JWMB 3GUTB 4PJBF 1E6NA 4P4RB 1ISYA 4FYRA 5DJDB 1XLJA 1BYDA 5E2WL 5CS7A 2F74A 4DKEH 2HNHA 2GI7A 3KOZA 3UBXB 1AO7B 4B95C 3F00A 4EXAA 2Z1PA 1IM9A 4PWKA 1ZHBA 3DXIA 1BVNT 4L8CA 2E25A 4D0BA 1GQJA 4HXAH 2ADFH 3Q2CA 2WQXA 4QAMB 4WY0B 4MXVF 2FJHA 1GYWA 4V33A 2XTJE 2YKLL 1FE8H 3ZLGA 3B9KA 2R4SH 5AB1A 5A16B 3OGCA 2B3IA 5JXAH 4PCFA 1X5ZA 3CV5A 3OZMA 1FWSA 2PWDA 5IW3A 4P2QA 1XR2A 4Y2LA 3MW7A 3BO8A 3CFCL 4OHQA 4MWAE 4P3DB 3VI4F 5L9FA 5AVYB 1J0YA 4U2YA 3JWNC 3Q6GL 4QPEA 1FV1B 3OXRA 4GUPA 4XNBA 4IX0A 5IBUG 2CMRH 2NXYC 2DQFA 3OAYH 2X4NA 4ZAKA 3WSQH 5DFTA 1FNAA 5EOTA 2YD2A 3NEEA 3F7KA 3S96A 3QCTH 2QHRL 2VD9A 1CI1A 4Z08A 2OYMA 1P6FA 3CD4A 1N19A 4L5FH 1KB5H 2ZUNA 1UZ6F 2L7QA 2WLNA 4NVTA 5HHPB 4GUOA 4O4YL 2J62A 3S9ZA 3M45A 3D39A 1SGKA 5J3HC 4W89A 4LLDA 1NFBA 4H13C 1EQPA 1AIFA 4O2CA 3N4AA 1BZ7B 3MRLA 5HD8D 1JQXA 3HN5A 4H19A 4W84A 1TJ2A 4GG6F 3F4CA 3BQUA 1MVFA 4IJRA 3DHPA 1UJQA 5LQBH 5GRJL 3QCUL 3F83A 4ODTH 2W59A 4YVVA 2P8CA 5KANG 1C7SA 4OE7A 3F4NA 4Z7WE 3REVA 4JFHD 3W85A 3QFJE 4S0TD 1QKZL 2CIKA 1LT8A 2XTLA 3V4PB 3GZKA 3IB4A 4QS6A 2HMID 4KU1A 2X8RA 4EDWH 1MAKA 5TJWK 3E74A 1MFMA 1KXTB 4JEGB 1GPOH 2RFXA 2NV9A 3MX0A 3TWAA 5B39A 4UTMA 2GSIA 4KK6C 4BBWA 1EHKB 1IXPA 1NFGA 3KLAA 3SD5A 2XFXB 1N82A 4P46D 4C6BA 1QTWA 3PAVA 4LKXB 3N13A 5C6MA 1CBGA 5T5NF 1MNUH 4IPLA 2YGVA 4ZTPH 1XXFC 1EPXA 3CQQA 5CEZE 4XNYL 1GYCA 5DHYA 5U4NA 3AI0A 2ZXBA 2QSCH 3I3EA 4FPSA 1QNZH 1FO0L 3QIUD 3VIOA 1EYWA 3EGDB 4JTRA 2Z7GA 2WSRA 4E0RA 3O3EA 2PP9A 3EJRA 1S3KL 5K7JA 1H7PA 4K8RD 2CKNA 1J1OL 5XIAA 1REQA 3UZVB 3EDKA 2OL3L 4LUIA 4ZUSB 4HJUA 3S2AA 5GJNA 2VQUA 1MCEA 1R2TA 3OPZH 4AVIA 2R15A 3CXFA 3PWVB 4ZPTA 3NH7H 1KLFB 3VWJD 4ZFZA 4PRTA 1BVLA 1WB0A 1EMTL 1S7WB 4UFLA 3AMDA 3GMMA 1OP4A 4OLUH 3G6MA 2ARJQ 5EF3A 4PMNA 2A74A 3CV6A 3TQ0A 5AL0A 3QEQB 4LANA 4WO0A 3UG4A 1YEJL 3S42A 1N5YL 5E8NA 4ELMA 2NVCA 4M1GL 3E2QA 1JNJA 1TJ1A 4LP4A 3S9YA 3E0LA 2QTVA 4NRYA 1W91A 1WV7T 1UQYA 5A6SA 5C07B 1FHNA 2Y70A 3G5XA 2Z4GA 1Q8AA 1TXKA 2FBOJ 1OGSA 1EWHA 1NFDE 2P8MA 4ALAC 3TA9A 1O94A 2QDDA 1B4RA 2A9NH 1OCJA 3QIBA 4NUJB 4PJAA 1FLRL 1RSYA 4W4NA 3IXAA 2PPGA 3NIFF 4MZRA 3BH4A 3PWLA 5DZOA 4YUEL 4GQBA 5FYJL 4KEUA 5I3DA 2BJML 2HVBA 5AVTB 3MPGA 3TCXA 4BFBD 1JYNA 5E2VL 2R1MA 3O9WA 3RVTC 2HKAA 4PV1C 4ZUTA 4DNHA 2WWNA 4L1SA 3AB0C 4IBQA 3QZPA 1QYGH 3BOVA 1HZHL 3NAAH 2Z2BA 3QCVH 2QAPA 4ONFL 2N1KA 2O55A 1E9TA 3MKGA 2CWRA 4X4ME 5LZLA 5GS1C 5TQLA 2Y36H 3KPNA 2OGYA 2VL4A 3H2QA 1DQJA 2Q8XA 2UZXB 3NK4A 4ZMZA 3W2UA 4J9JA 1LRTA 3KPPA 1I4NA 4JO1H 3HNSH 4PGZA 2BX5A 4BELD 2O92A 5B4MD 5KSUB 3DI0A 3RNQB 2D22A 1YYAA 4I5XA 5FXCH 4JUSA 4KXBA 1C91A 5C0CE 4JFXB 4YHOL 5D37A 2WYSA 2B7OA 3MJMA 4LVHC 1HKJA 4JVWA 1CXLA 1GPWA 4URTB 3RKDC 4LLUA 1E4LA 2DMKA 3U4AA 1VP5A 3DX6B 1EF3A 4W9KC 1D2PA 2WVTA 2OJPA 4Z7WB 4QLRA 3L9CA 3ULUE 4M7ZB 2CFFA 3M8OH 4K5OA 4C6MA 5M03A 4PCTA 2ZCLL 3VXSB 2AEPH 4QIUA 3L2NA 1G4MA 1PB0A 3RWFA 5IHSA 4EXKA 3T2LA 3TP4A 3RM9A 1AGDB 3LGDA 1TWZA 5IOPB 3GSUA 4WQ6A 5I66B 3RX9A 3MCKB 3CZGA 3UAJA 3CAVA 3FRPG 1T2QL 7ENLA 2VLJE 5HGDB 4KDTA 2V37A 1CZ1A 5FYLL 3PPSA 2PDNA 1ID2A 1TZ7A 3FAXA 4JPQA 3FA5A 4AL8C 5IEHA 5FR3A 4IGMA 3BUYA 2CUMA 3GDKA 1WFJA 2FWOB 1QBML 2JMRA 1ALDA 4NQEA 1P1ZA 1S2UA 3V8OA 4JQXC 2ZZ7A 4HWBL 1S5HB 3BAXA 3CK0H 4PJ8A 2CH8A 2FYYA 1W2PA 4XWGL 4OZHF 1U2HA 2QVTA 3ZS4A 3OKKB 2G5WA 1WO2A 4NPKA 4XMKH 4NJJA 2CXEA 4O1BA 3M5XA 2FE0A 3N40P 1A7OH 2ZKWA 2DVUA 4TQHA 5JW4N 5JR1H 5FGSA 3O07A 1I7TA 4Z5RB 1NIEA 3VA2C 5D96C 4WCJA 3WUBA 5EUOE 2J6XA 5JW3H 2WCAA 1TQWA 4A7UA 1QBAA 4O54A 4F15C 2WSDA 3T08A 4HJJL 3I02B 4Y2DD 1WICA 2VXVH 3AO0A 1I7UB 1NMCC 5GRZA 3FULA 1KIRB 4A2HA 2XIJA 5E00B 2AK1H 3CPUA 2AKMA 1LWHA 3P3BA 1INEL 2GPZA 1OBAA 3T4CA 3S9IA 1DZBA 2FO4A 5D72H 7PTDA 4OD2A 4WJ8A 3Q2VA 3ZE0E 1CD0A 3TFBA 4OD3L 3GSXB 4CN4A 3Q1SH 4EIBA 4G6AC 2N4IA 2DQJL 3KCLA 4QHUA 2YDQA 4QQ3A 3CQ0A 4O2FA 1PHWA 2X0WA 4ODXB 5D2TA 5HVWA 2B7PA 4H2CA 4HEPA 3GDLA 4B5XA 4HMEA 2NY1B 3DN5A 2ATKB 5J1AA 5LBSA 1KM2A 1MCCA 2IPTL 4JMXA 5EO1B 3MT1A 5DTFB 3EMQA 3SDXB 2ZRUA 1HFUA 4E2VA 3AIWA 3WJXA 4IS6B 4OCYH 2VL5B 1WYIA 4JY6B 1OQXA 2IGTA 1YEWA 4ZMNA 1U8OA 5FAGA 3RX2A 4U10A 3EXTA 4EWND 1MHPH 1UJ3A 2E3ZA 5CPLA 1EO5A 3H8NA 3QZOA 4R0LA 1WISA 3SCMC 4Y4KD 1CTNA 3O8AA 1AQKH 3UCCA 4R5TA 3OX8A 5C0FA 3VOGA 1KT2A 3W70A 2ZE3A 1JGVH 4NZ3A 5C54A 1D9KB 3S4SB 3GTFA 4N0UE 1FFOB 4JTJA 5K1JA 1ORQB 3LRSB 3G08B 1TU2B 4RZ5A 3I6EA 4NN6B 1QEWA 2ZYRA 3GIPA 1DSFH 5M2FX 3GK0A 3DPBA 4IIQC 2IAMD 4WNQB 3QDGD 2H6PA 1IAOB 1EXGA 2JKLA 5E1GA 1YYMH 4N6FA 5JORA 1S2VA 2W8CA 3EYQD 4LESA 1XC6A 3CFJA 2JKRM 4OCNC 5CZRA 5J6GB 4N20A 3UJTH 4P7LA 2CNZA 1KEML 4RMBA 2IBZX 1H3WM 2IF7A 4PGCA 1Q2RA 1CG9A 3MBFA 2I7OA 2AXGA 4BF9A 3TBYA 1GMEA 1FVCB 5ITFA 3OG3A 1DIEA 4TXEA 1B3YA 5D2VA 3E1ZA 4PFMA 2ADIB 1C29A 1FRBA 3JWDC 3MNVA 1MRDL 1B3OA 4DJFA 1CD1A 5H1WA 5B3SB 2NUPB 5ICZB 2EVJA 2HROA 4IQLA 4D9RD 1I85A 1FZJB 4G9FD 1EHLH 1KCZA 4MZ3A 4IXHA 1KN2H 1UOKA 3Q8EA 4ODVH 2HISA 2Y07L 4BQ4A 2AK4B 3C5JA 2RQ8A 1NCCL 4PJCE 3VTMA 1A53A 4L4JA 3CHEA 3ZVVA 3PJNA 4O1EA 3LNPA 3GNDA 3V6ZA 2OO0A 1BJMA 1CF1A 3KVQA 5CN2A 3DG6A 4FK9A 5A8MA 1OP3K 4HHPA 3II1A 2VLJB 2WBWB 1TPH1 3M5VA 3SYOA 3QSTA 3GLAA 1KJ3L 4Q58C 1XL6A 3BVWA 3M1BB 3S5OA 2Y1HA 1GGIL 2R7EB 1R34A 4F40A 4AMXA 3HGRA 2PO6C 3P93A 2GGGA 3N2CA 1P7KA 1KJVA 5HGAA 4AY0A 2ACQA 1UR2A 5ALCL 1RZQA 3VDCA 2DU2A 5HPCA 3W1TA 1TQUA 4ADTA 1DJHA 2BFVL 1DVZA 1BEXA 4ZE5A 1PUDA 3NRFA 4H1ZA 2E47A 3OKMB 4MD0B 2YYTA 2AXFA 2I9LB 5EMJA 3X1GA 2X9XA 3VFRA 5FKAA 2V7NB 3CFQA 2A4CA 3CLWA 3R1ZA 1WBZB 2HTKC 4OQTA 3CXDL 1ZHNB 2C1HA 2XVBA 5DLCA 2HWGA 4OCRH 4XHJC 4Y4HD 2ED7A 4LNRA 3OR6B 5F44A 2WMHA 2KLRA 1R3JA 1A02N 2H7WA 1C5CH 4DWDA 2DP3A 3Q5TA 1GQLA 4NNPH 4W6WB 2ZIDA 1BZQK 4UOJA 4GJ1A 2ZCHH 3CG8A 5DJ0A 2B1AH 1DJNA 1EXUB 1EDHA 4G42B 4FX6M 4UQCA 2NY7L 4CC0A 2ZRXA 1YNTA 2LU3A 3PTDA 3X11B 2WWKT 3R1GH 4ENZA 1OV8A 3WY3A 2MRYA 3ZE0B 1O6IA 2QUMA 2BODX 4XZWA 1NPNA 3C6LD 1XCFA 2QKSA 3P0YH 1QO5A 3WLMA 4QF1B 4QEGA 5SWSD 3CVHL 1DQQA 5K9KA 2J8UA 4W7VA 4MS8D 1ZE3C 3ASOB 5I07A 3CVCA 3UDWA 3BANA 4G7QB 3O6DA 4OZGE 4NBXB 2OCFD 4PB9H 1FL3B 3ZL4H 3MLUL 4HS3B 1SFDA 2NVAA 3APFA 4WY7H 3WDPP 5KBDA 1M1XA 3U0WH 3E0VA 1C5DB 3F8UB 1XC4A 3WIHL 1R5YA 1M7PA 1A50A 4PVBA 1JDDA 1L6SA 4FXRA 4XBPA 2ON3A 4F2MA 1A6WL 1A5BA 1A4LA 1C3FA 3GK8H 4EXBA 1BLNB 1E71M 3H0TA 2FVLA 4HX1A 3NG5A 4ZUVB 3F4WA 2JCCF 4H25A 5JO5B 1WFMA 4IDJL 2RMNA 4X0KA 5ACLA 4LOVA 4RAVA 2EDLA 2CA4A 2DZAA 2DW6A 1YLBB 4XVUD 5HATA 4PJEB 2CO3A 4BFOA 5C6WH 3O8XC 1EJVC 3S5NA 3M7OA 2ZZ5A 4ZFFA 4PGDA 1R3HA 1MNNA 3CO8A 3WEMA 2CBVA 3QMSA 2FO8A 2IFFH 4BSVA 1C08B 4TQPA 1U58A 4YDZA 1SXNA 1MH5A 4YVXA 3BAIA 2E77A 3WD1A 3RPIB 1BG1A 5IMOA 1WJ3A 5FSDC 4Y9EA 2FJGA 1RHFA 4B5VA 5KANI 4C91A 3BKCL 1NCUA 2ICWA 2DLTA 4WW2C 2X1SA 2DEYX 2VCAA 1A3RL 1LTXA 1MOEA 1AUSL 4AEEA 3N6YA 2JQXA 4H9TA 1FH8A 4EI5A 1H5YA 1VJZA 1YECL 4AYDC 1WPCA 4FJ6A 1UWAA 1W3JA 3PF2A 4UBPC 5HYSB 2QEJA 4OAWA 2EKSA 4UNUA 1IC1A 3GGWA 2VT0A 2WWOA 3T6QC 5LB1A 1WAPA 3KZPA 2TSAA 2Y61A 4H6QA 4Q4RA 3TV8A 1CGWA 3WH9A 1OARH 1XDJA 1MCRA 3WG7B 1KCUH 1SJHA 5K39B 1XFCA 1ZPLA 1ORSB 5TQ2H 1I6NA 3EMZA 5FOJA 4I9TA 5DSCB 2AQPA 1PKYA 4F3FA 1NCGA 3GS4A 4PUDA 3FT0A 2IAAC 3FB6B 1FNEA 2CZVA 1SQMA 2VXQA 4YWGL 4AYFB 3E6FB 2GTWB 3AS2A 3T07A 3CTLA 1ZGLM 4MNGE 3G5YA 1XYFA 1CPUA 1ZS8B 2E8ZA 1HINL 1P0SE 4NAFA 5IROC 1KBKA 3O6MH 4JQ2A 4WGXA 4XZ9A 4FG0A 3D2TA 1HL2A 2NQCA 2XBTA 3HAEB 1Z6KA 2HMCA 5JIWA 3M1ZA 3CBKB 3MP3A 4ZFQA 3BLBA 2MTAA 4NNYA 4UFKA 1PTDA 5DD5H 2Z2UA 3MB9A 3AAMA 2PUQT 4IPNB 3F04A 3QO0B 2NSQA 3GSOA 4S1RL 4WFGE 3ROOB 2RGMA 1T21A 1BTMA 1PYWA 2BS71 4YHLH 2ZJSH 2N7AA 1MG3C 3PL6C 1GVRA 2Z92B 3KPSD 4QGTA 2QZRA 4LFHD 1J8VA 3UAFA 4JREC 4A6YL 3QW4B 4MD4A 3SKMA 4QAWA 2WTPA 1O6SA 3L23A 5GS2D 3ZUNC 5EORL 4JS3A 2R2HB 4K7FA 5KSVA 2Z6JA 4F9PA 2NUXA 1TSIA 4DJED 2ED8A 4U05A 2A6KB 4K9EH 5FYKE 5KSBF 5KVDL 1OYBA 3ETBF 1LNUA 2VFIA 5I5RA 5I6KA 3FUNA 2A21A 3N6JA 1CT8A 1OHQA 1S7TB 2HRPH 4EKJA 5ICXA 2BO0A 1Q2SA 4U1MA 1H63A 4UC5A 4O10A 4MMZB 1UOWA 1H1NA 2AP2A 3HIJA 8PAZA 2Y6SC 4XNUL 4MG4A 3QORA 4WFFD 2Q76A 2Q3AA 1JPHA 3G7TA 1RJZB 3QDJE 3RZCC 4GAJH 5CEXB 2GJZB 4QMEA 3BHBB 2VLLA 3NJLA 4PS4L 1F90L 1TREA 3DBXA 5BZDB 3EFFB 4U5KA 1WIPA 6REQB 4OLYH 2APWA 5L8JB 5FB8A 1CQKA 3RLUA 3P2VA 2I32A 4HT1L 5FO9A 2FJKA 3WUEA 5F9OH 3TESA 2QDHA 4LSTH 3TNNA 5DY2A 2AQ3A 4DX3A 3ITLA 4DN1A 1IAII 3O2DH 3C60D 4IU3B 4S3GA 5D1XE 3WJJC 4IJ3C 1MI5A 4IRJD 2BK8A 3JVAA 3ECQA 3APYA 4W9EC 2AJVH 1KPVB 1HEJC 3UR7A 3NJFA 1NCDL 1T8QA 1ECQA 3C8KB 1EVTC 2BCKA 2R1YB 4CD5A 1J1PL 4L3FA 3NIDF 4P3WA 1XLFA 5H2BA 4GRLC 2YCJA 3GIYA 1NGYB 2YD7A 4C6CA 1H9VA 5I8OH 5ISZD 3TN4A 3KWWB 2QV2A 4QXVA 3EYOB 2NY0D 5C0GA 4LRIC 4PVLA 4CD8A 3PBGA 4Y5VB 5TGBA 2FTYA 1BAFH 3WLWC 4MKNA 3DX5A 3LPPA 2XH7A 1M6UA 4U6YB 1B4KA 3UP6A 3KBEA 4QSHA 2QPSA 3FJ4A 5F89A 3GH4A 1MEIA 4NNAA 2BOCA 3KEDA 1GW0A 1OOAA 4JIQA 2DIJA 2B7NA 4H7VA 3C87A 3OJ2C 2H0FA 2EEAA 1A1NA 3EWYA 2YFOA 4AYID 1GKQA 5I8EA 4R26H 1L6XA 2Q7YB 4FQLL 4NRXA 4WW1A 2HN7B 5D7KD 2Z31B 4B92A 3CUJA 4RIRB 3LZ5A 1SPDA 3Q44A 2ORBL 3W1QA 4F7MB 2FUQA 3B8IA 4BI6A 3QHFH 1IBHA 5EPMA 1RZKL 5E8PA 1W2KT 3K71A 1SJBA 4NM8L 4GXVH 3CK5A 1TPXB 3VIPA 1JHKL 1IC0A 2DLHA 1HSAA 3V5KB 2GJNA 4LVEA 3FT2A 1I1FB 2WO2B 4J3WA 3HZ3A 4XMLH 4Z2HA 1NM9A 1J05A 5BVPL 4KMTL 2WBGA 4NO0B 1PL9A 1S5TA 2IC2A 1Z6JT 2VDRH 3QS3A 2EINB 1OFRA 4IPJA 5E9DA 2PDFA 2EG6A 1QASA 3KLDA 5GRWA 3EWZA 3D08A 3U36A 1PZBA 2A3AA 3LJ3A 3LBOA 1N18A 3RVXC 4R33A 4D6EA 2W60A 4JE4B 3I6RA 2G96A 3HNVL 5BOZG 3W82A 3OG4B 4R4ND 4BCZA 4U33A 1M41A 3Q6FB 4PJHB 4S39A 2VDGA 2DBLL 1Z41A 3LCGA 5MHSE 3I6LE 3UJJL 3HCVA 5CMAB 1DVSA 3RG1C 5AW9B 3OODA 1SN0A 4UAHA 5FF4A 4DQWA 3RU8H 2DWDB 2X87A 4FNLL 4Y2DA 3SE8L 3MO1A 4HK0B 2KZKA 3VDGA 2DM4A 4ZQKA 2PDQA 3ANYA 3NJKA 5EDXA 2VUOA 4HFWA 1GVFA 4FTVB 1MCNA 2ODIA 3R6IA 5AVUB 4QXUH 2AKRB 5DJXA 3VH8G 2YR3A 3P2TA 5LAXB 3N34A 2FLIA 3BCDA 4XI5C 4ZQOA 1Q94A 3C61A 1U8IB 1NAMA 2VAJA 1R0MA 4WO4B 5CD5D 1FNFA 2NTSP 3RTQC 1KDIA 1M71B 1BM3H 3QUXA 4OF3A 5EEYA 4XV0A 1MWAB 2FEDD 1OWQA 4E8CA 1USQA 1IGIH 4NN5C 4KROC 1TEGA 1TKWB 3UG5A 3IIZA 4S3FA 4NXSA 3A4DA 3LNIA 4IMKA 3DO3A 1K2DA 1NMAH 2KH2B 2P7TA 3QEUA 4P06A 1Y6NR 5E08L 5AY7A 2XXCB 4LOEA 5HHXH 4YJ5A 3B0YA 2XU9A 5C70A 2BOGX 4AD0A 3G04A 5DHVA 1G9NH 4JQIL 1OE3A 4P5KA 5B8CB 2WXIA 3HKFA 4Y4KA 2YD3A 3GH7A 5D2NE 1EWEA 3IKCA 4RBPK 1VFMA 1NUGA 2R0WH 1ZT1A 5D7IA 4FKEA 4R4FL 4BWUA 5J6HB 3TT1H 2CCVA 4YVUA 3GD1C 3QUZA 2GG1A 1XSOA 3LDBC 5D1XB 1Y1DA 2JIXA 4HPOH 3AHZA 1YTDA 5F7WC 4DOHE 3QIWB 4ES4A 1RSFA 4ZS6D 3ZTDC 4P05A 2YXFA 4J3UA 2IAMA 3KPLB 4O51A 3JT0A 3T4AC 4I0CC 1AJ7H 4JOMA 3QDGA 3BE1H 2QADD 3MUY1 2OKTA 2VH5L 1ICSA 4ODUA 3UU0A 3RI5K 3NDYE 4OB5L 2BNRE 4WKZA 4KKAC 3LHUA 4TUKL 3BTNA 1CLOL 1ZIBA 5DGRA 3S36H 4MJ6B 2LV4A 3S1GA 3GUGA 3WD0A 3VOJA 3VFVA 5L2KA 2XG4A 4LAZA 4PYSA 3PBWA 4XH2B 2LLEA 2A4EA 4S38A 1QMLA 2UY4A 2VXQL 3ZTNH 5J0BA 1R9FA 4G9FA 1C1EH 1YYLL 2KZWA 5T1LA 1KV5A 1NWUA 3LEXA 4RFOL 4MWFA 4APQD 1FO0A 1G7PA 4AE0A 1GZ1A 1G1KA 2BSED 3BPLC 4K8RL 3FEMA 4RE4A 5ESQB 3N44B 1EA0A 3O4LD 3VJ6B 5HPOA 1BQHA 1E1FA 5DK2B 3ORJA 3UL4A 1L0QA 5LGJB 4B5NA 2C9AA 3U6XA 5BWFA 3RX7A 2OL3A 4W88A 5FOOA 1E6RA 1ICTA 3P30H 5KSAD 4DTGL 4GYPC 3ARWA 5INDA 5D32A 1GONA 4RZKA 3PXJA 5C9JA 3ECWA 2MKLC 4AD2A 5FF6B 3JV0A 1ETZB 3S48A 4MMXB 2INEA 1K8YA 4XMPL 3LEPA 1W15A 3NZGA 5H94B 2DI7A 1G7QA 5DVPA 4LEEA 1V5XA 4K15A 4L9LA 4K3JH 4QHLB 3VD2A 4OFKA 1O5RA 4M1DL 2LU4A 4E2BA 3FTGB 2WWMD 1MNZA 1H3PL 4X9FA 3TEVA 4ECLA 1WFUA 1CI5A 3NIYA 3BJSA 3KL0A 4FNUA 2PDYA 3IJIA 2JI2A 2XY2A 2E6FA 3LHYA 1IT7A 4HGMA 3E8UL 4OLEA 4K23H 2G9HB 3FCGA 3W0WE 2WQDA 1BBDH 3OLIA 3Q2NA 4QTHA 3IGKA 1INDL 1GIGH 1I9IH 2BW4A 1KCVH 2JKIS 1C8VA 2DV6A 1P4IL 2QHLA 4HS6A 4P2AA 3SGKA 4LSPL 2VM3A 3VMNA 5TK4A 4AGOA 2G3ZA 3O6FB 4U1LB 3FB7A 3X13A 4DQOH 5I30L 3FYOA 1W3TA 4L8DB 5F2FA 3IUDA 5E99L 4UZGA 4WSKA 3BRDA 3PFMA 2DQWA 1CBVL 2NY6D 3TEZA 2VELA 4MFEA 5D5MF 4GZJA 1ZV5A 1I1WA 4RMVA 1H11A 4ZENA 1CFMA 1NIUA 1HCFX 2CBMA 4X3ZA 5GJPA 2BWGA 1K4GA 5AAPA 3MACH 2VCBA 2JK2A 4LAMA 2X0UA 2C3XA 2WN3A 4QRSA 4QIRA 4MJMA 1QSVA 1BMGA 1TG8A 5DRNB 3EG9B 4UIMA 4YBLB 4W9GC 5C1MB 2EQDA 3RJXA 1A21A 3QXUA 1JK9B 2I60L 4IDLA 1SJMA 1C90A 1MFCH 5D2NB 5DJ8B 4MA3A 1U3JA 4NZ8A 4H2HA 3GRGA 1CWVA 4QYOA 2JB6B 5D1ZC 1NGQH 2F18A 5FD0A 4KAQH 4H4NA 1K8ZA 5AHLA 4GUJA 1ANUA 4N5ED 1QSFD 5G2WA 3RWGA 3LKSB 2PTXA 1CICA 1CLCA 4XP9H 2VDKL 5F88B 3F03K 3FFDA 4DOHB 5TH2B 2FGBA 4GXMA 4OZFA 2WO4A 1X6NA 3LV3A 5GISH 1ISZA 4MNLA 3P5YA 1WDSA 2WZHA 2GHWB 3NQIA 1XM3A 3QQ4B 1SYSB 2HX8A 5CKGA 3WELA 4RA0C 3CO4A 2BW5A 4HJIA 6FABL 4JTSA 3HE7A 1V3MA 3L66A 2BNRB 3E3QC 3L7FB 1TV7A 2C15A 4AQAB 3FXIC 5IB5B 3QQWA 1PXGA 5DQPA 1OF2B 4P59L 1TVLA 3FY1A 3QRLA 2WJDA 4J6RL 5EN3A 2AI0H 1XZWA 1ONQA 2UV3A 3I6GA 3GINA 2VOMA 4F27A 4ZUWB 1T66C 3A3XA 3E9AA 4UNLA 3THMH 2DZSA 3DFTA 2VXTH 3QWNA 4ZUUB 4J28A 5K93A 2YMXL 3Q13A 3VCCA 3NJHA 1OZQA 3VOCA 2GK2A 2H3DA 4IQDA 1MFDL 1AIZA 1F74A 2FWLB 2PNDA 4D0CB 4AUBA 4HWBA 1JNHB 1I1RA 4NO5B 5CBEB 5GGVH 3QEQE 2X1TA 1BTCA 4KKNA 5I5IA 4DGVL 5KYXB 5EU6A 1BYAA 1HF6A 3IRZA 3QXAA 1F97A 3QXBA 5SWUA 1R2SA 2DWSA 3I75B 5C07E 4LASH 4C57C 3ET9F 4AVNA 2I17A 2JKJA 5CCKL 4WLCA 3O3RA 3K1KC 2O5YL 2DB8A 3UBGA 1AZRA 2YKKA 4W6XB 5DX7A 1DTUA 1IE7C 1Z9OA 5C0IA 1CF8L 2LVEA 1XIFA 3IJHB 2OGJA 3P4MB 3RU8X 3DUSB 4I90A 4UTJA 1A66A 2X3CA 5E6IC 3QLLA 6A3HA 4C6PA 5LNRA 3H7BA 3V18A 2Y1ZA 1B0GA 4X7FC 2OJ1A 2FSEA 4JG1H 5DD3H 1J87A 1ES0B 4MLRA 4JN1H 1NAML 1ITBB 2Z1XA 3UCQA 1GVYA 3WMBA 2XUWA 3HG4A 1MFAH 3HHSA 4LCRA 3LKQA 4ZXBB 3W0WB 4NT6B 4V11A 3X1BA 1YY8B 2OBGA 4KJWC 1KJ2B 5SV4A 5DBTA 5BW7A 4R96B 4CVXB 1GEHA 4QTIH 4U6XB 2FR4A 1HILB 5E7FA 4EIGB 5HR7A 2VKWA 4JNZA 4NX5A 4DJEA 4XVOA 1E2ZA 2FHCA 5JHDB 1PO9A 3URBA 2WMKA 5IV2B 4N0YH 4FA3A 3DIFB 4C83B 4IOSD 3PLYA 4FALA 1N3NB 4YXKL 3RVUC 5I74C 5C0EB 4ELKA 4TL4A 4E3VA 3OPSA 4IFKA 5EU7C 2C3HA 2H3NB 4B9JA 3FQ2A 1TTCA 5LLIC 3AG1B 4XO4A 3CC5B 4O2EB 3PWAA 4GGHA 4O0KA 4BKNA 4KY1L 4QGCA 3A22A 4OGYL 1X5MA 2WBJD 1S5NA 4XNMB 3ARGB 3LN5B 2W67A 2VFDA 3FXGA 2PGRA 4X8JA 1CFNB 3W27A 2BXYA 4FQHA 4MJ2A 1MAML 3DSFL 4KTGA 7FABH 3SBWA 3TSBA 2X0HA 1Z89A 4A7VA 2X40A 4AK1A 4NQTA 5EFFA 2AJSL 4EF9A 1F8TL 3K6NA 1DO6A 4RE2A 1NANH 5CCGE 2CLKA 3RJYA 1XTMA 5IFHH 1OM0A 3VXSE 3A3YB 1MPAH 3FO1B 4PS7A 1LE5A 3ZDXF 2HZGA 3GNPA 1ZT7A 2J12B 4X0VA 5FFGA 4H5SB 3GO1L 5I71B 3FN3A 2FD6H 4Y90A 4AENB 5FV2A 1J8KA 3VZXA 5I19H 3S36X 3KPOA 3IK4A 1QWKA 2A0LD 4AG0A 1LO5A 4IMAA 3L8QA 4OY9A 4GCXA 2XV2A 4DP4X 4YDJB 1K9DA 1FWXA 3UG3A 5PTDA 3L3OC 1QPOA 3BPNB 2DYPD 5I79A 3BKMH 5KW9H 1RLCL 1FRGL 4YNYB 1FN4B 4PUKA 2EKJA 1K9FA 3ML9A 5B39G 3DMMC 4AI7A 1IEBB 4NKQB 4F2BA 4PRBA 2XWJB 3A5FA 3X3FL 4YHPA 1SEQH 1KYDA 4OFIA 3UWQA 2A1WL 4ANWA 5GHWH 5EZLB 5FK9B 5CIPA 1IGCL 1HEHC 2EPHA 4L3ED 4I1PA 5AW4B 1JR1A 1S5IL 1EVUA 3FB8B 4O16A 2JKPA 2CLRA 1H6TA 2VDLH 3V0EA 3IKKA 2IKIA 1UURA 2XQBL 4IGBD 2CR3A 3SE4A 3UPBA 4F20A 3F65A 9CGTA 4E41D 3G8EA 1FWWA 4HIQA 4GIEA 1DE4B 5K69A 4PTWA 2LLNA 3T0CA 4DN4L 1C93A 3IACA 5TE7L 3VFGL 3TFKC 4ELDA 4PR5A 5D1QD 4POZC 1BHGA 3FCBA 1J79A 4Z7IA 1L7IH 3GR8A 5D6DA 2QCGA 4HLJA 4YDNA 1UZ1A 4H9MA 4UFHA 2AV1A 1MQKL 2BBFA 3K81A 3DGCR 5DLMH 4G70B 3N55A 1OAXL 5D4YA 1I1XA 3IGUA 3WBDA 4K55A 3DX1A 2XPYA 5E51A 4JTHA 4Q8OA 4H9ZA 1FHVA 3VXRA 4G1EB 2WVVA 2YCLA 2RB8A 3W2JA 3SDXE 3H42H 1T1ZA 4D8PA 5I0ZA 3AIQA 4GVIA 2YGOA 2XPZA 1ZAGA 1T40A 3DVIA 4WK9A 5JBFA 3IU3B 1AH1A 1FL5B 3TC7A 4Z1AA 3SBQA 1RL1A 3QJAA 1SEBB 1E0TA 5EDSA 4K71B 2OWWA 3WI9A 3NGBC 4YSTA 4JZJB 2OZTA 2K9UA 3FHAA 1BXCA 2B2XH 2BY0A 4DGYL 1M56B 3P62A 3G5ZA 2HVJA 4KFMA 1S7QA 3CVHA 1JGEB 4AH2A 1ZXKA 3F7QA 4JIRA 5BS0E 1ODUA 1LQBC 4D71A 2Z8SA 1KB5B 1A4MA 4PRPD 4HNUA 4P2OC 2INZA 3T3PF 3VI3A 4AQ8A 1IEXA 2VDQL 4HS8H 4FZEH 4IIGA 1Q63A 1X5FA 5I1DB 4C6EA 4LGPB 3RB7A 3DZ1A 1BJ1J 3G5EA 3C5ZD 1FWAC 3VC6A 3WIHA 1FWCC 5F4WA 3CN1A 2F84A 4ZVJA 1AI1L 5FHBH 2C1OB 4HALA 4PWEA 3PWNA 5F9AC 3AT0A 1XIDA 1G6RL 4HCLA 1H6UA 1UZGA 4TS6A 5DC0A 3FQNA 3UTTA 3NRQA 5CU5A 2CIIB 4TMCA 3S2MA 1VLXA 2APSA 2P80D 1N10A 5A8QA 2IXQA 4M00A 1VBGA 1WT5C 2X4SB 3TT3H 4CSSA 4GKNB 5FECB 4NSKA 4JDEB 4UT7L 1LEKA 1CFSB 3RWIA 1EDGA 4UZSA 5ECGA 4IK6A 2Y5SA 2YZRA 4UTWA 4R83A 1G9MH 4OSUL 5FA4B 4ODHL 1TR7A 3MBWB 3AGWA 4XAYA 2NYYD 2OMXA 3DIDA 2VXUH 2QLVB 2WIIA 4LHQB 4KOBA 1M65A 2Q71A 4Z7VA 3GDBA 3C5SB 2C1IA 2AK4E 3EJYD 4MZ8A 3O0KA 1HCVA 2WKJA 2V8ZA 2FMOA 2YZ8A 2OKOA 3QNXA 3KBFA 1X5GA 1P7QA 4PRAB 2CYGA 4ETYA 1G4EA 2VC2H 3Q94A 2OEJA 2EO7A 1BRLB 4UDTA 3D3VE 2GJLA 4MA8L 3ZDZF 3QFGA 1WVZA 1N70A 8TIMA 2HLAA 3MLSH 4NFCA 1RZ8A 5CSBA 4XVTL 3D25B 5DQ9B 1TV2A 1Z32X 3POHA 3MROA 1JK8A 1J0ZA 1R3RA 1JERA 1M1BA 3TVMB 5BOFA 1F6LL 1KTCA 1AQDA 1AOZA 4DNMA 4HULB 4PJDB 2NYZA 3ARXA 4S3CA 1H60A 1B6UA 3U9PL 3NEXA 1B1YA 2XU2A 5L6YH 4LBEB 1NIFA 1X8CA 1D8CA 3Q0HA 2OSXA 2XM2A 2G5BB 2HQAA 3WS3A 3CU1A 3P8JA 2VKZG 3ZLHA 5A2BA 3HBQA 1DBJL 1JCVA 3VAVA 3QH3B 2G8ZA 5SWQB 2GQHA 3LXAA 3L08A 2BZNA 3IGSA 3USZA 4HK7A 4F58H 2BIMA 5K9JL 5IESH 3N25A 5HYQA 1LL4A 4EN3A 2NXGA 4APQA 5E7BA 3KRZA 1U92B 2UZIH 3HE6D 2HT4D 4UI2A 3SDYH 2BSEA 3VXUD 3DBPA 2DT0A 4XX5A 2D3LA 5E2WH 4X60A 3BV4A 1AD4A 3ULAB 1QUNA 4F7CA 2OCCB 2ZSWB 2Z7ZA 2HT2C 2IWGA 3NL3A 4P2RD 4L4VA 1XXDC 1A64A 2XKNA 3PUEA 3DV6A 4YSQA 4P23B 4HUWA 3DPDA 1IQDA 5KBNC 2B16A 2CHDA 1L8NA 3BMWA 3WLNA 3KHJA 4P2CG 4Q6IC 4LP8A 4I88A 1EF2A 4X7SH 3HR5A 1ZSDB 3KCPB 3QPYA 3U9WA 2YKLH 3HQPA 3TYZA 5DMGD 4LOUC 4A6YA 2FT7A 1X44A 1B9KA 3MA9H 1YMMD 2OMWB 4YXLL 2PYEB 3PSWA 2YXVA 4FI7A 1GZPA 4BWLA 4XHQA 2ENSA 3CFCH 4RX4A 4NAEB 3A4AA 4ZGYA 1G7MA 3RFZC 2GT9A 2X6BA 5I0YA 3Q6GH 3MXWH 3HBZA 2UYLB 1OADA 4MADA 1DL7L 4BYHA 2FZ8A 1NH6A 3MRGB 4IP7A 5DRXA 3RUGF 5BS0B 3E96A 4UYQA 4Y9NA 3N50A 3GFYA 5CG0A 1Q4NX 3UXIA 3UBHA 2HT3C 2QHRH 1REIA 1TMQA 2R2BA 1EJFA 3P54A 2XPGB 4C1KA 2XY1A 5M94B 3TF7C 2N0MA 1QNQA 4PJEE 3BW9B 2PF6A 4O4YH 3L4UA 3ZT6A 3K72A 4LVGA 4NQCB 1QAWA 4GO8A 2X42A 1COBA 3LB6D 5AFAA 1K6QL 1GYAA 1S39A 4PJGA 3DJTA 1FNSL 1MUJA 4Y4FD 4GW5B 2QUTA 5GRJH 3QCUH 5HI3D 1A5OC 4NJAH 3FNKA 2Z9TA 4XWUA 3B3DA 4RUBA 1XIWB 1TTJA 2V5TA 4ONOA 4PJBA 3US9A 4H3DA 4ASTA 5EU4A 4R9HA 1UJTA 4X0NA 3UH8A 3MUHL 3K6FA 2WWKO 1LG2A 1QKZH 3FKUS 3T2QA 3FUMA 5KBMA 1EGJA 1JZEA 1UC6A 1PKQB 2VCCA 1H5VA 3PG2A 2WCGA 4L9YA 3DYPA 1O9VA 2DI9A 3QV7A 1CDBA 1O7DC 1V8EA 3MZTA 4H40A 4CGTA 2BOEX 4HN4A 4E4UA 1XRVA 4O1FA 1E4HA 5HQEA 2E5BA 4L29B 3DU0A 1EDYA 1JZ6A 1V7YA 1A3ZA 2WLYA 3UYPB 3HJEA 4YXGA 4Q6XA 5BPPA 3MREB 1R24B 3NZ8B 4Y19E 3OQEA 5C0ND 3QDMD 3CDCA 4A7GF 3TS8A 4JY5H 4OCWL 2VR4A 3J8F7 5D6CA 3GBML 2QKIB 5AB2A 2DWEB 4DLFA 1F5ZA 3D3VB 3CIWA 1YEYA 5I6SA 4XNYH 3L3DA 1W0VB 7TAAA 3RL1B 1ETJA 3U2SB 4JGDA 3W56A 1Y6KR 3AU2A 4LF3B 1CR9L 5C9KA 4LRSA 3QG6B 4XZMX 3G6AB 4NHUA 3UTZA 1SHMA 1TYGA 1FGNL 1F4WL 3VI4A 1HTYA 3ANUA 4LLWA 1S3KH 5KTEH 1Q1JH 3DERA 2BLEA 4WGVB 1J1OH 3IJ6A 2BP1A 1GH7A 5H6HA 1JVKA 5E2TL 3CXOA 3LKRA 2P0OA 2VZSA 1HJBC 4MDRA 1ZOXA 3HS0C 3NJNA 1UG6A 1B31A 3CFKA 1AGFA 2EUVA 3VKKA 1B0RA 5DGQA 2UWFA 2X0SA 4HT3A 1HKIA 3RWEA 5BO0D 4ABUA 4DO6A 1VERA 2Z6IA 5CN3A 3RURA 2ETWA 5F1IA 4G43A 1LVEA 1EA9C 4Y9BA 1VCBC 1CNVA 3FYPA 1SJXA 5D7LA 1YEJH 4OLZL