3L4ZA

Crystal complex of n-terminal human maltase-glucoamylase with salacinol
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 275
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4zA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4zA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4zA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4zA01
3S2CA 3A22A 1JI2A 5M03A 3K8KA 4DUWA 1DWIM 4D6HA 1ESWA 1LWJA 1G01A 3A3HA 4DUXA 4DWSB 1TVPA 1UWIA 3L4XA 3VKKA 3SCWA 3UCQA 3MV11 3BVTA 3M07A 1UKOA 3VSUA 4CCDA 4EANA 6CGTA 3CZ8A 1KQZA 1PBGA 4U5IA 1E5JA 2J7DA 1FHDA 4W7VA 3B9AA 3IAPA 4W93A 1LG1A 2AMGA 3AZRA 3KL3A 3MMUA 4UOZA 2O92A 3VVGA 2VCCA 4W5UA 2DH2A 1M03A 3JUGA 1WDPA 4H8VA 4L4OA 3PTQA 2WHJA 4KMQA 3DDGA 4OOZA 3ARRA 1GHSA 4JL2A 2GJPA 2EPOA 1CXEA 1JXKA 5ABFB 5GNZA 1M01A 4MB1A 5HPOA 1CGVA 2G8ZA 1VENA 1XV8A 3VDAA 3EDDA 2YL9A 3FY1A 1B9ZA 3O9NA 1GW1A 1QBAA 3QGVA 3I3DA 2IXUA 3NYDA 1CXFA 3AIQA 4CKQA 4PMRA 3A5VA 1SFSA 1JNEA 1TQUA 3NCOA 2G3JA 3MUAA 1GCYA 1R7AA 4HTYA 3EJSA 3NUKA 2DT3A 1XD0A 3BXWA 3G6MA 1OB0A 2X09A 5C8BB 4ATLA 4AEEA 3B8SA 2YLAA 1PSPA 1IV8A 1HP5A 5A6SA 3K1DA 3PZUA 3L4YA 1W2VA 4GQQA 5CGTA 3OLIA 4KGLA 1LL4A 1HT6A 3OLDA 4OBRA 1X6NA 3WSUA 1UG6A 4W7WA 1PS3A 2BY0A 1UWSA 1K9TA 3OGRA 2YDQA 1FOBA 4FNQA 4W87A 2WNWA 3U57A 3UEQA 2FHFA 5HOSA 4Z2JA 1PJ9A 2BVYA 4LX4A 4GO9A 1CPUA 1T0OA 4CU7A 3IJ9A 1B31A 3OIHA 1VAHA 1IZJA 4RE3A 3VSTA 3QR3A 2W67A 5D8ZA 3HG2A 5CXPA 2WYSA 3VGFA 1LL6A 4CGTA 3VD9A 3DHUA 4CN6A 1VFUA 2D73A 4UFMA 4AZBA 2OYMA 2D2OA 2A3CA 1E1FA 2YDSA 1QNRA 3SUUA 1ISZA 1C8YA 1XSJA 2VRKA 2CPUA 1U33A 1BPLB 4CU8A 1D2KA 1UD6A 1MQRA 2YKKA 2V5CA 3U5YA 1SMDA 4IM4A 2Y8VA 1V3LA 3BLPX 3HG5A 3SCNA 4U5KA 2XN2A 3D4ZA 2VQUA 4MADA 1NP0A 1OD0A 1ZBCA 4ATDA 3BSHA 5D9NA 2XFYA 5I79A 1CGUA 1HJSA 3ZSTA 4CCEA 2CETA 3F5KA 3BUIA 3ZSSA 2VCAA 1CDGA 3LPGA 4JFWA 3FAXA 1V3HA 2RGMA 1J0ZA 4MJ4A 3HJEA 3ZT6A 4V2XA 3WDQA 3MS8A 1V0KA 4MB5A 1E9LA 4PMZA 3WDPP 1GJWA 2YJQA 1H3GA 1D3CA 1UR0A 1S46A 4AZCA 3BMVA 1C7TA 3GTNA 4J3TA 3AXHA 5I5RA 1LG2A 4FF5A 3ZIZA 2VRJA 3A4AA 2V3GA 4UFIA 4J7RA 1J0YA 4FMVA 4BQ2A 4HU8A 4N0RA 5AYIA 1UA3A 1PIFA 3SCVA 1RPKA 2WHKA 1OWQA 1W1VA 2VZUA 5D8WA 2VOTA 1H5VA 1HJXA 1RD6A 2WWCA 4DO6A 3N15A 2XFFA 3FHQA 3J7HA 1H09A 4J3SA 1VFOA 5E0CA 4DWSD 2VVNA 3WUBA 1PEZA 1KWKA 1QI4A 5I78A 4HOXA 5F7UA 3VIFA 4Z2LA 4JL1A 2WMIA 1UD4A 2X2JA 2W5FA 5HNNA 4EK7A 2ZX6A 4LXFA 2VZSA 3PZNA 3CTTA 3WF1A 3O2LA 2Y2WA 1HNYA 3HMCA 4E2OA 3WQ8A 5A6BD 2JEPA 1VBUA 4TVDA 3WDRA 1UUQA 5CGMA 3DYMA 4CD5A 1PAMA 3LMYA 3WQ6A 3PTKA 2WPGA 2VR4A 4ZFMA 1PIGA 1PX3A 1EOMA 3THDA 3GXTA 3VGBA 5CG0A 2OW7A 3ARQA 3ARXA 4AZ7A 3BCFA 1LJYA 1C8XA 1ZS2A 4WKFA 4AZGA 1RP8A 5JUVA 4Z2IA 2ZXAA 4PMXA 3AI0A 3CMJA 3ZR5A 5IFPA 4M8UA 1RH9A 3UERA 2CKSA 1V08A 1UWRA 3PZQA 5BYWA 3GNOA 1C8QA 4AIOA 3PTMA 4UOJA 3MSGA 1BYDA 1BFNA 2O9RA 2J7FA 4M56A 1CEOA 5A6MA 3I3EA 4WKHA 3KLKA 4D1IA 3VM5A 1TR1A 4MB4A 3VD7A 3KZSA 1BTCA 1GVIA 3D4YA 1EQCA 3W6LA 4FNSA 3MV01 4D6CA 4ATWA 4P8UA 2PWFA 3VGGA 3WF2A 1RP9A 5A8MA 3CUJA 5ABEA 1JGIA 3GH5A 2WB5A 3W82A 1G94A 5EMYA 4OIFA 3GXNA 3VIHA 5A6LA 3WH5A 1JFHA 1FP9A 1OT1A 1H41A 4J27A 3S6TA 5GNXA 2QV4A 3WEZA 2WZHA 1JAEA 1JDAA 1U30A 3NDYA 5CZKA 2EPMX 2XVKA 3EJQA 1WKYA 2F1BA 1KTBA 4BS0A 3WD3A 2V3DA 2F18A 1V6VA 1JYWA 2WVVB 3BMWA 2VO5A 1V3KA 4R27A 1WDQA 2F7RA 2FE0A 1O7AA 1C7SA 1W9XA 1HVQA 2CHNA 4UQEA 5BRQA 2YA1A 4GZEA 2BXYA 5DT7A 4JFVA 3W29A 5BXTA 4FLRA 3AHTA 3N13A 4JAWA 3CBWA 2G3NA 5A3HA 3CH9A 2WVTA 3VNZA 4Q7NA 4MTVA 3AYSA 4F9DA 1SR0A 2O9PA 2ZUSA 2F2HA 3OBAA 3BUDA 3DC0A 1E4LA 3MUZ1 1TQWA 4JFTA 3AMKA 3HG4A 4ZE5A 2CIPA 5I24A 4GO8A 4W7UA 5AYBA 4QCFA 3AMLA 2PC8A 3OGSA 2MANA 5A2BA 3CZLA 4FLSA 3S5YA 2J74A 2ZXDA 3OLEA 4DM1A 3DDFA 2IXVA 1UKPA 1TA3A 2WMHA 4M24A 3RDKA 4ACZB 1HTYA 1NWUA 4U31A 2DGAA 2ZX5A 3RJXA 4M81A 5JIWA 2GFTA 3L4TA 2XPKA 3ARYA 2V3EA 3CHDA 1MXDA 1ZJAA 2VZOA 7CGTA 3A4XA 1VRXA 4BF7A 2JF7A 1KB3A 1CGYA 3AFBA 2PI6A 4KWUA 2EO7A 1OD8A 3PBGA 3QHNA 5KEZA 3N04A 3W28A 4MNMA 1CXIA 4OJYA 3AHYA 1OCQA 4X0VA 3BC9A 3DHPA 2J8GA 1GONA 2DH3A 4QLLA 4ML4A 3VIKA 2ZWYA 3NSMA 4CU6A 2J75A 4J3UA 4XB3A 1KWGA 3SUTA 1JI1A 1UWUA 3FAWA 3II1A 2YIHA 4F8XA 2DSWA 5IHRA 1TQSA 4CD6A 3VM7A 3AMCA 1J0JA 1E1EA 4GXPA 4EKJA 3WUGA 4JZ5A 4XZBA 1UASA 4UTFA 4X9YA 2OYLA 4AEFA 5I0DA 3ALFA 3WNKA 2BXZA 3VX0A 5E9AA 1FA2A 4NRSA 5HBFA 3RM8A 1BYBA 4PUEA 3VIOA 2DSKA 2CESA 4GI6A 3GH4A 5GNYA 4PSRA 4NF7A 5I6SA 1FP8A 2VCBA 4QLJA 2J4GA 1K9DA 2VZTA 3T08A 4PUDA 3KWXA 5ABHA 3RMEA 1EDQA 5FOOA 2W91A 4KRUA 3ARVA 2D0HA 1J0KA 1KBKA 1R47A 2XIBA 4B16A 1HX0A 2WK2A 1KTCA 3IJ8A 4LQ1A 3RO8A 2CBUA 3PZMA 2JEQA 3W24A 1XHGA 4TVCA 4D6DA 2XFRA 4ZXLA 1E4NA 5A69A 1B3ZA 1HJWA 1DEDA 2QPSA 3AIEA 1JZ7A 4ZEPA 1ISVA 1IZKA 4YHGA 3BAWA 3FNDA 2V38A 3MSDA 4P8WA 2EBNA 1E72M 2F8QA 4Y7EA 4PMDA 5IXEA 4E4PA 5DF0A 2B31A 2ZUNA 2PWEA 1Q6GA 4TTGA 1GNXA 2XYLA 4U3CA 1TVNA 4MDOA 4C7GA 1E43A 1Q6CA 1W3JA 1V0LA 4EE9A 3UR7A 2XSBA 2GSJA 3BAYA 2HISA 2OSYA 1V03A 5M3WA 3CLWA 2GDUA 3CHCA 3GXPA 3EDFA 4P7RA 1J01A 1DWGM 3WNPA 3AIUA 1E4MM 3AYRA 1MW1A 4FK9A 2XWDA 4PN2A 3VD5A 1HF6A 2QMJA 3T2QA 3WDJA 1UD5A 3BH4A 3WH9A 3CUFA 3L4UA 1UZ1A 3GXFA 1UD8A 2XIIA 3IAQA 2XGBA 1UD2A 5E6ZA 4LYRA 3VIGA 1GJUA 1WDRA 3W26A 1VJZA 4QLKA 5I77A 2J7EA 3G6LA 4PBGA 4W89A 3AISA 1V6UA 1EGZA 4BQ4A 1KGXA 2DEPA 3WBEA 1UR8A 1NARA 3B9EA 3GBEA 1ISYA 1HKJA 4JHZA 4HU0A 5GPRA 4YN5A 1LF1A 3AMGA 2GJRA 3WL1A 2X2IA 4RE4A 1NWRA 5FKYA 2C7FA 3DX0A 2G3IA 1I75A 3TONA 4WKAA 1AQHA 1VBRA 2E9MA 2EPNA 9CGTA 1XSIA 1CIUA 3EDJA 1ODUA 4UZSA 2J8FA 3WD2A 1E73M 2YA0A 3WN6A 3EMZA 2CHOA 4QDMA 2UWFA 3CPUA 1ZBVA 2YOCA 4KH2A 4URIA 3T0BA 4LYQA 4HZ8A 1QI2A 2IUZA 4H41A 1UWTA 3BVXA 4GIAA 1X6LA 1J10A 1DWFM 1V6WA 3CUGA 2G3MA 3W37A 3WF3A 3W0KA 1U2YA 1CNVA 1CGWA 1WZAA 4UNIA 4QCEA 5FCZA 2YBUA 3D51A 2J77A 4AZCB 4MJ2A 4DM2A 3AXIA 4PMVA 1AQ0A 1JZ4A 1H0GA 3D3AA 4JIEA 2YFNA 3VMPA 1ZL1A 1UKQA 5A94A 3CZNA 1QHOA 1XC6A 1DWAM 2XN0A 4HA1A 1QW8A 1TCMA 2X2YA 3WH6A 2V5DA 5D9PA 1LLOA 5JBEA 1E0XA 2WMFA 4NXKA 1J12A 3DYOA 3WFLA 3VO0A 4AYSA 1M53A 2GJXB 4F79A 4UFKA 5BRPA 2DPEA 2DQXA 1BG9A 3W6MA 3BSGA 5A2AA 1GOKA 1OGGA 1E71M 1N82A 3L2LA 3VMOA 3EMQA 3GXMA 4XZWA 3DX3A 2D22A 1PX8A 5IHSA 2XVNA 3A21A 4GQRA 1ZBKA 2TAAA 1JG9A 3OZPA 4BQ5A 1B0IA 1UH2A 2GJXA 1OGBA 3GDBA 5EB8A 1WE5A 1TQTA 4UFJA 1WP6A 5CLTA 4CD8A 1BGGA 3GXDA 3FHAA 4PTXA 1MQQA 2WMJA 2D0GA 1UKTA 1E6SM 1E6QM 5A6AA 3TOPA 3DX1A 4AD5A 4UQAA 1GQJA 3N1AA 3WNOA 2XG9A 5AY7A 1R8LA 3T2OA 1KGWA 4WF7A 2NSXA 4NX0A 3VSVA 3U7VA 2VX4A 3FXYA 3POCA 4MNLA 1HJQA 4HA4A 3ARZA 3D50A 1CBGA 1WZKA 5BXRA 3BUBA 4A3HA 2ZWZA 1JZ3A 1UH4A 3CV5A 4UZUA 1Y7VA 3NJ3A 3WH7A 4KRTA 3WDIA 1GZJA 2FH6A 1EIBA 2E8ZA 1C90A 1EQPA 2XM2A 1HL8A 1BYAA 6TAAA 2AAAA 1H1NA 2D20A 2VX5A 3PZGA 5BROA 3VDHA 1C91A 2UY5A 3A4WA 4NZFA 5D9OA 5JBDA 1GQLA 3WENA 5JIPA 1A47A 4QAWA 1V0MA 3BLKA 4MB3A 2VR5A 3KEHA 1JYNA 1ITCA 3CUHA 3DX2A 1SYTA 3B9DA 3VIMA 1I1XA 7A3HA 1J11A 4PMNA 5JBFA 1VEPA 3E1F1 3WQ4A 3ZJ7A 4OKDA 1EHAA 4V28A 5BXPA 4HMCA 4W88A 2D3LA 1CLXA 1UWQA 2NT1A 3AROA 1QWNA 3VPLA 1P6WA 5A6BA 3TA9A 1E6NA 1O7DC 3N12A 3SEPA 1JD7A 1GHRA 2Q8XA 2VRQA 4CN1A 3LPPA 1FH7A 2DSUA 5CPTA 2WCAA 3BUQA 2A3EA 4BZYA 3MMDA 4D6GA 2WBKA 5GQBA 2J7CA 1PX4A 4M80A 1TG7A 2WLZA 3T09A 1V3JA 2YL5A 2FHCA 4OGZA 3S5ZA 4TXEA 1JZ8A 4AC1X 1EA9C 2ZUUA 1X1NA 3LX9A 4U2ZA 3POHA 4YPJA 4IUGA 3SUVA 4DO4A 1UHVA 2Y8KA 1US2A 2JIEA 3A24A 1V3MA 1QVBA 1B2YA 1EH9A 4LPCA 8A3HA 3K8LA 1K9EA 1KCKA 4ACZA 2ZIDA 1BF2A 1DP0A 2WWDA 4AMWA 3IJ7A 5E0FA 4RL3A 4H04A 1E3ZA 3WMSA 5LA2A 3AZTA 1HP4A 1W1TA 1UR2A 2VJXA 2EADA 1AVAA 1EDTA 2PBOA 2ZUTA 1K6AA 2VUYA 1R85A 4CUCA 2WVVA 5A6JA 1UQZA 3GNPA 3MANA 4Z2HA 3RILA 5HDRA 2QPUA 1E40A 2F7OA 3WD0A 2WC7A 1HL9A 3WH8A 3AXXA 4XX6A 4FNPA 3GM8A 4AW7A 5I23A 3CHEA 1VFMA 4OUEA 2CNCA 1ZBWA 1HJVA 3VILA 1R87A 1UA7A 3PN8A 2WXDM 3WF4A 2VX6A 3AHZA 3WMCA 2FGZA 1B3VA 4PMOA 4CVUA 1E70M 1SZNA 1BHGA 1MQPA 1NP2A 2UY2A 3W53A 3VIJA 3HG3A 1VB9A 2WMGA 2DT0A 3LPFA 3QOKA 1J9YA 3MMWA 3T2PA 5A8QA 3ZT5A 3UETA 1WAWA 4PTWA 4AMCA 2PWGA 1B3YA 2VC9A 3DYPA 1JXJA 2J7HA 5C70A 2DSZA 1QI5A 3SCOA 2BS9A 3DECA 1PZ2A 3O6AA 3PZ9A 4PMQA 3HU7A 5ECUA 2WHLA 3VGEA 2J7GA 1GPFA 1NM9A 4TUFA 2FH8A 1DWHM 2WC3A 1XGZA 1CENA 1E3XA 4GI9A 3MO4A 3LXBA 1EO7A 1UZ4A 1ZU8A 4M1RA 2VMFA 4JFSA 1JIBA 2XGIA 1JFXA 1CLVA 4YHEA 4GZJA 1H49A 2XHYA 4RE2A 3UG3A 2WZEA 3AIBA 3AZSA 4DWSC 4OOUA 2F7PA 4B3KA 2J79A 1PS2A 1DWJM 4KGJA 2YL6A 1H11A 2Z1KA 4BQ3A 4LGXA 1UQYA 1W2PA 1V3IA 4U2YA 1NOUA 3K4AA 3W25A 4JCMA 3SCTA 1G5AA 3WEOA 1E9TA 2CKRA 4AISA 1MFVA 3WKZA 5CPQA 2GK1B 7TAAA 3TTOA 3KL0A 1WDSA 1YHTA 2E3ZA 2Z1SA 1JF5A 2XJ7A 3BAKA 2BVDA 1E56A 2WC4A 3SUSA 2W4XA 4F66A 5LA1A 1BAGA 2EPLX 2FGLA 1JNDA 2IGTA 1QI0A 3BVWA 1B3WA 3RPMA 2WSPA 1HIZA 2D3NA 3EDKA 2WKLA 4NXSA 3VDBA 5E6YA 2ZUWA 2BNJA 3CIVA 3CC1A 2XVLA 4EAMA 1EXPA 3NIYA 3SUWA 3H55A 4FLOA 2Y24A 1OSEA 2X8RA 1BQCA 3AHXA 4PRWA 4C7FA 5A8OA 3WD1A 2E0PA 5D4YA 2WHMA 3ALGA 4ZENA 2NT0A 2W92A 1C3FA 4WSKA 4PTMA 1GQKA 3K8MA 3AICA 3W27A 1JZ2A 1W9DM 1WPCA 5IFTA 3ZO9A 2DIEA 1MW0A 5FIPA 3GXIA 4H8UA 4D1JA 5DT5A 2D23A 3AS2A 1B30A 2WKGA 4QP0A 4W84A 4CD4A 2WW5A 2OYKA 1HI7A 2NW0A 3UG5A 3CUIA 5E09A 3SCQA 3ARUA 4PSPA 1ZB5A 1KXVA 2X2HA 3CMGA 2G4FA 1CXLA 1UH3A 1W3LA 1KCLA 1QPKA 1GOIA 2DT1A 3WUEA 5IDIA 4P7LA 3VUPA 3HN3A 3QHOA 1JZ6A 3BVUA 2E8YA 1OM0A 4HPGA 3WY3A 2X05A 4TTUA 4HMEA 1C93A 4D6FA 1MW3A 2EJ1A 2WANA 1BVZA 4TVUA 3MUIA 3RJYA 2BHYA 2EABA 1EOKA 2BV9A 1B90A 1XRVA 4HMDA 1CGTA 3TP4A 4MAVA 4AZIA 2CCRA 3N9KA 1FFQA 1GVYA 1AQMA 1OIMA 3VINA 1V02E 3TTQA 2BHUA 3MU7A 4XUYA 2YFOA 3VNYA 3VGDA 1MVYA 2JIWA 3UG4A 5LA0A 1WZMA 4AYGA 2WZIA 3CHFA 3RCNA 2CITA 4AIEA 2A3AA 3UR8A 2F1AA 2J47A 1ODZA 3IK2A 1GOMA 2CEQA 1XYFA 1FHLA 1ECEA 2X0HA 1UR4A 3WIJA 4AZHA 3PHAA 1TZ7A 2WAGA 1R34A 2ZX9A 2E9LA 1KXTA 3NSNA 1ITXA 1H2JA 4PCTA 5EFDA 3M46A 5DO8A 2WMKA 2CYGA 1E0WA 1V6YA 3WY1A 5BCAA 3IANA 2XVGA 4AY1A 2ALWA 1XH2A 3ZQ9A 3VD4A 2A3HA 3LXAA 3K46A 2J62A 1OT2A 1QNQA 4OBSA 3FW6A 4W8BA 1QWUA 3BGAA 1KFWA 2V3FA 4MNJA 1KXHA 5I3DA 1QW9A 4UOQA 2VT0A 3ZJ6A 1CXKA 1KXQA 2E4TA 3TV8A 4QFUA 2YLLA 3M6DA 4CD7A 4GI8A 3OGVA 5HPCA 3NDZA 2OSXA 4P8VA 3I3BA 2JALA 1QI3A 2PF0A 2ZOXA 5ABFA 3FN9A 3RIKA 3LRLA 2O9TA 1W1PA 3ZR6A 4P7NA 4E8DA 1FH9A 2VQTA 2VNCA 2XM1A 1CWYA 4BA0A 3U5UA 2XN1A 3H54A 3EJTA 4UQ9A 1NOFA 3PZIA 1KR0A 4D71A 4LYPA 4D6EA 3THCA 1ISXA 2WCSA 5M17A 4A3YA 4W85A 1TQVA 1NWSA 5DMYA 1ZJBA 4DO5A 1JAKA 3EMCA 3ZM8A 1CECA 3MKKA 3EYPA 3EJPA 4AWEA 3WF0A 1HN1A 1E6XM 3ZJKA 1B3XA 2QLYA 3ZJ8A 1V6XA 2VX7A 3WY4A 2AOSA 3GNRA 1H4PA 2BFGA 3CZJA 5CLWA 2BVTA 2PWDA 1E0VA 2OLHA 3CO4A 2QF8A 1E6RA 2ZX8A 4B9ZA 1IT0A 1J0IA 3VGHA 3WELA 4AD4A 3AHVA 2E40A 2OWXA 1US3A 1FH8A 4F9JA 3LXCA 2ZICA 3W38A 1QOXA 1F4AA 4WSJA 2OW6A 2W66A 3OLGA 3ZOAA 1W9PA 1TFVA 3OG2A 5C71A 1Q4NX 1CTNA 2WM0A 4HA3A 1LQ0A 1MW2A 1QHZA 3F5JA 3A23A 4P7QA 1KQYA 1W91A 3AIRA 3CZGA 1HKMA 3T0DA 4GKLA 3CZKA 1AMYA 1MFUA 1R33A 4XV0A 4OZOA 3W81A 4ZE4A 2D1ZA 1HWWA 3D52A 2E9BA 1WNOA 3WBAA 3WNLA 4NZJA 3AJ7A 2FDMA 1D7FA 3VIPA 4PMUA 1PPIA 5CQ1A 1G9HA 4MDPA 2VURA 4GPNA 4P8XA 4D6IA 5LYRA 4CCCA 4UR9A 4NI3A 2DIJA 5EBAA 4DWSA 1GOOA 1DHKA 1CZ1A 2C0HA 3VX1A 1R46A 3WUFA 2VI0A 2XTKA 1G1YA 3SCSA 2JF6A 2ZUVA 3EJRA 3D5HA 4HZ6A 1CXHA 2VZVA 1JYXA 4IPLA 5DFAA 1PE31 1OINA 1W1YA 1W3KA 3EJUA 1R86A 3CZSA 1EO5A 2ZX7A 5FL1A 1VEOA 2EAEA 3AMDA 3WMBA 4W8LA 1CYGA 1ISWA 2Y5EA 1PCPA 5BXSA 1JDCA 2PB1A 3PZOA 2WLYA 4J3VA 2QHAA 2GVYA 1GORA 1W9BM 1OBAA 1BGAA 3WNNA 3APGA 4BCEA 4AZ6A 3DX4A 3KE0A 1GUVA 1BSIA 5FL0A 1NQ6A 4J3XA 1Q6FA 1HXJA 1Q6DA 1JZ5A 3VTRA 4HOWA 2DDXA 1KGUA 1GOWA 2PSPA 3GBDA 2WVUA 5E70A 5FD0A 1J18A 4Z2KA 1M04A 1G0CA 3AIWA 1J0HA 4UQCA 4UFLA 4PYSA 1QNSA 3BAXA 1HJUA 3VD3A 4R5EA 1O6IA 1LL7A 4N42A 4C7DA 3OB8A 3MUY1 2J78A 4W8AA 3MI6A 3CGTA 4HPHA 3SCRA 1OGSA 4X0NA 2D24A 1H0IA 1W9VA 3SCPA 1E15A 2G41A 5A6KA 2XVPA 4H8HA 2O9OA 3F5LA 2XSAA 2JE8A 1TE1A 2UY3A 4IISA 3QHMA 3ARWA 2DSVA 1V0NA 2ZXQA 1XSKA 1W32A 1JD9A 2YBTA 4NSBA 4PCSA 3OA5A 4JCLA 5KZ6A 3HZ3A 5BWFA 4FNUA 4JKKA 3IGUA 4UQDA 2CBIA 3AS0A 3WDHA 3AS3A 4W5ZA 3WQVA 3VOCA 4K68A 4UFHA 1F4HA 1QHPA 1UD3A 1VF8A 4TX8A 3WNMA 3N11A 2CBVA 4GINA 2ZXBA 4CVWA 1E5NA 1VEMA 2ESCA 1EHNA 3LRMA 5AC4A 1BLIA 1I1WA 4J3WA 2UY4A 5EFFA 2WBGA 2BY2A 5D9MA 6A3HA 1NOWA 3VDCA 4D6JA 4WK9A 5CSUA 2X1IA 4PEEA 1UR9A 4JKLA 3ZT7A 1XCWA 4WJXA 2BHZA 1LWHA 4JHOA 3WQWA 2OWWA 4B9YA 2EEXA 4Q22A 5HXMA 2GK1A 2W63A 3WL0A 1E55A 4B15A 1HKIA 3GZAA 4JFUA 4FNTA 2FHBA 3BVVA 3BUPA 1V02A 3RM4A 4IPNB 3TTSA 3L4VA 2XWEA 2VTFA 3N18A 4D72A 4J28A 2F7QA 3WY2A 2YL8A 1JDDA 4Z2GA 1EDGA 2VVSA 4WLCA 4MPKA 2Y4SA 1WZLA 4L4PA 4NRRA 1YQ2A 3TTYA 2HVMA 3A47A 2OSWA 3ARTA 2DT2A 4P7OA 3ECQA 2PBGA 3L4ZA 3N17A 1FFRA 5TD4A 5I2UA 3GYCA 2C8NA 3M7SA 1WO2A 4FNRA 1QNOA 3SURA 2YDRA 2F61A 3PZTA 4CN4A 4ZXOA 3WQ5A 8CGTA 2EQDA 3EDEA 4TOQA 4DUVA 3BAIA 3PZVA 5DEZA 2WSKA 2WVSA 1Z32X 1JF6A 5M5DA 4H2CA 3VU2A 3BCDA 3KLLA 4WIWA 2FYVA 1E4IA 4NZCA 1Q6EA 1R7OA 3SCUA 1TA3B 1HXKA 3L2MA 3CZEA 3AOFA 4GZIA 1NWTA 1XH1A 2VL4A 4HZ7A 2A3BA 3EBVA 3U7BA 1JYVA 3F4VA 2EACA 3ZMRA 3AS1A 3NSXA 1W3HA 1C92A 3KL5A 4UQBA 1M7XA 4HP5A 4U33A 1HVXA 2CERA 4E8CA 3UESA 4MAZA 4ACYA 2GUYA 3VMNA 3T0AA 5A8NA 1BVNP 5A8PA 1HKKA 2CXGA 4S3KA 5CPSA 4H7VA 5A1AA 3WD4A 4V27A 3QOMA 1NH6A 1VFFA 5ABGA 5A95A 2D0FA 4AD1A 1BG4A 1SMAA 1JL8A 1UR1A 2QMKA 1DTUA 3RM9A 1BYCA 1XYZA 2EPKX 2X0YA 4AD2A 1E6ZA 4MNKA 1GOQA 1WB0A 4W86A 5CJ5A 3WFZA 2ZE0A 2BY1A 3BLBA 3AQUA 4PMYA 4UCFA 2EXOA 2WMIB 1PZ3A 3ARSA 1W9UA 1KR1A 4TX6A 1TUXA 4JKMA 4PTVA 3W4RA 3OZOA 1UKSA 3LPOA 3K4DA 2CBJA 1MWOA 4AD0A 3VIIA 5AC5A 1VIWA 4AMXA 2JFEX 1TMQA 3BAJA 1L8NA 1CGXA 1XH0A 3A6OA 2XUCA 2W62A 1R75A 5E1QA 1QX1A 1VJSA 1XD1A 1GQIA 2J7BA 2WCGA 1KBBA 3ARPA 3H53A 3GH7A 1MXGA 1QNPA 4AD3A 2W61A 4B3LA 2J25A 4A4AA 4AXNA 1L0PA 4M29A 2YA2A 2ZUMA 2RGLA 1QBBA 1B1YA 4S3JA 4FLQA 4HOZA 4AIUA 3WEMA 1MYRA 5CSYA 1OIFA 3SIMA 2GDVA 3LRKA 2PWHA 1WCGA 3AIVA 1A3HA 4AZ5A 2OWCA 1XCXA 1K9FA 4U3AA 1E6PA 1UOKA 1UYQA 3L4WA 2BY3A 5A2CA 4M82A
chains in the Genus database with same CATH superfamily
4PTTB 3RB5A 2FNBA 3T0EB 1TXKA 3VI4A 1LMKA 1YNKH 2NR6D 3PG2A 1BVOA 2QADD 3C08L 4U4BA 3B0VC 2XRAL 3QFJD 2DTML 1FQ0A 3AUOA 4X9SA 5ISZD 3RCMA 2I16A 2DM3A 4INFA 3MJ8A 4PB0H 3RWIB 4X4ME 2K6ZA 3LNGA 3OG6B 4L1HA 4ZUVB 3T2LA 1DWIM 1G1OA 5KG9B 1VHCA 1IGTA 2P5EB 1Q94A 1G01A 4WOZA 2VEKA 1LM1A 5SWZD 3VA6A 4MNQB 1WDWA 4HA4A 4BJHA 3VKKA 3LU2A 4OTXH 1RU9H 5HDOA 4WKXA 2VDRB 3WXWH 5B8CB 1UKOA 1VQTA 1FWDC 3GSXB 2R56L 4RDZA 3IDXH 4EANA 3MROA 3U4BL 5AHMA 3M17A 2NY4C 3NTYA 3CZ8A 3C2YA 5DQ9A 1FVDA 1O9ZA 4KK6D 5IHUH 1EGMA 2BXVA 3WTXA 2A73A 2GSEA 5EU6D 3UTTE 4ZTEA 4CBPA 4ZAKA 2PW2A 2VXQL 2W65A 2OMAA 3AZRA 5AKQA 4F7EB 5BW7A 4Z6AT 3MMUA 3LEVH 5IB3B 3VVGA 1Z9MA 3JWNE 3QIWD 3OQ3B 5EV7A 2KMWA 3RDTB 4APQD 3CAVA 2J66A 3PHSA 3FQNB 3QO1A 3TLRA 1A6VL 4UNVA 1HUVA 3ULUF 1DPMA 4KMQA 4FX6M 1IFRA 3GJFK 4FFZA 4FQHA 1XR9A 4LLUB 4QHMB 5D1QE 5DZJA 1P1MA 3IV8A 4O57A 3V5DA 3V0TA 4O18A 5CPNA 1RALA 1AR1B 2OOGA 3QV6A 2ADGA 2VO8A 1AO7D 3PWJA 1FCCA 2XCMC 2AGJL 2OK0H 5HJGA 2ENQA 1CGVA 3OF6A 1J05A 3K72A 2BLEA 3EDDA 4L0PB 3MI3A 3UXAA 4A2SA 4AQZA 2YL9A 1G1CA 4WVRA 1B9ZA 1F42A 4B60A 1U5VA 3L3HB 4Y4HC 9RUBA 3RPKA 4RWHA 3QGVA 3I3DA 3LV5A 4NKDA 1CXFA 1R0AL 3PP3K 4Y4FC 5IKCB 3CUXA 3A5VA 3DX6A 4R4BA 1SFSA 2V2CA 1MLCA 4OGQC 1AZVA 3VH8A 2G3JA 3EX1A 3PAYA 3C5ZB 4TX9A 3UCRA 4YHKL 2QHRL 5CFHA 2FEDD 3NUKA 5DQ9B 2N3JA 4A39A 2HSAA 1NOAA 1CFTA 3PPGA 3CASA 4XNQA 2BVQB 1IE7C 4ZFFA 1Q9OB 1H7NA 1W72B 3RBGA 1N6QL 4GXVH 1EC9A 2ICEC 4ATLA 3MLRL 4L1XA 4MKSA 4XZLX 3RJOA 5BUPA 4LLYA 4PRDB 3DKHA 3CPLA 1IV8A 4LVHB 1PDKB 1XGTB 3GHBL 3T2NH 3PZUA 5F9JA 4UANA 2RDTA 3EWXA 3G1YA 1RHFA 2ID5A 4IRZH 4O2EA 4FQCH 4OU1A 2VLJA 4KQ3H 4D8OA 3O2DL 2I17A 4C1LA 3NH7L 2PCPB 3OR6B 5MEOB 1X6NA 3DI0A 1MNNA 1N67A 4NEHB 2POZA 4KKNA 5EZLA 1LUCB 2NQZA 4GKSB 1A7PH 4N8UA 1R5WB 1PS3A 3K6OA 3SN6N 1NFGA 1E9OB 5CSGA 1SJCA 5IBUB 5E8NB 1TJHH 3EOAA 4LSDA 1K9TA 1TWSA 3M0YA 4W87A 5HNTA 3WHE0 2R1XB 2ZYSA 5CLYA 3VKAA 4PJ7F 1H1ZA 4PS7A 3UEQA 5F2MA 3G9VA 4RRPA 1JCJA 4K2SA 3IXAB 4G42B 1H5BA 4TUJA 5D55A 4HUXB 4GOAA 1SHXA 3O2DH 4N4PA 4OZFA 4ELME 5LCVA 2G9HA 1QPXA 3OIHA 4O4VA 3K2UL 2L7QA 4B5ZA 3FSOA 2CSPA 2RR3A 3IDGB 3QW4B 5E7BA 3LCLA 4YCOA 4WXYA 3KR3L 4XOBA 4BEUA 1ZRUA 5CXPA 4MGXA 4E2BA 1L9PA 2GABA 3C5ZA 1TO4A 3LNIA 4LEFA 4MQ7B 5E8DH 4H1ZA 4I48B 5EUOA 5DMGC 5FF3A 4IRJD 3VD9A 2J12B 1NDGA 1OQXA 3DUUB 4CN6A 5J1TC 4F0HA 2KX9A 32C2B 3UP6A 4IRSC 4ONFL 4Q4QA 4P4RB 1Z44A 3ARDA 2A3CA 3L67A 1E1FA 3CSFA 4WZ9A 2BIIA 1QNRA 2IPKB 3NXFA 3BLFA 4Y0GA 2ATPA 4OZHA 2Z92B 4X7CC 1R9ZA 2FIQA 1P7QA 1XSJA 1CX9A 4C6QA 1QO2A 2GGGA 1NC4D 3BGFB 4RPQA 1TPXB 5DZLA 2CPUA 3LS9A 5EDSA 3V18A 2DJUA 4XBEH 2X4PA 3MPGA 4XNYL 3FYOA 3SY0B 1FDZA 2B15A 2QQLH 2B9BA 2BH0A 3UFIA 4MQ7A 1MQRA 2V5CA 3DUGA 1OGPA 3GAYA 3HFYA 1MG2C 4DJFC 4AMAA 1HEZB 5I8CB 4PGBB 1V3LA 2X9WA 3BLPX 3G6DH 4GUIA 4PUBH 3O3EB 3FCGA 4CILA 4ZX4A 2AXFB 3MXWL 4WHCA 5EEUA 1R3HA 2WYHA 3D4ZA 2VQUA 3BUYA 3O11B 1GTHA 5KZMA 2Y1VA 1NP0A 3BSHA 1LBLA 3V4VA 1WHPA 2XFYA 3ITGA 4NC1C 5I79A 3H4WA 1KACB 4G9DB 2ZSVA 3F7JA 2JKIS 1NDWA 3U7WH 2GAZA 1HJSA 1A6VH 2H2PC 4S2SB 3T1FB 3ZSTA 2E56A 3R0UA 3H3KA 4CCEA 2QGEA 4OZFB 1XF5A 4N90E 3BUIA 3B9OA 3IRZA 3GU2A 3B5GA 1CDGA 1G7HA 3ORJA 3LPGA 4RH4A 3FAXA 5FYLE 3HAEH 1FX6A 4U7KA 3ZT6A 1ML1A 2W6RA 5IGXL 3TEYA 2EAWA 3PJUA 3QFWA 4RNIA 4X6DF 1IE4A 2LU4A 3D85B 4WNJA 4PMZA 4EN3D 3BPWA 5DN1A 1KBIA 1RURH 3WE6A 1YPXA 4DJFA 3CFKA 5FHAL 4BZ2L 4F57H 1UC5A 4XI5C 4G7EA 4MQTB 2JK2A 1F73A 4H19A 4YHPB 1A53A 1S46A 5LHFA 3PAJA 3BMVA 1UZ8B 4Q8BA 1E65A 5F89A 3AXHA 5I5RA 3HPFA 4FQQA 3NNTA 3ZIZA 3KPPA 1JR1A 2V3GA 3GLAA 2ATPB 3IRSA 3LV6A 3TWBA 4ZB2A 3HE6D 3PP4H 1PIFA 5CD3B 2MQ0A 4MNGA 1H3WM 4WVXA 4N26A 5BO1H 1LO2H 2WHKA 5KSWA 3Q8CA 1PYWB 2HBVA 3O4LA 3SE9L 3VFNB 2VZUA 3Q2DA 4Y5YA 1MEWA 4IP7A 2REQA 3JZUA 1XXDC 1HJXA 1BF5A 3NEVA 1RD6A 4BZ1H 3PWPD 1RIHH 1YTDA 3BP5A 3L13A 3FCPA 3GG0A 4X9HA 3HB3D 3PE9A 4PGBA 2ASHA 4X6BB 3MVSA 4QSFA 4OY9A 6REQA 1UXMA 2MQ3A 4JZOA 5EU6A 3ZR4A 3LBMA 2R2BA 4J3SA 5ALCL 2Y7QB 1R3SA 3S88L 2OZ3A 1IC7H 3INPA 4JDBA 4J8QA 1U3HD 3CDZA 3PP4L 3QJOA 4N2NA 2VVNA 5GZNA 1JRBA 3WIFA 3ULVL 1NLDL 1F3TA 5KUMA 3TU6A 3TEUA 1HKWA 1V8EA 3VFNA 1PEZA 1LMIA 2X1WL 2WWMD 4HXAL 5DJCB 2X4SB 5SX5K 3QQDA 4F2BA 3STZA 1MRCH 4HWZA 4J39A 3G5XA 4G5ZH 3WIHA 3ZTJH 1I1AB 4HOXA 1I7RA 3VIFA 3EX4A 3B9KD 3BP5B 1XTMA 2N7BA 1FXPA 4JIRA 4NDMB 4YJ5A 3W7KA 4X6BA 3L9EA 3CSBA 3TYAA 3NK4A 5KITA 1IB5A 2XA8L 4UBDD 3OVQA 5KBLA 4M3HA 4ZT1A 1RLBA 2FK9A 3QEUB 4FCHA 3HMCA 4E2OA 1CTOA 4Q8PA 4ICCX 1AO7A 1ED3B 5HJYA 1NGXB 1IC5H 3MGTA 4MMZC 3IJ6A 5JPMC 4H6KA 3EOEA 3BD5A 5ANHA 1NLDH 2A2QT 1PE1A 1TNMA 4OLVL 4OLEA 2EVHA 1IGMH 3LNEA 4I0CC 4CD5A 1MIML 1UB6A 3GB7A 3C12A 5D5MF 3TIMA 3WQ6A 3L12A 4WFHD 2FIKA 2G0WA 2AITA 2OL3A 1JFQH 4ZFMA 5I5MA 3Q44A 4L4MA 5TTRA 1WITA 3NDYE 1MCCA 1FY6A 1Q45A 1U8LB 5H4YA 3X3GH 3GXTA 1K3UA 3Q01A 3ZLGA 4HV8B 4KNUA 5CCJA 2GCYB 3SCTA 3D25B 4DAGL 3HI5H 4JFXB 2UUDK 1SZFA 2G9KA 4OV5B 3GZKA 3QYMA 2J6VA 3OJ2C 4U1LB 4FB7A 2XJLA 4UTBL 3SRFA 1I7TA 4ZXBA 4PJXE 1HH9A 1SN0A 2PXYA 2Y7QA 1KJ2A 1JPTH 3MBEB 3NFSL 2R1KA 1FVCA 4B4HA 4IOFD 5EZJA 4ZMTA 1X98A 1G7JA 2Z6JA 1NMAH 1OTSC 5C0RL 3UZYA 1ROCA 4NP7A 5FHBH 3ZR5A 3H9HA 4GT7A 4OZ4A 1O6TA 2ZT9C 4NQCB 2WJFA 3FFSA 1JPMA 5DRWA 4ODHL 4NI6A 3HZMA 3UERA 1KYAA 1O7DE 2CKSA 1KY6A 1Q9KA 1V08A 1AXIB 1I1AA 3PWLA 3Q2LA 3QDJD 2G4JA 1TJRA 3S83A 1C8QA 1TTGA 4NDMA 1TU2B 4RBPH 2PDIA 3ZDWA 5D96C 1T3FB 4A6YA 3PV6A 4YR6B 4O1FA 2H8PB 4PTTA 4XWGL 5AOKA 2FWUA 3ABKB 1HH9B 4ASTA 3NH7H 4D0CA 2FATH 3T42A 3FTZA 3N2CA 3LHWA 2V9UA 4M56A 4ZMOA 5ILTH 1CEOA 4MXWH 4JRXB 4Z77B 3KLKA 4EIZC 2WQ8A 4L4VA 5FFOA 2ADYA 1XI3A 3BP4B 1C08B 3QWRD 2UZ9A 4K9JA 3TO4C 1NGYB 1X5JA 1GVIA 2FIKB 3D4YA 4XN2A 5F8RC 3VFSA 3HNTH 3U2SB 1EQCA 3QUMH 4ORGB 1SXZA 5HPMB 2NQ5A 2Y7NA 3VOJA 4HK3J 3JVGC 1TPFA 1MI5D 2K0RA 4DVRL 4MYWB 3M17B 3C2SA 1CURA 1DJXA 4RAUB 2RQ8A 2ENSA 1JGIA 25C8L 4JHAL 5C6MA 5ABEA 1OAXL 1QBMH 3S3CB 1SVDA 2EZ0D 3GS4A 1BWVA 3S6CA 2FO4B 2VFEA 5G1MA 1U8HA 2HKHL 2D4FA 2FYYA 3IGAB 1R3VA 2RDUA 2QVIA 4HG4J 3WH5A 1JFHA 3QORD 3WD5H 1JZDC 4V2CB 4M93B 5GS1B 1S2WA 4LUJA 3EWWA 3UPMA 1S9XA 1TMLA 3GTFA 4LASL 1I1RA 3TN0C 5HMEA 1AP2B 1FG9C 3EJJX 2OZTA 3MRNB 4ZFOL 4YNYA 4DJDD 5AVYB 3CDCA 1RBOB 5GNXA 5I03A 1G7PB 2HTLC 2QV4A 3DC8A 5DJ0B 1LRTA 2WZHA 5L9DH 1OE2A 4F93B 2QR0A 4AX3A 4YHML 5FYLD 6FABL 3LCGA 1EXGA 3O6YX 1X9UA 4GW4B 3FA4A 1IIIA 3V5KA 1TVLA 5CILL 3D18A 3EW3B 3ZE2E 1A0DA 1AUSL 1Z69A 3J8F7 2A3TA 1WKYA 1ZZMA 3MLRH 1RBAA 3MJ6A 5TBOA 4KY2A 4X4MA 2F1BA 1C5CH 1KTBA 4L5FH 3UGVA 1CK0L 3WD3A 3NFPB 4ENZA 2AZAA 2CG9X 5IMOB 4XVEA 3G5EA 1AZRA 3U79A 1PG7H 3HMXH 4IRZL 3ZLQC 4QXUL 3PF2A 4JRXA 3FKKA 5AKSA 3AU1A 3U4BH 3P77B 3PGCA 4GSXA 1NIEA 1Q9WB 4Y9EA 1XRTA 2WV8A 3MLZL 4R27A 4Q8TA 5D03A 2FE0A 1TIWA 5LKYA 2F54D 3LKPB 1C7SA 1IBBA 2CHNA 1NUFA 1ZJHA 2H8ZA 1OFEA 2AGKA 2BVOB 1KIPA 1MZHA 3IJHA 5D33A 5FM5O 3UTTA 3SE6A 1F00I 2P5EE 1XCQB 1H7WA 2A7NA 5DT7A 4XPGH 1W5QA 3TSDA 4IU3B 1R24B 1Z41A 4JFVA 1E9ZB 3PJWA 2LHAA 4XHJC 3BPCA 3PJNA 4BK4A 4MVBC 1TJ2A 5HY9A 3EKLA 3N1PC 4OTXL 3KPMB 4N6QA 5E94B 2PAJA 1VYRA 3IE4A 5LDSA 2FO4A 3AG3B 4HZAA 3IGAA 4F9DA 1RZJC 2R2CA 6TIMA 4POZD 3TZNA 3BUDA 4RFNB 3NYZA 5JPNB 1E4LA 2FVMA 2QUMA 4I8YA 2J43A 3VI2A 5DZVA 4Q89A 4X5LA 5I18L 2VGLM 3HG4A 4Y2WA 4OVVA 4IMCA 3VAVA 5CSSA 3TBVB 4DT2A 1NIDA 1ZLSL 2J55A 3D0AA 3UPRA 1SOKA 2JV6A 3QAZB 4M6MH 4XZ4A 1UC4A 3OGSA 1ORQB 2ODIA 1IGWA 5IB4A 3CHQA 5A2BA 3O2WH 4OCXL 4DP8X 4UR8A 4QO1B 2HKAA 3QJHA 1FNEA 4R7LA 2YBVA 2HVNA 3FUKA 1IC1A 4Z7VE 1SO6A 3TNNA 4DM1A 4N28A 4Q8NA 3ZS4A 2EUXA 1VFTA 4PJ7A 1IEIA 4XPTL 3NQCA 1R3QA 2VDKB 4CVXB 2I14A 3QWOA 4ABUA 4M24A 3NL2A 5AYYA 3QNXA 3TN4A 4ACZB 1P84K 3QXDB 2QCLA 2OX5A 2HKFL 1NWUA 4JGUA 5IREA 4HJ0C 4U31A 1LQ2A 2DGAA 2PDHA 4XP4H 2PSNA 4HPXA 2Y5TA 2WPBA 1W72H 2UV3A 3WS6A 2BFVH 5JIWA 5AD0B 1I82A 2YUXA 3L4TA 4HWBL 5LNEA 3FN3A 2V3EA 5L2KA 3A13A 1DVSA 2H2SD 5MHBA 2NY0D 1QLEB 1R5IB 1NCHA 4ZPTB 3UXKA 1NKOA 1AQFA 2R1WB 4LPTA 4Y4FA 4PJBF 4ICNA 2DQHL 1WT5C 1X3DA 3TV3L 3CNYA 4NYUA 5DZPA 4X6FB 2CUMA 5IBLC 4GNJA 4WEEA 1IARB 1N3NA 1A5MC 1T5WB 1WGVA 1A5FH 1EUAA 1ZHNB 4K8EA 5I73C 5JR1L 3GRWH 3AFBA 1WWAX 2FX9H 3NJIA 1KULA 4HYRA 1X5ZA 1KIQB 5AW0B 4AK1A 5KEZA 1ADDA 1SXBA 3L3KA 3P30H 5I19L 4WY0A 2B0SH 1OYCA 2IPKA 2YCKX 1DZBA 1HCVA 1S2UA 1P7QB 1TITA 3KJ6L 2OTUB 3I75A 2VLKD 4J2XA 1YRKA 4GYKA 4MNMA 4X7TA 1CXIA 4K55A 4OJYA 4ZNCD 4X0VA 3TBSB 3BC9A 3AT9A 4KKRA 4WQ6A 1T0MA 5FF0A 3B9KC 5AWNH 5TIMA 2CDEB 2ZWYA 4XXDA 2MHAA 1SUJA 2CIKB 4LSPL 1NEZG 5GHWH 2CDGA 4LF3A 3ZO0A 4B4FA 1UWUA 4M7ZB 2V2WB 4KROD 3HCVB 5I1DB 1OOWA 2XWJA 1XGEA 3I6EA 1XIDA 4KIRA 1A4KA 5EC2A 1RHHB 2G0LA 4MDJB 4XMLL 5GRWA 3VKJA 4QAIA 2DSWA 3HNVL 2FZBA 2VHLA 2XPZA 4EKJA 1T2QH 3NQBA 4GXPA 5MF5A 1F3RB 1QATA 1RVFH 4XZUB 1S8DB 3ARFA 4Q6IA 4K5NA 3QS2A 2ZZ7A 4XZBA 5AVNA 3U8GA 3TVMC 4S3DA 2OYLA 5I0DA 3F4WA 1B88A 4RMUA 1WCQA 2W9DL 4S2SA 4YSRA 3T1FA 3A9IA 4G6CA 5I02A 1XF5B 2CDEA 1U8JB 1YUHA 4ADJA 4ERSH 4APXB 5HD8C 2I7GA 2NX9A 3ABOA 1R30A 3AC0A 3MROB 4FG0A 4KZ0A 1B3OA 1FA2A 1FWJC 4L3CB 3HC2A 5ECGA 1JMZA 1A7OH 1YC7A 1BYBA 3TEWA 1ENUA 3LNFA 1PU0A 1FLTX 1VACB 1PZDA 4L5FL 4MMXB 4PJ8B 5DUJA 2OXHA 3PXLA 3SGUA 4KRPC 1GG1A 4HZLB 3GH4A 1KM1A 4PSRA 4NF7A 4G6ML 1QXLA 5I6SA 3O6LL 1NAML 3RWCB 4PJCF 3HS0A 1E1CA 4HJUA 3R89A 1F9CA 3OF6D 2VZTA 1J5DA 3I4EA 3MKVA 2YD7A 4PUDA 4DVBB 1U95A 3B0PA 1FNGB 4XMVA 1NDMB 1OVZA 2QIIA 4P9HH 3ZE0B 4KDTC 1SHMA 4B95C 3V0AC 2IPTL 4L3CA 4ZMVA 2VSKB 3IN0A 2QXWA 4DEWA 1LO3H 2B4CL 4G9FE 1IAMA 3R4DA 4S3FA 2WK2A 1EFZA 3TYDA 1FNSH 4O11A 5LXEA 4AZ8A 1KTCA 4AU0A 4YXGA 3IJ8A 1MI5A 4LQ1A 1IBYA 1N18A 4DP6X 2CBUA 2PCFB 4GKOA 5T5FH 1RZGB 2CR3A 3DIVA 4HZLA 2F53D 4D6DA 4TLSA 4LVHC 4YFEA 2XFRA 4A35A 3IDMB 2XACC 3QO0A 1E4NA 5FEPA 2XIMA 2FLIA 4YSOA 1JZGA 2YSSB 1RY0A 3TBTB 1JZ7A 1MO0A 5J12B 2YXMA 4NRXB 1W5NA 3QI9A 2NY0B 1ISVA 3GDLA 1SJEA 4LRIA 1MHCB 2NRDA 3IFPB 4TQEH 3CE1A 2YRZA 3BAWA 4GP8B 3FNDA 2A6JB 1RUQH 1KM4A 3FA5A 4PZVA 2OGJA 2FIRT 2PTZA 3TN5A 3UWZA 4P8WA 1VSCA 1B6DA 1G6RB 3H85A 3SD5A 3VH8B 5IXEA 2BNRE 4E4PA 2YARA 1XZWA 2WWNA 3EYUL 5F7EH 4NQDD 1LEIB 3PB2A 3EUDA 2BP5M 3UO1L 4TTGA 2CZNA 5DCDA 3T0EC 3UBHA 4FAAB 4ZB0A 4KUCF 4U3CA 3WN5C 3BJFA 5CPOA 5JDSA 4K94C 3VG0H 1NBZA 4HSNA 1POJA 2DKUA 2EDHA 4B9KC 3DHJA 4A2MA 5MENB 2NNFA 3PULA 2XSBA 1BXBA 4QYOB 5HDBE 5BO1L 4GHRA 4UQ3B 3OG3A 4G6FD 5M3WA 3AQYA 1NELA 1V03A 3V0WL 2O1AA 3ZDZF 4C59B 1V7NL 3CHCA 2ENYA 4XB8A 4P7RA 2A6JA 3WS6C 4C83A 2UVEA 2XG4B 4DKDC 4PI2A 3ME3A 5DMGD 1WHOA 3CQKA 4C6JA 2DQJH 2E47A 3GK8H 5AYUH 3QEGH 1KCUL 3FRPB 3VD5A 2H7WA 4AVHA 3D46A 4MNHA 3M8OH 5DT1L 5IHBA 3UEZA 4AIXA 4K23H 1LE5A 3ZYJA 1VYPX 1V93A 1MI5B 3P2VA 4HV8A 5F1KC 3E6HA 1MCSA 3BH4A 1MWAB 1BYNA 1HHIB 3L4UA 3BPNB 2WQSA 4UYPA 3AWEA 1T22A 1M6OB 2OMVA 4F7EA 2MOVA 1EGJL 3IAQA 1I1FA 5E8EA 4Z7WB 2IPUK 3P0VH 4YFLF 3RI5K 4R8WL 5FC9A 1OK8A 3GIQA 2CK2A 5D7IA 1MFEH 4FJYA 3UYPA 1EZVY 5E6ZA 1J8KA 3PS6A 3HRZB 4KQ4L 1W0MA 2YQ2A 2VR3A 3R7QA 5DUPL 3BZ4B 3H9SE 5DMIL 1LQAA 1WDRA 2J88A 4M7KH 4AGOA 4GYPC 1IT8A 4QLKA 3W22A 3T0EE 3G6LA 3AISA 1EGZA 3P54A 5FDWB 4IGBB 3T8XA 4YHNB 3E6HB 2V5KA 5ILTL 3B9EA 1IC5L 1UR8A 4ZS7H 3F7RA 1KGYE 2DKMA 4FRWA 3HE7D 4KXZH 1R3RA 1PB0A 4N9BA 1MCWM 4PUUA 4YN5A 3B06A 3NAVA 3HZKA 3G24A 1BQSA 1VERA 2EXWD 1W0YT 4X7FC 3ABGA 1F02I 3S34L 1KV8A 1X8CA 4LAJH 3HVNA 1MQKH 3LHTA 1Q9LA 2X2IA 2FQFA 3ZMEA 1IYXA 3GE7A 4KIEA 2C7FA 1XLMA 1TZGH 3U6XA 2IQ9L 3MV9D 3GC5A 4WKAA 1AQHA 3CDGA 3MRIA 3B0YA 1FL5A 1VZHA 2Z3FA 1WQVT 4OCMC 3GYEA 1KOAA 2QJNA 5HGHA 4OI9A 1XSIA 4HFUL 4IGBA 3LKOB 3G8EA 5LN4A 4L8SA 3FTGA 3L9BA 4LIQE 5D2LA 1IGML 4HK0B 2A3LA 3PWIA 3EMZA 2CHOA 3FGCA 4PJ7E 4GX8A 3GS7A 5EPMB 2YOCA 4OTKA 4ZAKD 3GFZA 3EHBD 3LRSA 1R3HB 4HZ8A 2HLEB 2JCCA 1ZSDB 1QR1A 4H41A 2GOKA 5EU5A 3HE6C 4LCIL 1THCA 4PWIA 3VYPA 2XDFA 3P74A 3KS0H 1WX0A 3NSCA 3GMNB 2ZKWA 3MRGB 1G4RA 3HS0C 3MV9B 2VDQL 4MMYB 3UYRH 1EPVA 3LSOA 4QDWA 3A6CL 3BLEA 1NCWH 1X6LA 1J10A 4BFEA 3M9YA 1Q6LA 4Q4IA 2XH0A 5ENLA 4DPQA 1G9ML 3O3BB 5FGCE 1RHCA 3IFLH 2R29A 4HCRA 1U2YA 3CVBA 3S47A 3GJFB 2O5YL 3U4FA 3O4LD 1OTUC 1U6AH 4HSQA 1VKXA 2QR0B 4HC1L 4FA3A 5IQ7H 5B1BB 3ZGIA 1ID5I 3D51A 4FA7B 4XOCA 4L8CA 4G6AC 4L1GA 1T4WA 2YS4A 3NJFA 3PWUA 3E74A 3WSQH 3G1FA 3SI9A 3BD3A 1MNSA 3O41B 3IFOB 3ABQA 2DL2A 3CSGA 4DM2A 1HKLL 5K39A 1XIMA 2DAVA 4OJAA 5AHNA 1AOHA 3KPPB 1AGDB 3UP1A 2AEIT 4PLOB 1YEEH 1KFEA 2D69A 4E41E 2XIDA 3IDNA 4MHBA 3TO4A 1YA5A 3DHMA 1LWRA 2X0VA 3D39E 4M6OH 4XPAH 4XO5A 4BFRA 1BWWA 2FATL 3H6AA 2C3ZA 2Z29A 1YQVL 2J1WA 4NWTH 3IETB 5LBSH 5J6SA 2HJFB 4NNBA 4NB7A 3GJFA 2K6WA 4AYEC 3VFPB 1EUNA 1QWGA 2XTJB 4F2EA 3RLVA 4WHBA 2QUVA 4KRLB 4RZBA 1J7VR 1QACA 4RGOH 1SY6H 3ESPA 1XC6A 2ED9A 1FV1B 4H4NA 4QRUB 1G7QA 2XN0A 1DWAM 3B9KA 3CG8A 3PWUB 1DQDL 1MG3C 3T3PF 2CJ3A 4NZ5A 4RXFA 5T91A 1VC4A 1AO7E 3N14A 3ZPDA 3NIFB 5E4EB 5GGVH 3W25A 3APYA 2IALB 3IMVA 2WMFA 4I1PA 3KXQA 4KAQH 5D72L 4LQFH 4AEHH 4PVLA 4TL4A 3B8WA 4N0YL 3IDNB 3DARA 4GRLD 3UA3A 5FX3A 3WFLA 2YD4A 5LBVA 1ZT4A 1IM9B 2GJXB 3HO8A 4IMLA 4F79A 4M62H 5JPNA 4YBQD 1LO5A 2HKHH 2J8UF 3VUSA 2AQTA 2P47B 2WD0A 3HRZC 1BG9A 5FWQA 2X4SA 4NX5A 3QQDB 1HZLA 3W6MA 3AXMA 4I3RH 1GOKA 1OGGA 3WLHA 3SY6A 6XIAA 2JB6A 3B8IA 2IFGA 2YZ8A 2ZOWA 3O6DA 3UVIA 1CL7L 4BUQA 4MJIA 3ES6B 3MV9E 1UZDA 4W6XB 4JQIH 1MOEA 4M3KB 5F4XA 3EMQA 1OOAA 1Y07A 3GXMA 4XZWA 2VUKA 4NC1E 4P8QA 2XV3A 2D22A 1MEXL 4J40A 4NAFA 3K4WA 4UM8B 4XBKA 4TOYL 2XVNA 4XKMA 4GQRA 1DJHA 2NW2B 3V7AE 4DPBX 1UUNA 1ZBKA 3UWUA 2F53A 2DQIH 2CO6B 1JG9A 2ZCHL 4I4WB 2JK5A 4YAQB 4OT7A 1ADQA 1B0IA 5B7EA 3RX5A 4BQ5A 4M02A 5TGBB 4FLHA 3G5YA 4LHUD 4BHUA 5IF0A 3QORB 2NLYA 2R7EB 1BD2D 3BPLB 5HHVH 3WIIL 1MCFA 4F1ZA 1MCIA 1MHHA 1WE5A 1XYLA 3JVFC 1L2UA 1TQTA 4IMKC 2OZ4A 4RKAA 4P2OC 2BRQA 1PDYA 1X39A 3ESUF 1KGCD 2HJFA 3GXDA 4WI8A 3ANYA 3E0WA 5L2KB 4NCC1 2PP8A 1D9EA 5DURB 2O4QA 3ERPA 4C6IA 4DK3A 2DW7A 3UJTL 4EDXB 5T9BG 3VFWB 3RNDA 3WMLA 3B7TA 3WE6B 4ZS7L 5DRXB 1E6SM 4PREA 1KG0A 2FLMA 2V5RA 5GRYA 3LRGA 1AE6L 3OGCA 5GRJH 4AQ1A 1HNFA 4G9PA 4AD5A 3FCSB 1UZ8A 2QADB 3DSFH 3SDXA 2JELL 3AUJA 2OKOA 5D2LF 1XF4B 4Z7UB 5EORH 5I66B 3KPRB 3N1AA 1NCAH 1P7QD 2OR7A 5AY7A 2P7TB 1CLOH 4NUGH 2LLLA 1M3IA 3NSYA 4AYFB 4WDWA 5EIVA 4LSPH 1P0KA 3FULA 3PANA 4Y16D 5DA4A 5I71B 3VSVA 2DYPA 3VGAC 4XCFH 1ZP3A 2VX4A 2Y70A 5IT2H 3MW7A 4OBTA 1ADSA 3M1BB 3NL3A 2BSLA 2HXAA 2YAOA 1A7OL 5DRXA 5J6HA 2AS5M 1G7IA 4GW1B 1HJQA 4EIUA 2E86A 3QDJB 4MNQD 4NBXB 1FGVL 1HL4A 3D50A 3VUAA 3A6BL 4HBCH 5EUOE 2UY7B 1ITUA 1YEKL 4P9MH 1YE6A 4A68A 4H25A 2G2PA 3BUBA 3VQ2C 4PJBE 3DUSB 5DO2D 3IDUA 2W9DH 2A9CA 5DFTA 4GG8A 5L4IA 2GGIA 3ATZA 1I8MB 2R59A 4TVPH 3X11B 3TROA 1UOLA 5KAQG 3RI5F 1GZJA 3QH2A 4PCFA 5ID0B 2R7EA 3HZVA 4EI5A 4HKXA 4FQ1H 5DJCA 5DHEA 3BP4A 3ROLB 3U83A 4FADA 5FAGA 5C09E 3QUHA 2D20A 4JO4H 4HJGA 3W7JA 1LL1A 4TNEA 2DKSA 1X9QA 1AGEA 3ATFA 1T1YA 3PHOB 5C8JA 4DJDA 3MX0A 3K7UA 1W5PA 2NV1A 1XCTB 5H2BB 2Z1VA 3P0VL 4S0TD 1Y1UA 3MP5A 4OGAC 1RLCL 4TSAL 4X5XA 4JNXA 3CJJA 1RZ7L 1BFOB 3MOBH 4CC4A 1X5GA 1GQLA 5F7LB 3KRUA 3TA3A 1OYAA 3FEQA 3NEHA 3NL5A 4MB3A 5CJQL 1V0MA 2NY4D 3MCKA 4XN8A 1IWBA 2HPOA 3HE6A 2DZXA 4TQEL 1SF5A 2WBJD 4NPJA 3UO8B 4OLYL 4K9EH 1I8IB 1SYTA 1KTKE 4OJCA 4DKTA 3VIMA 3W85A 5GIRB 1YRRA 3X3FH 1Y5XA 3C2VA 4GQZA 1LEKA 4Q7DA 2IWFA 5D4IA 3TYGH 3PWPA 3KP0A 4JFEB 3LZFH 3E1F1 3KXFB 4R96B 3HPAA 1QKZH 2OAAA 3FCUB 1GYVA 3A4DA 4XBGB 2YB1A 5ITFB 5L8KB 1S7VA 1XDMA 2DQCH 4Y96A 3P11L 4P2CG 1R9YA 3TNOA 4ILDA 1THAA 1G84A 4Z7QB 1C9SA 4NQED 1I9CB 3C6LB 2D3LA 1UWQA 5C2CA 4JNYA 3RWGB 5BZDB 2B8OT 5F6IC 3QQXA 2UZXA 1PS9A 1P6WA 4KUZH 1QSED 4B5XA 1E6NA 2OI9B 3EH5B 1O7DC 4FXGB 4TIMA 5GRUH 5GIRA 4G71B 3DMMD 1CB7B 1OSPL 3H1ZA 3P77A 4N8CH 2VRQA 1NCCL 4QRRE 3FMGL 3VFOB 2Z8VC 3BESR 4CN1A 4KJQD 3S46A 4XAKE 3L1OL 4NJAL 1G1KA 1LO2L 4C56E 1OX4A 3BUQA 1VRDA 2DSUA 4A3UA 3OSKA 3MMDA 1H50A 4Z7QE 4PGEB 5D5MA 1O5DT 1NANI 1T3FA 3GSXA 3NJXA 5CCHE 4NKCA 1IM3A 1I1AC 4FHAA 1PX4A 43C9A 4M80A 4EN3B 1TG7A 2Y7MA 3N3MA 2IDSA 3V3WA 4G5ZL 1I85A 3KXFE 4Z1CA 1DSYA 2BSRB 1JCTA 2WLZA 2A73B 3T09A 1G9MH 5E5MA 1NBZB 3V5HB 2IG2H 1GZGA 4NT0A 1H6UA 5CZTA 1ZSXA 3IN2A 4MLSA 4OGZA 1M7IB 3QRHA 3CQPA 3BEVA 4M61A 3BH9B 4IP5A 2B4CH 2N7SA 4RW3A 4YYFA 4KFZC 1NGPH 5JPMB 4A2HA 3R4IA 3V5CA 4F33A 4AC1X 3CU7A 5CCGE 2R56H 1EBAA 4P2OA 2ZZ2A 1HXYA 4BHYA 2UZIH 3FBKA 5DEJA 1WAAA 4XMZA 3V9CA 3LX9A 2FEDC 4PMJA 4IUGA 5EPDA 2CBQA 5TDPB 4NJJA 3NP3A 3H2NA 4PP2A 3S5LB 1GAFL 2YRBA 3OXSA 5EH1A 4KMLB 2JIEA 1A7PL 4ZUSA 3M41A 4G3YL 4QMEA 4L3FA 2HBXA 3LS4H 3CQIA 4LFYA 1I3VA 1BXNA 3WEXB 3ZTDC 4AVNA 4OR1A 1QHQA 1XEDA 2IG2L 1IBFA 1XLFA 1EH9A 5ES4B 8A3HA 4NJGA 4GH7B 1HYRC 1CFSA 1KCKA 2F8OA 1GPOH 4JLRA 4K7PH 1VKFA 5HULA 1VZWA 4FXGA 1FZMA 3VXMD 2BNQE 1TTPA 1DP0A 3ESVF 2K3HA 3W7OA 3NQ7A 1AHKA 2EE3A 3PUCA 4N7QA 4NQQA 3L3HA 1DJGA 1ZGDA 3H42L 3OTRA 4EP8C 3RYSA 3VZXA 2VDHA 4B2DA 2HMCA 3WMSA 7ENLA 4GKSA 2BNQD 1DJSA 3CFEB 3KBMA 4PW9A 1E9OA 2A4ZA 5AB2A 5F72S 4JNZA 4IRSD 2VJXA 3E3QC 2MPVA 1IXOA 2ZBTA 5LGHL 2ZZ4A 1H3UA 3G6JB 3STGA 4E38A 1CFTB 1IVLA 2IQ9H 3VFRA 5T1JA 1KM3A 3P4MB 1YNKL 2VUYA 1Q6OA 1IIKA 2I27N 3C5SA 3JV0A 4MDRA 3MA9L 2WVVA 5D2WA 3LZOA 1KSRA 4ORMA 3TW7A 5A6JA 5L88H 2FT8A 4FQPA 4WW2C 2WXOA 4EOWH 3CK0H 3QWRA 1QNIA 1WAEA 5F0LB 5IFJB 5JXAL 5AOUA 3IK4A 2BZ7A 5E5RB 1W56A 5D2VA 3TBSA 1NUGA 5D7SH 4H6EA 4JEGB 4NPYA 3AXXA 3WH8A 3WD0A 4OD1L 1U58B 1I2NA 1TT6A 3K5SA 3CN2A 3QSKB 1S5NA 2D2GA 2N7AA 3CHEA 4HIJB 4OIBA 5FIEA 4UR7A 4A29A 3IWUA 4JM2D 3SDOA 4IU2B 1BRLA 5G2IA 1TX0A 1JVOA 1MFEL 4MDJA 1ZBWA 5D6CA 3ARDB 3VILA 1R87A 1E5CA 3O8XB 2G95A 3GMMB 1W17A 1BGXH 4GXMA 4ZTOL 1LT8A 5G2WA 4JN2B 2XLLA 2VX6A 1M7JA 2QGCA 2FGZA 1B3VA 1Y5VA 3PF3A 4PMOA 2IJ0C 1E70M 1SZNA 4DWDA 4Q4PA 3UL4A 2BPBA 2JTYA 3O06A 5EDXA 4YSTA 5L9FA 3II3A 4I9MA 2JELH 5D7LE 3WKPA 1FL3A 1TJHL 3IDGA 5IB4B 5C09D 1Z8AA 1U8IB 1MDTA 3HG3A 2GUUA 2NY2B 1N8IA 4GX9A 1VB9A 4NUGL 2WMGA 2R1YB 2DT0A 1XB3A 2NTSP 3LPFA 4LNCA 3RB7A 3NA9H 3DZ1A 5K59F 5AC8A 5DQDH 4PJHB 3SGZA 5DMIH 3MMWA 1OX6A 3P3YA 3ITLA 3KBEA 1W6WA 2P26A 5F7DB 3ZT5A 2IW0A 4HNCA 5BNXD 5A8QA 5B39B 3C5SB 2FJGB 5GGVY 2O7QA 3T71A 1B3YA 3R6IA 4JPIA 4E36A 2ZRUA 4N2LA 2RTTA 3CBKB 5D7JD 4PHZA 1CLYL 3ZTCC 1R3JA 3U36A 2LV4A 2VN5A 2BDQA 3AU6A 4BSJA 7XIMA 2OP4H 1PY9A 4XNUH 5D70L 4EIGB 4ZW5A 4BUHA 4IQLA 2WWKO 5D8JL 1NM9A 4G1EA 5CPMA 1SSDA 4TUFA 3PPSA 1AFVL 1JUKA 2ZZUT 1N68A 4Z3FA 4QNPF 3LCHA 3DBSA 3FUDA 2OLAA 4GI9A 2ZADA 5LHEA 1YPZF 4KBPA 3LHYA 2BMBA 5DZNA 3LXBA 4IOFC 3DXAD 4N2DA 1C5CL 1BQLL 3O3RA 3FQRA 1ZLWH 4M1RA 3SO7A 3JV5A 5MP6L 5LSMA 1HCZA 4JFSA 1BOYA 1JIBA 3CHPA 1CO1A 2E4FA 2NW3A 1JFXA 4LSSH 3PUEA 3DXAE 1JNNL 2X4QB 3S5LG 4OF6A 4FABH 4RE2A 4KO6A 1PL9A 2WZEA 5C0BD 3NPZB 4US6A 3C08H 4M4RA 4H88H 4HKZB 4DWSC 4H1LB 1GAFH 2QVNA 1C29A 4B3KA 5MKGB 3QPZA 3FDWA 3IB4A 3FV9A 2YL6A 4MNQE 1ERNA 1ZPUA 4U1KB 2XIQA 2PNDA 3Q67A 4K37A 3SKNB 4N6EA 5AZ2L 2CBMA 3L66A 3C5QA 4GRMA 2A9DA 4QYOA 8FABA 4U2YA 3ARFB 1S8DA 1BQRA 4Q6IB 15C8L 4JCMA 3U1SH 4LT7A 1EEPA 2MUCA 5CF3A 1G5AA 2KZWA 4P5RA 2EVGA 4N9CA 1KC5L 5HUOA 3CYVA 4IIGA 5ELIA 5L2KD 1MFVA 2OMYB 3CMOL 2WQAA 7TAAA 1HKLH 3T77B 4HAGA 3ONCA 3GSQB 3G5XB 3KL0A 4X61A 3VWKB 4G2DA 1WDSA 4GPVA 2EEFA 1CD0A 1JF5A 3QHTC 3L7RA 4H7ZA 3TJXA 4ZBJA 2XJ7A 2BVDA 2QT6A 1MEIA 2O56A 3BV7A 1U8KB 1L5GA 2IGLA 4MFDA 4OCYH 3L3GA 3MBXL 1J9TA 3QNZB 4H8WC 2Y61A 3WYRA 4WI0A 4GY7A 3FTYA 1GW0A 3THMH 3NQIA 2WSPA 3ESOA 2ZDRA 2HT2C 4RA3A 4XCFL 2D3NA 4A1RA 2P0OA 4PJ9D 2DZTA 3FUFA 3OJDA 5BU6A 3SSZA 1DQDH 3VDBA 1DCEA 2BNJA 2VM8A 3CC1A 5GGSA 3SRHA 2R1NA 2GTWA 3QJFA 5GISH 2E7HA 2FX9L 5D7KE 3SUWA 2AABL 5K93A 4Q9QL 3DFNA 4H9UA 4LDLB 2DP3A 1KEML 3VABA 2FSDA 2OJEB 3ATDA 2X8RA 2ARWA 3AB0C 4AZ8B 3WD1A 4F2MB 2JXMB 2WHMA 2JNZA 3NCEB 1FWHC 1HI6A 4LLMA 2DQHH 4N90D 2ZP9A 4JZJA 1XIHA 1XLIA 2QPDB 1C3FA 2FQIA 4PR4A 2NR6C 4I3RL 4XBSA 3GMRB 5EUKA 5I75C 3UGRA 3MRQB 1FWRA 4WV1B 4KXZI 3K1GA 3W27A 1JZ2A 1RJYB 4R4NC 5KSBB 1LP9E 1WPCA 3WO3B 1LTXA 2P1FA 3QARA 3ZO9A 4F15B 5C0JB 1B2WL 4K15A 4UTCA 2VD8A 4NZ4A 1LD9A 3AS2A 2RAMA 3P5YA 3FSUA 5HVHB 2WKGA 4HK5A 4W84A 1CLZH 2Z7YA 5FYJL 2XA3A 3HZMB 4WO4A 3GC3A 5LGZA 4MBRA 4GQGA 1RZIA 4HJGB 1FSKC 3I9AA 2OCJA 5HDLA 1KXVA 2X2HA 3CDFA 1X5YA 1ZB5A 1XF1A 3G1AA 1UH3A 3KCWA 4DOHE 1U8KA 1FRGL 1NCDH 1UT2A 2W1NA 1NBCA 2Q8BL 3LQZB 2LT9A 3ECBA 4GKNA 3PDGA 4GLRI 4Z18A 1SVCP 1P0NA 4D0CB 1FZKB 2Q8AL 2DU2A 2DT1A 4K3JL 1UJQA 1CDYA 5EZPA 2CGZA 1FHUA 2PTTB 3STBA 1NCIA 3MCKB 1JZ6A 4QISA 1RQ5A 3LSOB 2W38A 3PHQB 1TWZA 3KCJA 4S0SD 3FCBA 1QA9B 3WY3A 3ZKNC 4WEUD 3KPTA 1R6WA 1E7VA 2YKLL 3KLAA 1AY1L 5H37H 2WO2B 1B4LA 4HMEA 1J9RA 3UGUA 3SYPA 3USBA 3IRCA 4G43B 1UP3A 3E0VA 2FRGP 5HDWA 3E12A 4L7ZA 2PWVA 1DL7H 3K6NA 3R0MA 1RIHL 3H6OA 4NFDA 4JKNA 3Q8AA 2EO1A 3QWNA 3UTOA 4F2ME 1P4CA 2MIZA 3TP4A 5B7YA 3NFSH 2ZQKA 1CS6A 1KBGL 4N3TA 5H6HA 4J8RB 1T80A 2DQUL 1SW3A 5GRVL 1AQMA 4BH7A 1OIMA 3VINA 5H8MA 1BWKA 1V02E 3MU7A 4QNEA 3VQLA 4UV4L 3RL2A 3UA4A 1QEWB 3LN5B 3BLOA 1M7OA 3MV8A 2BX5A 1N6VA 1TZ9A 3B9VA 3L81A 4L48A 3V4LA 4XAZA 3VNDA 1MRFL 1G7PA 3GVWA 4B3ZA 3OWEA 3BGFC 2E76C 1DVTA 4I85A 4IDJL 4MJ6B 5EEYA 3G6AB 4IX0A 2AJUH 1EJ8A 2Q8LA 4WUUB 5SWQA 1DO6A 4AIEA 1K8ZA 2A3AA 2R8SH 5F9WB 4JRYA 2X87A 3QCTL 3FL7A 2TSAA 2J24A 3ENLA 2J73A 2XDHA 1RZQA 4LSUL 4AIZA 5J11C 3DETC 1F3XA 3AU0A 3RGVB 2OXGB 3KPLA 4DNMA 2Y1YA 3HFTA 1FHLA 3BN9D 2R23B 3MTRA 2C5DC 3CFUA 3BW9A 1A9EB 3ECVA 4JXCA 4Y9BA 4QY8A 3NCYP 4RISH 3CDGB 3MRIB 2OMTB 5GS1A 1I7UA 4H26B 4MHHI 4PW3A 3CXFA 5EMUA 1XX9C 2R0LL 2ZX9A 3G6DL 4XN9A 3T6VA 5C0CE 1UC6A 5I6XC 3DBPA 3NSNA 4FI7A 3ARBB 3SGJC 5L4FA 4PCTA 4GVHA 4DPCX 3CCHB 3SW6A 4DAIA 1ZTXE 1EWDA 1O9VA 5B4MD 3HPXA 1BVNT 2JQZA 5AVVB 4JRYB 3KS6A 4IQJA 2WMKA 1VPQA 5B80A 4KI5F 1E0WA 4PPTA 3P4NB 3BPCB 2DQDL 3RVXC 3FUJA 4EQ2A 1UR3M 1D9KA 3LIZA 1YTKA 5J3HC 1ZGLA 4Y1AE 4WV1C 5FS5A 1BVLA 1KYFA 1SM3L 3GIVB 4QRAA 2QVTA 4HPYH 3WTYA 3UD6A 2A3HA 4AD4A 3LHAA 1I31A 1TEFA 2EKSB 5TGBA 4PRRA 3DXAB 4RISL 1OT2A 1QNQA 2YRLA 4OBSA 5HHOD 3KVJA 3MZNA 5IGXH 5TF0A 2CCWA 1CI3M 1UCWA 5C0CA 2V3FA 5I3DA 2GHWB 1Q9WA 3L7FB 1MCOH 4JN6A 2PDBA 3REQB 3GHRA 5I82A 2A79A 4BQ8A 1FWXA 5CILH 4RCAA 4UTBA 2Y3NA 2VDLB 1CXKA 4NZRH 1V7YA 2DQWA 2OTWA 2DMHA 3TV8A 3UTTB 5CIPB 3C52A 4HSCX 4ODTH 1GKEA 3CK0L 1FWNA 2FPYA 2OSXA 4G6AD 2IGFH 3WS3A 1Q6QA 1UB5A 3BYYA 2FR4B 2EYTB 4MYPA 1HHKA 1HQTA 4LOEA 4KPLA 3WJZA 4OCSL 4MZ1A 4BFGA 3FS9A 4O15A 3QUZC 3O1NA 1NCUA 1G9MC 4LBEB 4P7NA 4XVSL 2PW1B 3MB9A 4E8DA 5B3NA 4MAYD 3C8FA 3EGJA 1KB5L 1HHGA 1YN7B 2BP0B 2JJWA 3PU7A 4Y5XB 2OJZH 5KW9L 1J5OH 4I9WD 1FH9A 4FFYL 4YH6A 2ABAA 4BA0A 1OTSD 1XIJA 4AC7C 3UTSD 3BARA 1OGAA 1N4XL 1NOFA 1YEDA 2W0PA 3M1BA 3BUTA 4ZPTA 1J1PL 5DUPH 5GSRA 2FD6L 3DGRA 2AL2A 1S2AA 2WCSA 4PBDA 4JJOA 1TENA 3QBTB 1ORQA 3RITA 1U3ZA 4H25B 4DGYH 4HUNB 3ITOA 3ZRFC 1H3XA 1JMXA 1OCWL 1NGWA 1KB9K 4L3EA 2Y7GA 4OSUL 1PD1A 2DIAA 2HS8A 4DO5A 3MRKA 1RK0B 2D8KA 1GSKA 4OIIH 3CL7A 5CO1A 2OODA 2VWSA 1FUNA 1JAKA 4PJ7B 3OZ9H 1E0TA 3ZM8A 3FNKA 4GAYA 1SN5A 4HKBB 1SGJA 3DX7B 3WD5L 2JI1A 1ILSA 5H4ZA 1J93A 3HKZA 2VE6A 2WBXA 1JWUB 1FJ1A 4GIEA 1OP5H 2OTUA 1P9MC 3EJPA 3QUKB 5JIHA 1N59B 4Y19D 2QCNA 3GR8A 1VIZA 4HUMB 2E7FA 4HGWA 4IFKB 1K6QL 5LXGL 3TQ0A 4B92A 4U3XA 3ETTA 3C60D 3N40P 5CJBA 3GNRA 2TPSA 3UJRA 1I9EA 2BFGA 1CG9B 2JCWA 2R1YA 2BVTA 2DQJL 4XPTH 3MZ2A 2CO6A 5JXED 2CLKA 1UM6H 4K7PX 3TA3B 4M7TA 4GUCA 4N4QA 4GXFA 5CINL 1SUHA 4MTVA 3VGHA 4DEUA 3K6DA 1E2ZA 5INDB 1KLFA 4J6RL 4TNFA 1J6PA 1SBSL 3BT2H 3W7CA 1PTGA 2FUQA 3W1MA 1AIZA 1KNOB 2D4DA 3FU9A 3SGDH 3ABSA 2W9MA 2B5IB 3H9SB 1F61A 1E6JH 1DBMH 1OSZA 1L6PA 5AHIA 3OKNB 4APXA 4A38A 2WY3B 2W66A 1I0BA 4K2UL 1UTDA 1UOVA 4JTFA 3RX2A 4LP4A 3OG2A 5DYOA 3V0VA 5C71A 1CTNA 1Q4NX 2WM0A 5ID1B 4IWWA 1W0WB 1RZKL 2MHAB 5A2LH 1PQZB 3X17A 1J87A 1RH8A 1VACA 1OP5K 1LQ0A 3GHUA 2E7MA 4GSQA 2X2GA 4QXGL 4HQQL 4LAMA 4MZ8A 4DYJA 5FOJA 5CKAA 1ZE3C 3AIRA 5EC2B 2UZXB 2ZTBA 5D9SA 3C5JA 4Z0XB 3BICA 3CZGA 3T0DA 4LHUB 1S7QA 2ZUQB 3TWYA 4GAYB 4GKLA 4HIEA 4HKBA 5HJ3B 3GSUB 3V6FB 4GLEA 1I2QA 5LGJB 2M83A 3P69A 3VFOA 1TPXC 3L6FA 1O5QA 2ZG1A 4LQFL 4AEHL 2RKXA 2X4QA 3VKDA 1AAJA 5AZ2H 2DZEA 3WBAA 3WNLA 4NZJA 2X41A 3P9MA 1TJ0A 4Y9PA 4AH7A 3AGVA 2XA8H 3OTTA 2C3VA 2VD9A 2QQQA 3VXOA 2OZ0A 3SOBL 3MBDA 4IMEA 2NY1D 5BW6A 1JXGA 3X14B 3DKLA 4WRHA 2KC0A 4ILSA 1Q0YH 4EE2A 2Z1WA 1PPIA 3HAEA 4BA8A 4E9QA 5KYUA 2BJMH 3PUGA 4K1GA 1KIRA 2NTFA 1H5BC 3K71A 3UWQA 4LHUA 5JA8B 2FB4H 1S7TA 4LUYA 2AQ2A 4PBVC 3WQGA 4ENED 1H6TA 3CFNA 4ZMGA 1XL4A 4LCCB 4UF7C 3I65A 1PFCA 5ENWA 4UR9A 3W71A 1MHCA 3X1NA 5EBAA 3MACL 1GOOA 1GA2A 4BM7A 2ACRA 2A1WL 2AKRA 1RAMA 3L9CA 4OCYL 2H41A 3MSYA 4GGHA 2VLJD 4D9RD 1QPQA 1AGEB 2EDFA 5C8JB 2C0HA 3TOYA 3LYRA 3N6QA 3D4CA 2DZPA 2EYRB 3KWWB 2V0TA 1JHKL 3AU2A 3OZYA 2EIMB 1YECL 1COBA 2YOAA 3HEIB 1KN4L 2HT4C 2XTKA 4ODTL 3HBGA 5EL1A 2C9VA 1ZWIB 3BDBA 4X5XB 3WFDL 2BNUA 2NXIA 3TNMA 4L5ZA 3CSPA 3PGFL 4PB0L 4A8LA 3SDAC 2XZCL 3LPWA 5J4MA 3F84A 5DFAA 3QQ3B 1PE31 1W1YA 2AABH 5I28A 5DSCB 2EDDA 2V7NB 1LP9F 4IOSA 4OIAA 4E2DA 3ZW3A 3QYCA 5FPIA 1NEPA 1REIA 2XH7A 1R86A 2D31B 4QDPA 3CZSA 2VQ1A 5LCVL 2P1YA 3P0GB 5ESQB 4Y16A 3GG1A 4R85A 2AJ3B 4H88L 5CZXD 3S42A 5D2NB 3QY8A 5FL1A 4NRXA 5A3IC 1VEOA 2JI3A 1LO3L 4IPPA 3WMBA 5IJBC 3TQVA 2EYRA 2PDUA 1K4CA 1CD8A 1XB6A 3P3RA 3W11D 5BOJA 1ZK5A 3TJEH 3B83A 3UJEA 1PCPA 3BFOA 3F58H 3C2RA 3QKZA 4AVOA 2H3KA 3DOSB 2ZF8A 1RUKL 1H9DA 3QQ3A 2G30A 2XWZA 4J3VA 4MNGE 1M9WA 3J27A 3PNWA 4OU3A 4YK4C 3KPQB 4XO4A 3TIEA 3FOMA 4K71C 3A64A 5CSRA 4JFDA 5FUZH 4JANB 2X9XA 4AV5A 3E0FA 4XN4A 1DVYA 1BSIA 3KW8A 4P9ML 5FL0A 2B4GA 1RK5A 2PCEA 3WCYA 3MCNA 4IK6A 2WZTA 4NL1A 1RVFL 4K94L 3NN8B 1BXXA 3IUHA 3RUBL 5JLZB 2WXIA 5KVDH 1CW2A 2NY7L 3BZ4A 2V9RA 3HG1D 4RFNC 4UAOC 3TVMD 1OZMA 1K6QH 5D5MB 5LXGH 3JWNH 3WHXB 3ELQA 1R38A 2E1DA 1RJRA 3KBVA 4LJ3A 3SJ3A 1NDYA 1SDAB 4H0IA 3UTSE 1M04A 3CB8A 3Q9QA 4M3PA 4DBDA 3TJLA 4S3CA 4UQCA 4P4KD 4PYSA 1MZZA 1S9YA 4ZMQA 5HI3C 1HJUA 1XF3B 4PYHA 3U0WH 4R5EA 3R8HA 3QZOA 2ERJB 4LB8A 2NQLA 3QV7A 1XYMA 2EEDA 1MEXH 3NN8A 4P2RE 2BTMA 4HZ1A 3GFUA 3TVMB 3S4SB 4PJDE 4LMQE 4NC2B 3MUY1 2BVWA 1HXYB 2J78A 4HSOA 4Y5YC 3SGKC 5I6MA 2OPCA 3CUPB 5BUGA 4X0NA 1KB9J 2EH8H 4GO6B 4OZFG 1H0IA 3UTSA 4L8SB 7REQA 4YHOH 4F7KA 1B3JA 4HALA 1YEJH 1NTHA 1YDVA 4D3CH 5J7CC 1IBGH 1A6UL 4NQEA 1FCQA 5K59E 4OLZH 4PJHA 3LRSB 4ZOAA 2VJ8A 4HIIB 3STLA 1YMME 4FQCL 1FYHB 1A7NH 1PYFA 2XSAA 1T6BX 2UVFA 3L7EA 1RJPA 2CBTA 4Y2DB 4IISA 4XIAA 2IBGA 4FZEH 4JE0A 5FJTA 4HWBH 4J8RA 1V0NA 1TPDA 3V52L 2Z7KA 3N91A 3MBEC 1JD9A 1W32A 1QNZH 2YBTA 1OAYH 5C92A 1R3LA 2EXYC 4JCLA 4PCSA 5BWFA 4QRPB 2KQNA 5IV2B 4X6DB 3V4VH 3VH8G 3MJYA 2G9HB 3OPZL 3IGUA 3TKFA 2O6EA 4RFOH 3PL6C 3AS0A 3WDHA 3MCOA 3F04A 2ISWA 4W5ZA 3VOCA 3WQVA 2XFGB 4K68A 4E9YA 1D2OA 3LK6A 2VGBA 4C6BA 2R82A 3IEAA 2C1PA 4XPGL 4H9YA 1JS4A 2KLSA 5E95B 1R9FA 5ACMA 1ANUA 3OZ9L 2O61A 2C71A 3DH7A 3S1VA 4R0LC 1UD3A 4MVBD 3EUUA 4ELMA 3N1MC 3NK3A 4IG2B 4YMPA 1AMXA 4M5YH