1HI7A

Nmr solution structure of the disulphide-linked homodimer of human tff1, 10 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords PS2 PROTEIN
publication title The Solution Structure of the Disulphide-Linked Dimeric of the Human Trefoil Protein Tff1
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 1hi7A00
1E9TA 3L4TA 1PSPA 1PCPA 3TONA 2PSPA 3L4XA 3LPPA 3TOPA 3L4VA 3L4UA 1HI7A 2QLYA 1PS2A 2QMJA 3L4WA 3L4ZA 3CTTA 3LPOA 3L4YA 1PE31
chains in the Genus database with same CATH superfamily
1E9TA 3L4TA 1PSPA 1PCPA 3TONA 2PSPA 3L4XA 3LPPA 3TOPA 3L4VA 3L4UA 1HI7A 2QLYA 1PS2A 2QMJA 1XU6A 3L4WA 3L4ZA 3CTTA 3LPOA 3L4YA 1PE31
chains in the Genus database with same CATH topology
1E9TA 3L4TA 1PSPA 1PCPA 3TONA 2PSPA 3L4XA 3LPPA 3TOPA 3L4VA 3L4UA 1HI7A 2QLYA 1PS2A 2QMJA 3L4WA 3L4ZA 3CTTA 3LPOA 3L4YA 1PE31
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E9T A;  3L4T A;  1PSP A;  1PCP A;  3TON A;  2PSP A;  3L4X A;  3LPP A;  3TOP A;  3L4V A;  3L4U A;  1HI7 A;  2QLY A;  1PS2 A;  2QMJ A;  3L4W A;  3L4Z A;  3CTT A;  3LPO A;  3L4Y A;  1PE3 1; 
#chains in the Genus database with same CATH topology
 1E9T A;  3L4T A;  1PSP A;  1PCP A;  3TON A;  2PSP A;  3L4X A;  3LPP A;  3TOP A;  3L4V A;  3L4U A;  1HI7 A;  2QLY A;  1PS2 A;  2QMJ A;  1XU6 A;  3L4W A;  3L4Z A;  3CTT A;  3LPO A;  3L4Y A;  1PE3 1; 
#chains in the Genus database with same CATH homology
 1E9T A;  3L4T A;  1PSP A;  1PCP A;  3TON A;  2PSP A;  3L4X A;  3LPP A;  3TOP A;  3L4V A;  3L4U A;  1HI7 A;  2QLY A;  1PS2 A;  2QMJ A;  3L4W A;  3L4Z A;  3CTT A;  3LPO A;  3L4Y A;  1PE3 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...