The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
135
|
structure length |
135
|
Chain Sequence |
GPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The structure of PknB extracellular PASTA domain from mycobacterium tuberculosis suggests a ligand-dependent kinase activation
pubmed doi rcsb |
| molecule keywords |
Serine/threonine-protein kinase pknB
|
| molecule tags |
Transferase
|
| source organism |
Mycobacterium tuberculosis
|
| total genus |
31
|
| structure length |
135
|
| sequence length |
135
|
| ec nomenclature |
ec
2.7.11.1: Non-specific serine/threonine protein kinase. |
| pdb deposition date | 2010-02-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03793 | PASTA | PASTA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A | ||
| Alpha Beta | 2-Layer Sandwich | Trypsin Inhibitor V; Chain A | Trypsin Inhibitor V; Chain A |
#chains in the Genus database with same CATH superfamily 2KUE A; 5E0Z A; 2KUF A; 5E10 A; 2KUD A; 3M9G A; 3PY9 A; 3OUV A; 5E0Y A; 2KUI A; 2MGV A; #chains in the Genus database with same CATH topology 1Y4A I; 1COA I; 5E0Z A; 3TEC I; 1Y48 I; 1VBW A; 1Y34 I; 1ACB I; 1YPA I; 1HYM A; 1Y1K I; 5E10 A; 2SNI I; 1TEC I; 1CIS A; 2MGV A; 4B2C B; 1CSE I; 2KUF A; 1TO1 I; 3M9G A; 1DWM A; 1TIN A; 1TM7 I; 3OUV A; 1MIT A; 1Y4D I; 4B2B B; 1TO2 I; 2SEC I; 2KUI A; 1Y3C I; 2KUE A; 1Y3D I; 2KUD A; 3PY9 A; 4H4F B; 1TM3 I; 1SIB I; 1YPC I; 3W0E A; 1TM5 I; 5FFN I; 1Y3B I; 5E0Y A; 1YPB I; 3RDY A; 1TMG I; 1TM1 I; 2CI2 I; 4B2A B; 5FBZ B; 1MEE I; 1LW6 I; 4B1T B; 2TEC I; 1TM4 I; 1Y33 I; 1EGL A; 3W0D A; 3CI2 A; 1Y3F I; 1SBN I; 3RDZ C; #chains in the Genus database with same CATH homology 2KUE A; 5E0Z A; 2KUF A; 5E10 A; 2KUD A; 3M9G A; 3PY9 A; 3OUV A; 5E0Y A; 2KUI A; 2MGV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
